RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780895|ref|YP_003065308.1| hypothetical protein CLIBASIA_03960 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >gnl|CDD|113384 pfam04611, AalphaY_MDB, Mating type protein A alpha Y mating type dependent binding region. This region is important for the mating type dependent binding of Y protein to the A alpha Z protein of another mating type in Schizophyllum commune. Length = 147 Score = 28.7 bits (64), Expect = 0.33 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 12/83 (14%) Query: 18 SPLTIANLPPPNTRRWVARRKAEV---VAAVKGGLLSLEEACQIYTLTVEEFLSWQASIV 74 + + LP P+ + R E A+K L + E+AC + +EE A V Sbjct: 37 TTVHFDPLPTPDLD-GLRTRLQEAKLPPKAIKSALSAYEKACARWRSDLEEAFDITAKSV 95 Query: 75 Q----HGLAGLR----TTQIQKY 89 H L LR T Q++K+ Sbjct: 96 SPHNLHLLELLRFRLYTQQVEKW 118 >gnl|CDD|144517 pfam00945, Rhabdo_ncap, Rhabdovirus nucleocapsid protein. The Nucleocapsid (N) Protein is said to have a "tight" structure. The carboxyl end of the N-terminal domain possesses an RNA binding domain. Sequence alignments show 2 regions of reasonable conservation, approx. 64-103 and 201-329. A whole functional protein is required for encapsidation to take place. Length = 406 Score = 27.7 bits (62), Expect = 0.76 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Query: 33 WVARRKAEVVAAVKG--GLLSLEEACQIYTLTVEEFLSW 69 + A R +V+ K GL+S C++ L++EE ++W Sbjct: 202 YAAIRFGTIVSRYKDCSGLVSFTHLCKVTGLSIEEAITW 240 >gnl|CDD|38652 KOG3442, KOG3442, KOG3442, Uncharacterized conserved protein [Function unknown]. Length = 132 Score = 26.5 bits (58), Expect = 1.6 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Query: 22 IANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQA 71 IA R+ + A G ++L+EA QI L V+E L+ + Sbjct: 28 IAASQQAAARQAAGKSGTRSAEANSNGKITLQEAQQI--LNVKEPLNREE 75 >gnl|CDD|147411 pfam05203, Hom_end_hint, Hom_end-associated Hint. Homing endonucleases are encoded by mobile DNA elements that are found inserted within host genes in all domains of life. The crystal structure of the homing nuclease PI-Sce revealed two domains: an endonucleolytic centre resembling the C-terminal domain of Drosophila melanogaster Hedgehog protein, and a a second domain containing the protein-splicing active site. This Domain corresponds to the latter protein-splicing domain. Length = 438 Score = 25.6 bits (56), Expect = 3.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 11 YVIGPDGSPLTIANLP 26 V+GPDG+P + LP Sbjct: 26 LVMGPDGTPRRVIGLP 41 >gnl|CDD|146359 pfam03683, UPF0175, Uncharacterized protein family (UPF0175). This family contains small proteins of unknown function. Length = 76 Score = 25.3 bits (56), Expect = 4.2 Identities = 8/31 (25%), Positives = 16/31 (51%) Query: 37 RKAEVVAAVKGGLLSLEEACQIYTLTVEEFL 67 R + + G +SL +A ++ ++ EFL Sbjct: 22 RLELAIKLYERGKISLGKAAELAGMSRWEFL 52 >gnl|CDD|34882 COG5290, COG5290, IkappaB kinase complex, IKAP component [Transcription]. Length = 1243 Score = 24.7 bits (53), Expect = 5.7 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 7/36 (19%) Query: 2 TEKIQSHMKYVIGPDGS-----PLTIANLPPPNTRR 32 + YVI DGS PL++ NLPPP Sbjct: 375 EYPFDNGTSYVI--DGSYMLYTPLSLKNLPPPMFSV 408 >gnl|CDD|31799 COG1611, COG1611, Predicted Rossmann fold nucleotide-binding protein [General function prediction only]. Length = 205 Score = 24.5 bits (53), Expect = 7.1 Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 28 PNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTL 61 R+ R A+ + GG +LEE + TL Sbjct: 100 FAERKRAMVRSADAFIVLPGGFGTLEELFEALTL 133 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.132 0.389 Gapped Lambda K H 0.267 0.0833 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,114,914 Number of extensions: 47661 Number of successful extensions: 131 Number of sequences better than 10.0: 1 Number of HSP's gapped: 131 Number of HSP's successfully gapped: 12 Length of query: 91 Length of database: 6,263,737 Length adjustment: 60 Effective length of query: 31 Effective length of database: 4,967,197 Effective search space: 153983107 Effective search space used: 153983107 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.2 bits)