RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780895|ref|YP_003065308.1| hypothetical protein CLIBASIA_03960 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >gnl|CDD|148310 pfam06627, DUF1153, Protein of unknown function (DUF1153). This family consists of several short, hypothetical bacterial proteins of unknown function. Length = 90 Score = 155 bits (393), Expect = 3e-39 Identities = 54/90 (60%), Positives = 68/90 (75%) Query: 1 MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYT 60 M K + V PDGSPLT A+LPPP+TRRWVA RKA VVAAV+GGLLS +EAC+ Y Sbjct: 1 MYLKKVEGPRSVTLPDGSPLTRADLPPPDTRRWVASRKAAVVAAVRGGLLSRDEACERYG 60 Query: 61 LTVEEFLSWQASIVQHGLAGLRTTQIQKYR 90 L+ EEF +WQ ++ +HG AGLR T++Q+YR Sbjct: 61 LSEEEFAAWQRAVDRHGEAGLRATRLQQYR 90 >gnl|CDD|181604 PRK08990, PRK08990, flagellar motor protein PomA; Reviewed. Length = 254 Score = 26.9 bits (60), Expect = 1.1 Identities = 10/13 (76%), Positives = 11/13 (84%) Query: 43 AAVKGGLLSLEEA 55 AA KGG L+LEEA Sbjct: 86 AARKGGFLALEEA 98 >gnl|CDD|129060 smart00827, PKS_AT, Acyl transferase domain in polyketide synthase (PKS) enzymes. Length = 298 Score = 26.6 bits (60), Expect = 1.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 40 EVVAAVKGGLLSLEEACQI 58 E+ AA G+LSLE+A ++ Sbjct: 93 EIAAAYVAGVLSLEDAARL 111 >gnl|CDD|178698 PLN03153, PLN03153, hypothetical protein; Provisional. Length = 537 Score = 26.4 bits (58), Expect = 1.8 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Query: 15 PDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLS 51 P SPL+ L +RRW R V AV LLS Sbjct: 7 PCSSPLS---LSRTRSRRWRHSRTGTAVVAVAALLLS 40 >gnl|CDD|165102 PHA02735, PHA02735, putative DNA polymerase type B; Provisional. Length = 716 Score = 26.2 bits (57), Expect = 1.8 Identities = 10/25 (40%), Positives = 12/25 (48%), Gaps = 3/25 (12%) Query: 12 VIGPD---GSPLTIANLPPPNTRRW 33 V PD P +A+LP P T W Sbjct: 288 VAAPDINSAYPAILADLPDPKTLNW 312 >gnl|CDD|178901 PRK00148, PRK00148, Maf-like protein; Reviewed. Length = 194 Score = 25.2 bits (56), Expect = 4.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Query: 21 TIANLPPPNTRRWVARRKAEVVAAV 45 IA P + +AR KAE VA Sbjct: 34 AIAASSPSELVQALARAKAEAVAEN 58 >gnl|CDD|149472 pfam08418, Pol_alpha_B_N, DNA polymerase alpha subunit B N-terminal. This is the eukaryotic DNA polymerase alpha subunit B N-terminal domain which is involved in complex formation. Also see pfam04058. Length = 240 Score = 25.1 bits (55), Expect = 4.6 Identities = 7/21 (33%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Query: 52 LEEACQIYTLTVEE-FLSWQA 71 LE C+++ L+ E+ F+ W++ Sbjct: 14 LESLCKLHRLSEEDLFIKWES 34 >gnl|CDD|182623 PRK10657, PRK10657, isoaspartyl dipeptidase; Provisional. Length = 388 Score = 24.4 bits (54), Expect = 6.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Query: 40 EVVAAVKGGLLSLEEACQIYTLTVEEFL 67 EV VK L LE+A + T V FL Sbjct: 313 EVRELVKDEGLPLEDALKPLTSNVARFL 340 >gnl|CDD|172557 PRK14067, PRK14067, exodeoxyribonuclease VII small subunit; Provisional. Length = 80 Score = 24.4 bits (53), Expect = 6.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 37 RKAEVVAAVKGGLLSLEEACQIY 59 R E+V A++GG L LEE+ +Y Sbjct: 15 RLQEIVDALEGGDLPLEESVALY 37 >gnl|CDD|132239 TIGR03195, 4hydrxCoA_B, 4-hydroxybenzoyl-CoA reductase, beta subunit. This model represents the second largest chain, beta, of the enzyme 4-hydroxybenzoyl-CoA reductase. In species capable of degrading various aromatic compounds by way of benzoyl-CoA, this enzyme can convert 4-hydroxybenzoyl-CoA to benzoyl-CoA. Length = 321 Score = 24.4 bits (53), Expect = 6.8 Identities = 10/36 (27%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 12 VIGPDG-SPLTIANLPPPNTRRWVARRKAEVVAAVK 46 ++GP G + +A L + + EV+AAV+ Sbjct: 174 IVGPAGVRRVPLAELYVEDGAAHLTLEPGEVLAAVR 209 >gnl|CDD|180870 PRK07190, PRK07190, hypothetical protein; Provisional. Length = 487 Score = 24.4 bits (53), Expect = 7.1 Identities = 11/16 (68%), Positives = 13/16 (81%), Gaps = 2/16 (12%) Query: 3 EKIQSHMKYVIGPDGS 18 E+IQS +YVIG DGS Sbjct: 150 ERIQS--RYVIGADGS 163 >gnl|CDD|130937 TIGR01882, peptidase-T, peptidase T. This model represents a tripeptide aminopeptidase known as Peptidase T, which has a substrate preference for hydrophobic peptides. Length = 410 Score = 24.1 bits (52), Expect = 7.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 14 GPDGSPLTIANLPPPN 29 G DGS L+ LP PN Sbjct: 357 GTDGSQLSYMGLPTPN 372 >gnl|CDD|163284 TIGR03480, HpnN, hopanoid biosynthesis associated RND transporter like protein HpnN. The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins appear to be related to the RND family of export proteins, particularly the hydrophobe/amphiphile efflux-3 (HAE3) family represented by TIGR00921. Length = 862 Score = 24.2 bits (53), Expect = 7.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 18 SPLTIANLPPPNTRRWVA 35 P+T+ +LPP RRWVA Sbjct: 644 EPVTLEDLPPDLRRRWVA 661 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.132 0.389 Gapped Lambda K H 0.267 0.0732 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,515,119 Number of extensions: 81311 Number of successful extensions: 233 Number of sequences better than 10.0: 1 Number of HSP's gapped: 233 Number of HSP's successfully gapped: 28 Length of query: 91 Length of database: 5,994,473 Length adjustment: 59 Effective length of query: 32 Effective length of database: 4,719,601 Effective search space: 151027232 Effective search space used: 151027232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.0 bits)