RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780892|ref|YP_003065305.1| probable two-component response regulator protein [Candidatus Liberibacter asiaticus str. psy62] (133 letters) >gnl|CDD|29071 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers. Length = 113 Score = 53.3 bits (128), Expect = 2e-08 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 5/115 (4%) Query: 5 LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62 L+VD ++R++ R L G+ V EA EA +E P+ +++D M G+ LE Sbjct: 1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEK-PDLILLDIMMPGMDGLEL 59 Query: 63 IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117 + +R+ + L D E + +AGA+ +L KPF+ E L +R L Sbjct: 60 LRRIRKRGPDIPIIF--LTAHGDDEDAVEALKAGADDYLTKPFSPEELLARIRAL 112 >gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. Length = 111 Score = 53.0 bits (128), Expect = 3e-08 Identities = 40/110 (36%), Positives = 59/110 (53%), Gaps = 5/110 (4%) Query: 4 LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61 +L+VD ++R++ R L G++V EA EA E KE P+ +++D M G+ LE Sbjct: 1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALE-LLKEKRPDLILLDIRMPGMDGLE 59 Query: 62 FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111 + +R+ P T V V L D E + +AGAN FL KPF+ E L Sbjct: 60 LLRRIRRRPPTTPVIV--LTAHGDEEDAVEALKAGANDFLSKPFDPEELV 107 >gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]. Length = 464 Score = 49.1 bits (117), Expect = 4e-07 Identities = 31/132 (23%), Positives = 59/132 (44%), Gaps = 9/132 (6%) Query: 1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59 M +L+VD +R++ G+ V A S EA E + + +++D M G+ Sbjct: 4 MARILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESP-FDLVLLDIRMPGMD 62 Query: 60 -LEFIAHVRQMPLGTDVFVYYLLM--EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116 LE + ++ V ++M D + + R GA FL KPF+ + L + Sbjct: 63 GLELLKEIKSRDPDLPV----IVMTGHGDIDTAVEALRLGAFDFLEKPFDLDRLLAIVER 118 Query: 117 LPQMQKSKDENQ 128 ++++ + EN+ Sbjct: 119 ALELRELQRENR 130 >gnl|CDD|31127 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms]. Length = 130 Score = 46.4 bits (109), Expect = 2e-06 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 6/119 (5%) Query: 3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATS-VCEAREFCEKELLPNYLVIDESMEGV-- 59 +L+VD + R++ + L D G+ V EA EA E + P+ +++D +M G+ Sbjct: 7 RVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGEEEALELLRELPQPDLILLDINMPGMDG 66 Query: 60 LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKP-FNRETLRFAMREL 117 +E + +R G ++ V L D AGA+ +L KP F E L A+R L Sbjct: 67 IELLRRLRAR--GPNIPVILLTAYADEADRERALAAGADDYLTKPIFLEEELLAALRRL 123 >gnl|CDD|33243 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]. Length = 360 Score = 43.0 bits (101), Expect = 2e-05 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 4/129 (3%) Query: 3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60 ++LLVD + R L G+ V EA + EA + + E P+ +++D M + Sbjct: 16 TVLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQ-EEPPDLVLLDVRMPEMDGA 74 Query: 61 EFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119 E + ++ M P + V L D E AGA+ +L KP + + L + Q Sbjct: 75 EVLNKLKAMSPSTRRIPVILLTAYADSEDRQRALEAGADDYLSKPISPKELVARVSSHLQ 134 Query: 120 MQKSKDENQ 128 +++++D Sbjct: 135 LKRNEDFLL 143 >gnl|CDD|31088 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 229 Score = 41.9 bits (98), Expect = 5e-05 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 5/116 (4%) Query: 4 LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61 +LLV+ + ++ + + G+ V A EA E ++ P+ +++D + + LE Sbjct: 3 ILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQ--PDLVLLDLMLPDLDGLE 