BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780892|ref|YP_003065305.1| probable two-component response regulator protein [Candidatus Liberibacter asiaticus str. psy62] (133 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780892|ref|YP_003065305.1| probable two-component response regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 133 Score = 273 bits (699), Expect = 6e-76, Method: Compositional matrix adjust. Identities = 133/133 (100%), Positives = 133/133 (100%) Query: 1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL Sbjct: 1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60 Query: 61 EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120 EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM Sbjct: 61 EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120 Query: 121 QKSKDENQFLDAI 133 QKSKDENQFLDAI Sbjct: 121 QKSKDENQFLDAI 133 >gi|254780893|ref|YP_003065306.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 236 Score = 29.6 bits (65), Expect = 0.020, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 86 FEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL 130 E + G ++GA+ ++ KPFN+E L +R + +++S+ Q L Sbjct: 84 IEDKVRGLQSGADDYISKPFNKEELVARIRAI--VRRSRGHAQSL 126 >gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 26.2 bits (56), Expect = 0.24, Method: Compositional matrix adjust. Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 18/77 (23%) Query: 2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELL--PNYLVIDESMEGV 59 D L ++D +++ K R++ D F+ R K LL PN LV+DE ++G+ Sbjct: 106 DVLQILDRVNLIGKYNRNI-KDLSGGEFQ-------RALLAKALLRKPNLLVLDEPLQGI 157 Query: 60 --------LEFIAHVRQ 68 E I VRQ Sbjct: 158 DFPGELSLYELITSVRQ 174 >gi|254780761|ref|YP_003065174.1| probable FAD-dependent oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 473 Score = 25.8 bits (55), Expect = 0.30, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Query: 70 PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD 125 PL +D +Y+L+E+ + + A+ AN+ L FN++ L + LP + + K+ Sbjct: 276 PL-SDTSPWYILLEISSTETLERAQNIANTILATGFNKKILTEWI--LPSLDEEKN 328 >gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 25.4 bits (54), Expect = 0.40, Method: Composition-based stats. Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 9/121 (7%) Query: 4 LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-----ELLPNYLVIDESMEG 58 +LLV+ VR+ + + G+ V EA S +A + EK +++ + +V+ E M+G Sbjct: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPE-MDG 742 Query: 59 VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118 + P +F+ E F K + + SFL KPF+ + L ++ EL Sbjct: 743 PTLLRELRKTYPSLKFIFISG-YAEDAFSKNL--PKDAKFSFLSKPFSLKQLATSVHELL 799 Query: 119 Q 119 Q Sbjct: 800 Q 800 >gi|254781096|ref|YP_003065509.1| UDP-N-acetylmuramate--L-alanine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 474 Score = 25.0 bits (53), Expect = 0.50, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query: 19 HLFNDFGFMVFEATSVCEA-REFCEKELL 46 H+F+D+G E +SV A R+ C ++++ Sbjct: 332 HVFDDYGHHPIEISSVLAAVRQICPRKII 360 >gi|255764515|ref|YP_003065608.2| SNF2 related [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Score = 23.9 bits (50), Expect = 0.97, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Query: 54 ESMEGVLEFIAHVRQMPLGTD--VFVYYLLMEVDFEKMIAG---ARAGANSFLLKPFNRE 108 E + ++E I RQ G VFVYYL+ + ++++ ++ LL +E Sbjct: 395 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 454 Query: 109 TL 110 T+ Sbjct: 455 TI 456 >gi|254780130|ref|YP_003064543.1| hypothetical protein CLIBASIA_00045 [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 23.9 bits (50), Expect = 1.1, Method: Compositional matrix adjust. Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Query: 54 ESMEGVLEFIAHVRQMPLG--TDVFVYYLLMEVDFEKMIAG---ARAGANSFLLKPFNRE 108 E + ++E I RQ G VFVYYL+ + ++++ ++ LL +E Sbjct: 142 EEHQQMIERIGVTRQRQAGFKRAVFVYYLIAQNTIDELVLQRLRTKSTIQDLLLNALKKE 201 Query: 109 TL 110 T+ Sbjct: 202 TI 203 >gi|255764483|ref|YP_003065151.2| hypothetical protein CLIBASIA_03125 [Candidatus Liberibacter asiaticus str. psy62] Length = 135 Score = 23.5 bits (49), Expect = 1.6, Method: Compositional matrix adjust. Identities = 13/52 (25%), Positives = 26/52 (50%) Query: 59 VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110 +L+F +Q+ +G D V L +E + +I G G+ + ++ N + L Sbjct: 44 ILQFDVLPKQVIVGDDKIVDVLALEKEKTVVITGKNLGSTNIIVLGHNNDIL 95 >gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 22.3 bits (46), Expect = 3.0, Method: Compositional matrix adjust. Identities = 12/45 (26%), Positives = 20/45 (44%) Query: 85 DFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQF 129 DFEK+ + KPF ++ L A + + Q+ + QF Sbjct: 215 DFEKVQLISSYAHEHIFCKPFTKDLLNLANKNIYQLSNPRYSYQF 259 >gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 465 Score = 22.3 bits (46), Expect = 3.2, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 102 LKPFNRETLRFAMRELPQMQK 122 L PF R+TL F+ ++QK Sbjct: 173 LVPFTRQTLLFSATMTDELQK 193 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 22.3 bits (46), Expect = 3.4, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 46 LPNYLVIDESMEGVLEFIAHVRQMPLG 72 +P YLVI ++ + F H ++ LG Sbjct: 244 IPYYLVISDNSDATFTFSPHPKKGILG 270 >gi|254780225|ref|YP_003064638.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 22.3 bits (46), Expect = 3.4, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 26 FMVFEATSVCEAREFCEKELLPNYLVIDESME 57 FM S+ E F + L NYLVI + ++ Sbjct: 64 FMNLSGQSLLEVMNFYKLPNLENYLVIHDDLD 95 >gi|254780224|ref|YP_003064637.1| hypothetical protein CLIBASIA_00545 [Candidatus Liberibacter asiaticus str. psy62] Length = 382 Score = 22.3 bits (46), Expect = 3.5, Method: Compositional matrix adjust. Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 53 DESME-GVLEFIAHVRQM 69 +ESM G+LE I+HVR + Sbjct: 215 EESMRVGILEMISHVRDV 232 >gi|254780901|ref|YP_003065314.1| single-stranded-DNA-specific exonuclease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 600 Score = 21.6 bits (44), Expect = 5.0, Method: Compositional matrix adjust. Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 2 DSLLLVDSSHIVRKVGRHLFNDFGFMVF 29 D L+L D R++ + ++N M+F Sbjct: 71 DPLILTDCDKAARRIVQAIYNSEKIMIF 98 >gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 753 Score = 21.6 bits (44), Expect = 5.7, Method: Compositional matrix adjust. Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 106 NRETLRFAMRELPQMQKSK 124 NR+ L F++ ++P+M + K Sbjct: 667 NRKLLIFSIDQIPEMSRGK 685 >gi|254780991|ref|YP_003065404.1| excinuclease ABC subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 21.6 bits (44), Expect = 6.0, Method: Composition-based stats. Identities = 8/11 (72%), Positives = 9/11 (81%) Query: 2 DSLLLVDSSHI 12 DSLL VD SH+ Sbjct: 468 DSLLFVDESHV 478 >gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 21.2 bits (43), Expect = 6.4, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 17/27 (62%) Query: 97 ANSFLLKPFNRETLRFAMRELPQMQKS 123 ++ F ++ FN +TL+ +REL + S Sbjct: 179 SDIFSVQDFNYDTLQHRLRELSFLNSS 205 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.141 0.404 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,959 Number of Sequences: 1233 Number of extensions: 3008 Number of successful extensions: 23 Number of sequences better than 100.0: 18 Number of HSP's better than 100.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 18 length of query: 133 length of database: 328,796 effective HSP length: 65 effective length of query: 68 effective length of database: 248,651 effective search space: 16908268 effective search space used: 16908268 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 34 (17.7 bits)