>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.80 E-value=3.5e-19 Score=157.01 Aligned_cols=107 Identities=28% Similarity=0.414 Sum_probs=92.9 Q ss_pred CCCEEEECCCCHHHHHHHHHHHCCCCEEEECCCCEEEEEEEEHHHHCCC------CCCCCCCCC------CCCCCCCCCC Q ss_conf 2878994654303456566760504167866886027887235450014------344672440------0267863257 Q gi|254780889|r 100 VNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFA------SNAQQAVGE------LMTRNLITVK 167 (493) Q Consensus 100 ~dPVti~pd~TI~ea~~lm~~~~is~iPVVD~~~gkLiGIVT~rDir~~------~~~~~~V~e------iMt~~litv~ 167 (493) T Consensus 1 r~Vitv~pd~~l~da~~lm~~~~is~lPVVD~~-g~lvGiis~~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~t~~ 79 (120) T cd04641 1 KNIATARPDTPLIDVLDMLVERRVSALPIVDEN-GKVVDVYSRFDVINLAKEGAYNNLDLTVGEALERRSQDFEGVRTCS 79 (120) T ss_pred CCCEEECCCCCHHHHHHHHHHCCCCEEEEECCC-CCEEEEEEHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCCCCEEEC T ss_conf 997898998999999999998098669998789-9698997599999887515544344208776421555547856989 Q ss_pred CCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEECCCHH Q ss_conf 3035899999998655330645747997868898021000 Q gi|254780889|r 168 KTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIER 207 (493) Q Consensus 168 ~~~~l~eA~~iM~~~ki~~LPVVDe~g~LvGIIT~~DIlk 207 (493) T Consensus 80 ~~~~l~~~~~~m~~~~i~rlpVVD~~~rlvGiIs~~Dilr 119 (120) T cd04641 80 PDDCLRTIFDLIVKARVHRLVVVDENKRVEGIISLSDILQ 119 (120) T ss_pred CCCCHHHHHHHHHHCCCCEEEEECCCCEEEEEEEHHHHHC T ss_conf 9997999999999849857989989997999998688238

HHsearch alignment for GI: 254780889 and conserved domain: cd04641