60 Query: 62 FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117 +R G+ + L D E + G AGA+ +L KPF+ L +R L Sbjct: 61 LCRRLRA-KKGSGPPIIVLTARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRAL 115 >gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 211 Score = 41.5 bits (97), Expect = 8e-05 Identities = 39/119 (32%), Positives = 61/119 (51%), Gaps = 7/119 (5%) Query: 3 SLLLVDSSHIVRKVGRHLFNDFGFM--VFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59 +L+VD +VR+ R L + V EA++ EA + EL P+ +++D SM G+ Sbjct: 2 KVLIVDDHPLVREGLRQLLELEPDLEVVGEASNGEEALDLAR-ELKPDVVLLDLSMPGMD 60 Query: 60 -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117 LE + +R G D+ V L D +I RAGA+ +LLK + E L A+R + Sbjct: 61 GLEALKQLRA--RGPDIKVVVLTAHDDPAYVIRALRAGADGYLLKDASPEELVEAIRAV 117 >gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]. Length = 435 Score = 40.7 bits (95), Expect = 1e-04 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 5/133 (3%) Query: 3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60 +L+VD R+ R + GF V EAT EA EL P+ +++D +M + L Sbjct: 134 KILVVDDDATQRERLRRILQVEGFRVVEATDGEEALLQLA-ELPPDLVLLDANMPDMDGL 192 Query: 61 EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120 E +RQ+ D+ + L + D E ++ G N ++ KP LR R Q+ Sbjct: 193 ELCTRLRQLERTRDIPIILLSSKDDDELVVRAFELGVNDYITKPIEEGELR--ARLRRQL 250 Query: 121 QKSKDENQFLDAI 133 ++ + E Q +++ Sbjct: 251 RRKRYERQLRESL 263 >gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]. Length = 224 Score = 37.1 bits (86), Expect = 0.002 Identities = 33/132 (25%), Positives = 61/132 (46%), Gaps = 7/132 (5%) Query: 4 LLLVDSSHIVRKVGRHLFNDF-GF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59 +L+++ +V ++ R GF +V A ++ EA+ E E P+ +++D M Sbjct: 3 VLIIEDDPMVAEIHRRYVKQIPGFSVVGTAGTLEEAKMIIE-EFKPDLILLDIYMPDGNG 61 Query: 60 LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119 +E + +R DV V + D E + R G +L+KPF E L+ A+ Q Sbjct: 62 IELLPELRSQHYPVDVIV--ITAASDMETIKEALRYGVVDYLIKPFTFERLQQALTRYRQ 119 Query: 120 MQKSKDENQFLD 131 + + + +Q L Sbjct: 120 KRHALESHQQLS 131 >gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]. Length = 475 Score = 35.7 bits (82), Expect = 0.004 Identities = 29/131 (22%), Positives = 62/131 (47%), Gaps = 8/131 (6%) Query: 1 MDSLLLVDSSHIVRKVGRHLFNDFGF---MVFEATSVCEAREFCEKELLPNYLVIDESME 57 M +L+VD ++R+ + L + +V A + EA E +E P+ ++ D +M Sbjct: 1 MYKVLIVDDEPLIREGLKSLIDWEALGIEVVGTAANGKEALELI-QETQPDIVITDINMP 59 Query: 58 GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115 G+ L+ I +++ T+ + L +FE + G +LLKP ++ L A++ Sbjct: 60 GMDGLDLIKAIKEQSPDTEFII--LSGYDEFEYAKKAMKLGVKDYLLKPVDKAELEEALK 117 Query: 116 ELPQMQKSKDE 126 ++ + + + Sbjct: 118 KIIGKLEEQQK 128 >gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms]. Length = 202 Score = 34.8 bits (80), Expect = 0.008 Identities = 34/114 (29%), Positives = 47/114 (41%), Gaps = 9/114 (7%) Query: 6 LVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELL--PNYLVIDESMEGV--LE 61 +VD VR L GF V S A EF L P L++D M G+ LE Sbjct: 9 VVDDDESVRDALAFLLESAGFQVKCFAS---AEEFLAAAPLDRPGCLLLDVRMPGMSGLE 65 Query: 62 FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115 + + G + V +L D + +AGA FL KPF+ + L A+ Sbjct: 66 LQDRLAE--RGIRLPVIFLTGHGDIPMAVQAMKAGAVDFLEKPFSEQDLLDAVE 117 >gnl|CDD|164540 CHL00148, orf27, Ycf27; Reviewed. Length = 240 Score = 32.0 bits (73), Expect = 0.047 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 6/104 (5%) Query: 4 LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61 +L+VD +RK+ + G+ V A+ EA + KE P+ +++D M + Sbjct: 9 ILVVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQ-PDLVILDVMMPKLDGYG 