RPSBLAST alignment for GI: 254780889 and conserved domain: cd04613

>gnl|CDD|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A ), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. EriC is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 114
 Score = 47.1 bits (112), Expect = 1e-05
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 7/111 (6%)

Query: 101 NPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVR-FASNAQQA----V 155
           + VTI     L + L ++     +  PVV+ D G+LVGI++  D+R    +         
Sbjct: 2   DVVTIPEDTPLNELLDVIAHSPENNFPVVDDD-GRLVGIVSLDDIREILFDPSLYDLVVA 60

Query: 156 GELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDD-GCCIGLITVKDI 205
            ++MT+  + V    +LE+A         E+L VVDDD G  +G+++  D+
Sbjct: 61  SDIMTKPPVVVYPEDSLEDALKKFEDSDYEQLPVVDDDPGKLLGILSRSDL 111