RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780891|ref|YP_003065304.1| hypothetical protein CLIBASIA_03940 [Candidatus Liberibacter asiaticus str. psy62] (215 letters) >2vxt_I Interleukin-18; FAB, IL-18, secreted, cytokine, autoimmunity, glycoprotein, TH1/TH2 cells, immunoglobulin domain, immunoglobulin V region; 1.49A {Homo sapiens} PDB: 1j0s_A 3f62_B (I:) Length = 157 Score = 34.0 bits (78), Expect = 0.017 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 12/71 (16%) Query: 129 SLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDS--HDIQFYYV 186 S PRG VTISV+ K I +L + F E N I DI F+ Sbjct: 55 SQPRGMAVTISVKAEK---ISTLSAENKIISFKE-------MNPPDNIKDTKSDIIFFQR 104 Query: 187 ILLAHENKIRL 197 + H+NK++ Sbjct: 105 SVPGHDNKMQF 115 >1hxm_A Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} (A:1-122) Length = 122 Score = 28.8 bits (65), Expect = 0.55 Identities = 5/22 (22%), Positives = 8/22 (36%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 + +K N+ LKI Sbjct: 62 DNFQGDIDIAK--NLAVLKILA 81 >2h32_A Immunoglobulin IOTA chain; beta sheets, V and C-type IG folds, immune system; 2.70A {Homo sapiens} (A:) Length = 126 Score = 27.7 bits (62), Expect = 1.3 Identities = 4/22 (18%), Positives = 9/22 (40%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 + + S ++ N L I+ Sbjct: 66 PRFSGSKDVAR--NRGYLSISE 85 >1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} (F:1-123) Length = 123 Score = 27.2 bits (61), Expect = 1.6 Identities = 5/22 (22%), Positives = 7/22 (31%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 K+ S S + L I Sbjct: 66 KKMEASKNPSA--STSILTIYS 85 >2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} (A:) Length = 115 Score = 27.3 bits (61), Expect = 1.6 Identities = 4/22 (18%), Positives = 7/22 (31%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 + + S+ SL I Sbjct: 61 SRYQLKGNISE--GNVSLTIEN 80 >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A (A:1-124) Length = 124 Score = 27.4 bits (61), Expect = 1.6 Identities = 5/22 (22%), Positives = 7/22 (31%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 G+ + K SL I Sbjct: 69 GRFRLLGDVQK--KNCSLSIGD 88 >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* (A:63-149,A:208-299) Length = 179 Score = 27.2 bits (60), Expect = 1.7 Identities = 9/83 (10%), Positives = 23/83 (27%), Gaps = 16/83 (19%) Query: 36 SLELLDEVGIEDEV---------MQLIRLSSMSAIIRLKFMRLAFGYTGSVDS------- 79 S+EL G+ ++ + + + L T + Sbjct: 12 SMELFRRWGVAKQIRTAGWPGDHPLDAAWVTRVGGHEVYRIPLGTADTRATPEHTPEPDA 71 Query: 80 LIGLGDIEQVIEDFIAVDKRVQV 102 + + ++ + + R QV Sbjct: 72 ICPQHWLAPLLAEAVGPRHRTQV 94 >1smo_A Triggering receptor expressed on myeloid cells 1; structure, activating receptors, TREM-1, innate immune system receptor; HET: TLA; 1.47A {Homo sapiens} (A:) Length = 119 Score = 26.9 bits (60), Expect = 2.1 Identities = 1/22 (4%), Positives = 8/22 (36%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 G++ + + +++ Sbjct: 63 GRIILEDYHDH--GLLRVRMVN 82 >1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} (B:1-126) Length = 126 Score = 26.9 bits (60), Expect = 2.4 Identities = 4/22 (18%), Positives = 8/22 (36%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 GK + + +L I+ Sbjct: 67 GKFEVDRIPET--STSTLTIHN 86 >1j8h_D T-cell receptor alpha chain; protein-protein complex, immunoglobulin fold, immune system; HET: NAG NDG; 2.40A {Homo sapiens} (D:1-116) Length = 116 Score = 26.8 bits (60), Expect = 2.5 Identities = 3/23 (13%), Positives = 5/23 (21%), Gaps = 2/23 (8%) Query: 133 GGKVTISVQDSKNENIFSLKING 155 + S+ F L Sbjct: 59 INGFEAEFKKSE--TSFHLTKPS 79 >3bik_B Programmed cell death protein 1; CO-stimulation, receptor-ligand complex, immunoglobulin- like beta-sandwich, T cell, B cell, programmed death; 2.65A {Mus musculus} (B:) Length = 134 Score = 26.8 bits (60), Expect = 2.6 Identities = 3/22 (13%), Positives = 8/22 (36%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 + I ++ + F + I Sbjct: 70 ARFQIIQLPNR--HDFHMNILD 89 >1ktk_E TCR beta chain, T-cell receptor beta chain; streptococcus, immunity, immune system; 3.00A {Homo sapiens} (E:1-121) Length = 121 Score = 26.5 bits (59), Expect = 2.6 Identities = 2/22 (9%), Positives = 4/22 (18%), Gaps = 2/22 (9%) Query: 133 GGKVTISVQDSKNENIFSLKIN 154 K I+ + Sbjct: 64 KDKFLINHASLT--LSTLTVTS 83 >2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} (A:202-358,A:572-619) Length = 205 Score = 26.4 bits (58), Expect = 2.9 Identities = 8/43 (18%), Positives = 13/43 (30%) Query: 33 IHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTG 75 + LL I + +RLS + R+ F Sbjct: 80 VLKDDNLLALFDIPKILWPRLRLSWQRRRHHMITGRMDFCMDE 122 >1tzp_A Penicillin-insensitive murein endopeptidase; LAS enzyme, metallopeptidase, peptidoglycan hydrolase; 1.40A {Escherichia coli} (A:) Length = 255 Score = 26.4 bits (58), Expect = 3.0 Identities = 5/28 (17%), Positives = 13/28 (46%) Query: 110 DLSRERAKILLNLFMVAHASLPRGGKVT 137 LS + + + + ++ +P GG+ Sbjct: 61 RLSSQVSNLGMGTVLIGDMGMPAGGRFN 88 >1hkf_A NKP44, NK cell activating receptor; natural cytotoxicity receptor, immunoglobulin domain; 2.2A {Homo sapiens} (A:) Length = 122 Score = 26.2 bits (58), Expect = 3.3 Identities = 3/22 (13%), Positives = 7/22 (31%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 + TI F++ + Sbjct: 71 SRFTIWDDPDAG--FFTVTMTD 90 >3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} (A:158-355) Length = 198 Score = 26.4 bits (57), Expect = 3.4 Identities = 5/39 (12%), Positives = 10/39 (25%) Query: 104 WTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQD 142 G + +++ L + P I Q Sbjct: 157 KVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQS 195 >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A (A:1-115) Length = 115 Score = 26.0 bits (58), Expect = 3.6 Identities = 4/22 (18%), Positives = 8/22 (36%), Gaps = 2/22 (9%) Query: 133 GGKVTISVQDSKNENIFSLKIN 154 + + S+ FSL + Sbjct: 59 IPDGYKASRPSQ--ENFSLILE 78 >3bp6_A Programmed cell death protein 1; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglobulin domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_A 1npu_A (A:) Length = 117 Score = 26.0 bits (58), Expect = 3.9 Identities = 3/22 (13%), Positives = 9/22 (40%), Gaps = 2/22 (9%) Query: 133 GGKVTISVQDSKNENIFSLKIN 154 + I ++++ F + I Sbjct: 59 DARFQIIQLPNRHD--FHMNIL 78 >3bj9_1 Immunoglobulin IOTA chain, immunoglobulin lambda- like polypeptide 1; immunoglobulin domain, beta sheet, polymorphism, immune system; 2.00A {Homo sapiens} PDB: 2h3n_A (1:) Length = 116 Score = 26.0 bits (58), Expect = 4.0 Identities = 4/22 (18%), Positives = 9/22 (40%), Gaps = 2/22 (9%) Query: 134 GKVTISVQDSKNENIFSLKING 155 + + S ++ N L I+ Sbjct: 64 PRFSGSKDVAR--NRGYLSISE 83 >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* (F:) Length = 250 Score = 26.2 bits (58), Expect = 4.1 Identities = 4/21 (19%), Positives = 11/21 (52%), Gaps = 2/21 (9%) Query: 134 GKVTISVQDSKNENIFSLKIN 154 GK T++ S + ++++ Sbjct: 197 GKATLTADKSS--STAYMQLS 215 >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} (A:) Length = 73 Score = 25.5 bits (56), Expect = 5.1 Identities = 9/47 (19%), Positives = 18/47 (38%) Query: 129 SLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVEST 175 SL G V I + ++ + + NG + FP + + + Sbjct: 25 SLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQSGPS 71 >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} (S:84-471,S:604-714) Length = 499 Score = 25.3 bits (54), Expect = 6.0 Identities = 11/50 (22%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Query: 14 LVALLCSRICHDIISPIGAIHNSLELLD----EVGIEDEVMQLIRLSSMS 59 L + +R+ + + L +LD E+ + D V L+ SS Sbjct: 354 LFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFLNDNVTSLLNQSSDK 403 >2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus HB8} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* (A:53-137,A:278-457) Length = 265 Score = 25.5 bits (56), Expect = 6.6 Identities = 11/57 (19%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Query: 21 RICHDII-SPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGS 76 I I S + + + + +G + + ++ +++ A R+ RLA+ T S Sbjct: 182 EILEQIGASGLITLPSEKDFKGPLG--PFLEKFLQGAALEAKERVALFRLAWDMTLS 236 >2p2w_A Citrate synthase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: FLC; 1.90A {Thermotoga maritima} (A:213-313) Length = 101 Score = 25.2 bits (55), Expect = 7.0 Identities = 17/92 (18%), Positives = 40/92 (43%), Gaps = 5/92 (5%) Query: 31 GAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVI 90 GA +L+E+G ED V + ++ ++ K + FG+ +++V+ Sbjct: 1 GASEKVPPMLEEIGSEDRVEEFVQ-----KCLKEKRKIMGFGHRVYKTYDPRAVFLKRVL 55 Query: 91 EDFIAVDKRVQVSWTGEKIDLSRERAKILLNL 122 ++ K +++ E+ +S + I N+ Sbjct: 56 QEHFPDSKLFRIASKLEEYIVSNKIKNIYPNV 87 >1vbg_A Pyruvate,orthophosphate dikinase; transferase, maize, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Zea mays} (A:1-115,A:199-249) Length = 166 Score = 25.2 bits (55), Expect = 7.1 Identities = 9/44 (20%), Positives = 16/44 (36%) Query: 75 GSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKI 118 G +D+++ LG + V SW + R +I Sbjct: 106 GMMDTVLNLGFPSDPKKQLELAVLAVFNSWESPRAKKYRSINQI 149 >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural genomics consortium, SGC, alternative initiation ATP-binding; 2.80A {Homo sapiens} (A:) Length = 175 Score = 25.1 bits (54), Expect = 7.2 Identities = 8/33 (24%), Positives = 16/33 (48%) Query: 174 STIDSHDIQFYYVILLAHENKIRLLPEIIDDHN 206 S + ++I+ YYV+ ++K + L I Sbjct: 1 SMLTLNNIRQYYVLCEHRKDKYQALCNIYGSIT 33 >2vg3_A Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, cell shape, cell division; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A (A:) Length = 284 Score = 25.1 bits (54), Expect = 7.5 Identities = 6/43 (13%), Positives = 13/43 (30%) Query: 145 NENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVI 187 + ++ G+ R + E T + I Y + Sbjct: 139 KKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCV 181 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.323 0.140 0.390 Gapped Lambda K H 0.267 0.0394 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,564,713 Number of extensions: 68077 Number of successful extensions: 263 Number of sequences better than 10.0: 1 Number of HSP's gapped: 262 Number of HSP's successfully gapped: 35 Length of query: 215 Length of database: 4,956,049 Length adjustment: 85 Effective length of query: 130 Effective length of database: 2,082,624 Effective search space: 270741120 Effective search space used: 270741120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.1 bits)