67 Query: 62 FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105 +R+ +DV + L D I G GA+ +++KPF Sbjct: 68 VCQEIRK---ESDVPIIMLTALGDVSDRITGLELGADDYVVKPF 108 >gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms]. Length = 786 Score = 30.8 bits (69), Expect = 0.12 Identities = 28/115 (24%), Positives = 45/115 (39%), Gaps = 3/115 (2%) Query: 5 LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62 LLVD + + RKV + G V E S EA + + + + +D M + E Sbjct: 670 LLVDDNPVNRKVATGMLKKLGAEVTEVNSGQEALDKLKPPHSYDVIFMDLQMPEMDGYEA 729 Query: 63 IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117 +R+ + + L + D G + +L KPF E L +RE Sbjct: 730 TREIRKK-ERWHLPIVALTADADPSTEEECLEVGMDGYLSKPFTLEKLVKILREF 783 >gnl|CDD|34205 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription]. Length = 182 Score = 30.7 bits (69), Expect = 0.12 Identities = 33/128 (25%), Positives = 49/128 (38%), Gaps = 6/128 (4%) Query: 3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60 SLLLVD + GF V A SV EA + P Y V+D + L Sbjct: 11 SLLLVDDDTPFLRTLARAMERRGFAVVTAESVEEALAAA-RTAPPAYAVVDLKLGDGSGL 69 Query: 61 EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM-RELPQ 119 I +R+ D+ + L + + GA +L KP + + + A+ R P Sbjct: 70 AVIEALRE--RRADMRIVVLTGYASIATAVEAVKLGACDYLAKPADADDILAALLRREPD 127 Query: 120 MQKSKDEN 127 + EN Sbjct: 128 EDTAPPEN 135 >gnl|CDD|145756 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, N-terminal domain. The N-terminal domain of Acyl-CoA dehydrogenase is an all-alpha domain. Length = 113 Score = 26.7 bits (60), Expect = 2.1 Identities = 10/29 (34%), Positives = 13/29 (44%) Query: 36 EAREFCEKELLPNYLVIDESMEGVLEFIA 64 REF E+E+ P+ DE E E Sbjct: 10 TVREFAEEEVAPHAAEWDEEGEFPRELWR 38 >gnl|CDD|144171 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain. This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains pfam00571 are inserted in the TIM barrel. This family is a member of the common phosphate binding site TIM barrel family. Length = 467 Score = 26.1 bits (58), Expect = 3.2 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Query: 47 PNYLVIDESM---EGVLEFIAHVRQMPLGTDV 75 + +VID + E VLE I +++ DV Sbjct: 236 VDVIVIDSAHGHSEYVLEMIKWIKKKYPDLDV 267 >gnl|CDD|35908 KOG0689, KOG0689, KOG0689, Guanine nucleotide exchange factor for Rho and Rac GTPases [Signal transduction mechanisms]. Length = 448 Score = 26.1 bits (57), Expect = 3.6 Identities = 23/92 (25%), Positives = 34/92 (36%), Gaps = 17/92 (18%) Query: 33 SVCEAREFCEKELLPNYLVIDESMEGVL-EFIAHVRQMPLGTDVFVY--------YLLME 83 ++ E EF +KE LP + + F H R+ Y YLL E Sbjct: 111 NIKEIYEFHKKEFLPELERCERDPLELGQAFAKHERK--NSVLYVTYCQNKPKSDYLLAE 168 Query: 84 VDFE------KMIAGARAGANSFLLKPFNRET 109 D E + G + +S+L+KP R Sbjct: 169 YDNEAFFQEYQTQLGHKLDLSSYLIKPVQRIM 200 >gnl|CDD|29616 cd01569, PBEF_like, pre-B-cell colony-enhancing factor (PBEF)-like. The mammalian members of this group of nicotinate phosphoribosyltransferases (NAPRTases) were originally identified as genes whose expression is upregulated upon activation in lymphoid cells. In general, nicotinate phosphoribosyltransferase catalyses the formation of NAMN and PPi from 5-phosphoribosy -1-pyrophosphate (PRPP) and nicotinic acid, this is the first, and also rate limiting, reaction in the NAD salvage synthesis.. Length = 407 Score = 25.6 bits (56), Expect = 4.1 Identities = 13/70 (18%), Positives = 25/70 (35%), Gaps = 3/70 (4%) Query: 63 IAHVRQMPLGTDVFVYYLLMEVD---FEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119 ++H Q P GT YL + + G + +L+ P NR+ + + Sbjct: 9 VSHRLQYPPGTTAVYSYLEPRGGKYYDQTVFFGLQYFLKKYLIDPVNRDFFIDEAEAVFE 68 Query: 120 MQKSKDENQF 129 ++ F Sbjct: 69 AHFGMNDLPF 78 Score = 24.8 bits (54), Expect = 7.