RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780894|ref|YP_003065307.1| hypothetical protein CLIBASIA_03955 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >gnl|CDD|162740 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. Length = 1164 Score = 28.5 bits (64), Expect = 0.42 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 2/98 (2%) Query: 2 RLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFA-Y 60 +L+++ +LKE RL + L L I + + +LE +I E + ++ Sbjct: 727 QLEQEEEKLKE-RLEELEEDLSSLEQEIENVKSELKELEARIEELEEDLHKLEEALNDLE 785 Query: 61 PILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNS 98 L+ S I L + + + R E+ +E + N Sbjct: 786 ARLSHSRIPEIQAELSKLEEEVSRIEARLREIEQKLNR 823 >gnl|CDD|179437 PRK02509, PRK02509, hypothetical protein; Provisional. Length = 973 Score = 27.7 bits (62), Expect = 0.66 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 20/67 (29%) Query: 3 LQEQRTRLKEFRLNDER------RQLQQLRATILEFRRIVADLEK-----------QIAI 45 L R ++ RL D R RQLQQ+R L +R AD+++ I+ Sbjct: 434 LAANRLTIRNIRLWDTRPLLETNRQLQQIR---LYYRFPDADIDRYTLKTENDDNRSIST 490 Query: 46 EERQVGI 52 E++QV I Sbjct: 491 EKQQVLI 497 >gnl|CDD|180128 PRK05560, PRK05560, DNA gyrase subunit A; Validated. Length = 805 Score = 26.9 bits (61), Expect = 1.1 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Query: 1 MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAI 45 MRLQ + T L+ ++ DE ++L A I + + I+A E+ + I Sbjct: 422 MRLQ-RLTGLERDKIEDE---YKELLALIADLKDILASPERLLEI 462 >gnl|CDD|182460 PRK10437, PRK10437, carbonic anhydrase; Provisional. Length = 220 Score = 26.8 bits (59), Expect = 1.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Query: 71 IDNLLLSIRDLLLRQESLESHLESESNSDK 100 I+N LL IRD+ + SL + E D Sbjct: 116 INNWLLHIRDIWFKHSSLLGEMPQERRLDT 145 >gnl|CDD|149682 pfam08702, Fib_alpha, Fibrinogen alpha/beta chain family. Fibrinogen is a protein involved in platelet aggregation and is essential for the coagulation of blood. This domain forms part of the central coiled coiled region of the protein which is formed from two sets of three non-identical chains (alpha, beta and gamma). Length = 146 Score = 24.6 bits (54), Expect = 6.6 Identities = 11/47 (23%), Positives = 22/47 (46%) Query: 3 LQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQ 49 L++ + E ++N + Q++ L+ + R + LE I ER Sbjct: 87 LRKMIEYILETKINTQESQIRVLQEVLRSNRSKIQRLEVDIDQLERT 133 >gnl|CDD|149487 pfam08440, Poty_PP, Potyviridae polyprotein. This domain is found in polyproteins of the viral Potyviridae taxon. Length = 274 Score = 24.1 bits (53), Expect = 7.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Query: 22 LQQLRATILEFRRIVADLEKQIAIEE 47 LQQ +A +LEF + D + + + Sbjct: 216 LQQAKAQLLEFSNLNGDGSNEEILRD 241 >gnl|CDD|182846 PRK10929, PRK10929, putative mechanosensitive channel protein; Provisional. Length = 1109 Score = 24.2 bits (53), Expect = 8.3 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Query: 63 LAKSARQRIDNLLLSIRDLL--LRQESLESHLES 94 LAK Q++D L ++R+ L RQ E LES Sbjct: 212 LAKKRSQQLDAYLQALRNQLNSQRQREAERALES 245 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.134 0.345 Gapped Lambda K H 0.267 0.0730 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,639,825 Number of extensions: 99695 Number of successful extensions: 300 Number of sequences better than 10.0: 1 Number of HSP's gapped: 298 Number of HSP's successfully gapped: 68 Length of query: 103 Length of database: 5,994,473 Length adjustment: 70 Effective length of query: 33 Effective length of database: 4,481,913 Effective search space: 147903129 Effective search space used: 147903129 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.0 bits)