RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780894|ref|YP_003065307.1| hypothetical protein CLIBASIA_03955 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 42.2 bits (99), Expect = 3e-05 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 16/60 (26%) Query: 57 HFAYPI--LAKSARQ-RIDNL------LLSIRDLLLRQESLESHLESESNS----DKSVS 103 + AYP L S + ++N +LSI + L QE ++ ++ ++NS K V Sbjct: 311 YEAYPNTSLPPSILEDSLENNEGVPSPMLSISN--LTQEQVQDYVN-KTNSHLPAGKQVE 367 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 34.2 bits (77), Expect = 0.008 Identities = 11/50 (22%), Positives = 21/50 (42%), Gaps = 23/50 (46%) Query: 18 ERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAYPILAKSA 67 E++ L++L+A++ ++ AD D + P LA A Sbjct: 18 EKQALKKLQASL----KLYAD---------------D----SAPALAIKA 44 >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 27.2 bits (59), Expect = 0.84 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 12/70 (17%) Query: 4 QEQRTRLKEFRLNDERRQLQQLRATILEFR-RIVADLEKQIAIEERQVGIYDKDHFAYPI 62 +EQR RL+E L+ + ++Q E+R + DLE+ +RQ +K+ I Sbjct: 92 EEQRKRLQE--LDAASKVMEQ------EWREKAKKDLEEW---NQRQSEQVEKNKINNRI 140 Query: 63 LAKSARQRID 72 K+ Q+ D Sbjct: 141 ADKAFYQQPD 150 >2hu5_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase, beta-propeller, enzyme-inhibitor complex; HET: PHE; 2.00A {Aeropyrum pernix} SCOP: b.69.7.2 c.69.1.33 PDB: 1ve7_A* 1ve6_A* 2hu7_A* 2hu8_A* 2qr5_A 2qzp_A Length = 582 Score = 26.9 bits (58), Expect = 1.0 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 31 EFRRIVADLEKQIAIEERQV-GIYDKDHFAY 60 EF RIV D+E+ IA+E+ + G+ D D Sbjct: 8 EFSRIVRDVERLIAVEKYSLQGVVDGDKLLV 38 >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 1zoy_A* 1zp0_A* Length = 621 Score = 24.4 bits (52), Expect = 7.0 Identities = 17/99 (17%), Positives = 37/99 (37%), Gaps = 8/99 (8%) Query: 1 MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEK------QIAIEERQVGIYD 54 L + R R ++ R +Q+ + R + L++ QI + + +D Sbjct: 451 ANLDKLRFADGTIRTSEARLNMQKTMQSHAAVFRTGSILQEGCEKLSQIYRDLAHLKTFD 510 Query: 55 KDHFAYPILAKS--ARQRIDNLLLSIRDLLLRQESLESH 91 + L ++ + + L +I R+ES +H Sbjct: 511 RGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAH 549 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.320 0.134 0.345 Gapped Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 789,081 Number of extensions: 34013 Number of successful extensions: 209 Number of sequences better than 10.0: 1 Number of HSP's gapped: 206 Number of HSP's successfully gapped: 54 Length of query: 103 Length of database: 5,693,230 Length adjustment: 68 Effective length of query: 35 Effective length of database: 4,044,638 Effective search space: 141562330 Effective search space used: 141562330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.7 bits)