PSIBLAST alignment of GI: 254780891 and protein with PDB id: 3dge

>gi|251836869|pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-Response Regulator Complex Reveals Insights Into Two-Component Signaling And A Novel Cis-Autophosphorylation Mechanism Length = 258
>gi|251836871|pdb|3DGE|B Chain B, Structure Of A Histidine Kinase-Response Regulator Complex Reveals Insights Into Two-Component Signaling And A Novel Cis-Autophosphorylation Mechanism Length = 258
 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 24/240 (10%), Positives = 53/240 (22%), Gaps = 31/240 (12%)

Query: 4   NICFNLSSMDLVALLCSRICHDIISPIGAIHNS-------------------LELLDEVG 44
                +  M       + I H++ +P+ AI                      LE++ +  
Sbjct: 11  ERLKRIDRMK--TEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQS 68

Query: 45  IEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSW 104
              E +    L       +   +         +         E      + V     V  
Sbjct: 69  NHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPC 128

Query: 105 TGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISV---QDSKNENIFSLKINGNLARFP 161
             E         ++LLNL         +            +     +  ++ NG      
Sbjct: 129 PVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGI-PD 187

Query: 162 EKFTQIVDGNV------ESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK 215
               +I +            +    +       +   +  R+  E            + K
Sbjct: 188 HAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPK 247