HHsearch alignment of GI: 254780891 and MMDB domain: 3ied_A_

>3ied_A (A:) Heat shock protein; HSP90, chaperone, structural genomics, structural genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum 3D7}
Probab=96.67  E-value=0.0028  Score=40.30  Aligned_cols=84  Identities=13%  Similarity=0.122  Sum_probs=51.5

Q ss_pred             HHHHHHHHHHHHHHH-------HHCCCCCCCCCCCCCEEEEEEECCCCCCCHHHHHHHHCCC----------------CC
Q ss_conf             444567664687653-------2001111123557720479998789844024588740545----------------45
Q gi|254780891|r  117 KILLNLFMVAHASLP-------RGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGN----------------VE  173 (215)
Q Consensus       117 qvl~NLi~NA~~a~~-------~gg~I~i~~~~~~~~~~i~V~D~G~Gi~~~e~~~~~~~~~----------------~~  173 (215)
                      .....|+.|+.++..       ..+...|.+..+++.-.|.|+|+|.||+ ++++...+...                ..
T Consensus        93 ~~~~eli~n~~dai~el~~ns~da~a~~I~I~~d~~~~~I~V~DnG~GMt-~~dl~~~~~~i~~S~~~~~~~~~~~~~~~  171 (272)
T 3ied_A           93 KEKTENVNESTDKKENVEEEKNDIKKLIIKIKPDKEKKTLTITDNGIGMD-KSELINNLGTIAQSGTAKFLKQIEEGKAD  171 (272)
T ss_dssp             ---------------------CGGGGCCEEEEEETTTTEEEEEECSCCCC-HHHHHHHTTCSCCHHHHHHHHHHHTTSSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEECCEEEC-HHHHHHHHHHCCCCCCHHHHHHHHCCCCC
T ss_conf             22222222122221111112466666349988648789899995427750-89988654000444648899864114444


Q ss_pred             -CCCCCCCHHHHHHHHHHHHCCCEEEEEEECCC
Q ss_conf             -78998720499999999970987999987799
Q gi|254780891|r  174 -STIDSHDIQFYYVILLAHENKIRLLPEIIDDH  205 (215)
Q Consensus       174 -~~~~g~GlGl~~~~~i~~~~gG~i~v~~~~~~  205 (215)
                       ...+..|+|+|-+..++    -.+.|.+...+
T Consensus       172 ~~~iG~fGiG~~S~f~va----~~v~V~T~~~~  200 (272)
T 3ied_A          172 SNLIGQFGVGFYSSFLVS----NRVEVYTKKED  200 (272)
T ss_dssp             TTCGGGSCCGGGGGGGTE----EEEEEEEESSS
T ss_pred             CCCCCCCCCCEEEEEEEE----EEEEEEEECCC
T ss_conf             431022573325788861----26999993476