>gnl|CDD|73106 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE. MgtE and its homologs are found in eubacteria, archaebacteria, and eukaryota. Members of this family transport Mg2+ or other divalent cations into the cell via two highly conserved aspartates. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 109

 Score = 40.9 bits (96), Expect = 8e-04
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 98  MVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV 145
           M  + +++S      +   L +KY +  +PVV+ + G+LVGI+T  DV
Sbjct: 59  MDTDVISVSADDDQEEVARLFEKYDLLALPVVDEE-GRLVGIITVDDV 105