RPSBLAST alignment for GI: 254780889 and conserved domain: cd04597

>gnl|CDD|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream. The function of the DRTGG domain, named after its conserved residues, is unknown. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 113
 Score = 40.6 bits (95), Expect = 0.001
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 101 NPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV 145
            PVT  P   L +AL LM +++I  +PVV+ D G   GI+T  D+
Sbjct: 67  KPVTARPNDPLREALNLMHEHNIRTLPVVDDD-GTPAGIITLLDL 110