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 96 GANSFLLKPFNRETLRFAMR 115 G LL+ R+T FAM+ Sbjct: 360 GMGGGLLQKVTRDTQGFAMK 379 >gnl|CDD|33990 COG4268, McrC, McrBC 5-methylcytosine restriction system component [Defense mechanisms]. Length = 439 Score = 25.7 bits (56), Expect = 4.6 Identities = 14/85 (16%), Positives = 26/85 (30%), Gaps = 3/85 (3%) Query: 52 IDESMEGVLEFIAHVRQMPLGTDVFVYY---LLMEVDFEKMIAGARAGANSFLLKPFNRE 108 ++G ++F H+R+ + ++I S P N Sbjct: 161 NLPGLKGRIDFARHIRKNLNHGHRISTAFDEFNEDNPLNRLIKSTLEILKSQTSLPTNLR 220 Query: 109 TLRFAMRELPQMQKSKDENQFLDAI 133 R R L ++ S + Q I Sbjct: 221 EARELYRMLDEVTPSHNVPQDFSYI 245 >gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers. Length = 373 Score = 25.3 bits (56), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 38 REFCEKELLPNYLVIDESME 57 R+F EKE+ P +DE E Sbjct: 11 RDFAEKEIAPLAAEMDEKGE 30 >gnl|CDD|35583 KOG0362, KOG0362, KOG0362, Chaperonin complex component, TCP-1 theta subunit (CCT8) [Posttranslational modification, protein turnover, chaperones]. Length = 537 Score = 24.9 bits (54), Expect = 7.2 Identities = 7/24 (29%), Positives = 10/24 (41%) Query: 19 HLFNDFGFMVFEATSVCEAREFCE 42 H N + MV + S + R C Sbjct: 298 HFLNKYKIMVLQINSKFDLRRLCR 321 >gnl|CDD|35362 KOG0140, KOG0140, KOG0140, Medium-chain acyl-CoA dehydrogenase [Lipid transport and metabolism]. Length = 408 Score = 24.9 bits (54), Expect = 7.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 37 AREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLG 72 AR+F + E++PN D+S E E I ++ Sbjct: 39 ARKFAKDEMIPNAAEYDKSGEFPWEIIRKAHELGFM 74 >gnl|CDD|99739 cd00615, Orn_deC_like, Ornithine decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to ornithine decarboxylase (ODC), arginine decarboxylase (ADC) and lysine decarboxylase (LDC). ODC is a dodecamer composed of six homodimers and catalyzes the decarboxylation of tryptophan. ADC catalyzes the decarboxylation of arginine and LDC catalyzes the decarboxylation of lysine. Members of this family are widely found in all three forms of life.. Length = 294 Score = 24.9 bits (55), Expect = 8.0 Identities = 13/82 (15%), Positives = 27/82 (32%), Gaps = 32/82 (39%) Query: 1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-------- 52 S++ V + N+ + ++TS P+YL++ Sbjct: 227 QGSMIHVKGDLVNPD----RVNEA-LNLHQSTS-------------PSYLILASLDVARA 268 Query: 53 ------DESMEGVLEFIAHVRQ 68 E +E ++E + RQ Sbjct: 269 MMALEGKELVEELIELALYARQ 290 >gnl|CDD|144984 pfam01596, Methyltransf_3, O-methyltransferase. Members of this family are O-methyltransferases. The family includes catechol o-methyltransferase, caffeoyl-CoA O-methyltransferase, and a family of bacterial O-methyltransferases that may be involved in antibiotic production. Length = 204 Score = 24.6 bits (54), Expect = 8.8 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Query: 99 SFLLKPFNRETLRFAMRELPQMQKSKDENQFL 130 +LK T A L QMQ S +E QFL Sbjct: 8 HEILKELREAT---AKLPLSQMQISPEEGQFL 36 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.141 0.404 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,623,021 Number of extensions: 82424 Number of successful extensions: 268 Number of sequences better than 10.0: 1 Number of HSP's gapped: 267 Number of HSP's successfully gapped: 35 Length of query: 133 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 50 Effective length of database: 4,470,190 Effective search space: 223509500 Effective search space used: 223509500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (23.8 bits)