>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.84 E-value=1.2e-20 Score=167.42 Aligned_cols=109 Identities=33% Similarity=0.595 Sum_probs=100.0 Q ss_pred CCCEEEECCCCHHHHHHHHHHHCCCCEEEECCCCEEEEEEEEHHHHC-CC---------------CCCCCCCCCCCCCCC Q ss_conf 28789946543034565667605041678668860278872354500-14---------------344672440026786 Q gi|254780889|r 100 VNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVR-FA---------------SNAQQAVGELMTRNL 163 (493) Q Consensus 100 ~dPVti~pd~TI~ea~~lm~~~~is~iPVVD~~~gkLiGIVT~rDir-~~---------------~~~~~~V~eiMt~~l 163 (493) T Consensus 1 r~vvtv~~~~tl~ea~~~m~~~~v~~~PVvd~~~~~lvGiit~~Di~~~~~~~~~~~~~~~~~~~~~~~~~v~~im~~~v 80 (125) T cd04631 1 KDVVTVPPTTPIMEAAKIMVRNGFRRLPVVDEGTGKLVGIITATDILKYLGGGEKFNKIKTGNGLEAINEPVRSIMTRNV 80 (125) T ss_pred CCCEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCCEEEEEEHHHHHHHHHCCCCCCHHHHCCCHHHCCCCHHHHCCCCC T ss_conf 99779799094999999999839988999979999599999999999987335431012101102321789999566898 Q ss_pred CCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEECCCHHC Q ss_conf 325730358999999986553306457479978688980210001 Q gi|254780889|r 164 ITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERS 208 (493) Q Consensus 164 itv~~~~~l~eA~~iM~~~ki~~LPVVDe~g~LvGIIT~~DIlk~ 208 (493) T Consensus 81 ~tv~~~~~l~~a~~~m~~~~i~~lpVvd~~g~~~GiIt~~DilrA 125 (125) T cd04631 81 ITITPDDSIKDAAELMLEKRVGGLPVVDDDGKLVGIVTERDLLKA 125 (125) T ss_pred EEECCCCCHHHHHHHHHHCCCCEEEEEECCCEEEEEEEHHHHHCC T ss_conf 899799998999999986395099999589939999988997369

HHsearch alignment for GI: 254780889 and conserved domain: cd04631