RPSBLAST alignment for GI: 254780889 and conserved domain: cd04631

>gnl|CDD|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 125
 Score = 74.8 bits (184), Expect = 5e-14
 Identities = 36/121 (29%), Positives = 62/121 (51%), Gaps = 16/121 (13%)

Query: 101 NPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV--------------- 145
           + VT+ P   + +A  +M +     +PVV+   GKLVGI+T  D+               
Sbjct: 2   DVVTVPPTTPIMEAAKIMVRNGFRRLPVVDEGTGKLVGIITATDILKYLGGGEKFNKIKT 61

Query: 146 -RFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKD 204
                   + V  +MTRN+IT+    ++++A  L+ + R+  L VVDDDG  +G++T +D
Sbjct: 62  GNGLEAINEPVRSIMTRNVITITPDDSIKDAAELMLEKRVGGLPVVDDDGKLVGIVTERD 121

Query: 205 I 205
           +
Sbjct: 122 L 122