RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780895|ref|YP_003065308.1| hypothetical protein CLIBASIA_03960 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) >2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} (A:) Length = 101 Score = 136 bits (345), Expect = 7e-34 Identities = 42/82 (51%), Positives = 56/82 (68%) Query: 10 KYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69 + V PDGS +T A+LPP NTRRWVA RK VV V GL++L EA Q Y L+ EEF SW Sbjct: 11 RSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSW 70 Query: 70 QASIVQHGLAGLRTTQIQKYRE 91 +++ +HG L+ T ++KYR+ Sbjct: 71 VSALAEHGKDALKVTALKKYRQ 92 >2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} (A:) Length = 95 Score = 136 bits (345), Expect = 8e-34 Identities = 41/82 (50%), Positives = 56/82 (68%) Query: 10 KYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69 + V PDG+ L+ A+LPP +TRRWVA RKA VV AV GL++ EA Y+L+ EEF W Sbjct: 10 RQVTLPDGTVLSRADLPPLDTRRWVASRKAAVVKAVIHGLITEREALDRYSLSEEEFALW 69 Query: 70 QASIVQHGLAGLRTTQIQKYRE 91 ++++ HG L+ T IQKYR+ Sbjct: 70 RSAVAAHGEKALKVTMIQKYRQ 91 >2k53_A A3DK08 protein; NESG, CMR9, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium thermocellum atcc 27405} (A:) Length = 76 Score = 26.6 bits (59), Expect = 1.1 Identities = 5/41 (12%), Positives = 14/41 (34%) Query: 28 PNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLS 68 T + S+E+AC ++ + ++ + Sbjct: 17 RGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVK 57 >2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} (A:184-458) Length = 275 Score = 26.5 bits (57), Expect = 1.5 Identities = 5/25 (20%), Positives = 12/25 (48%) Query: 16 DGSPLTIANLPPPNTRRWVARRKAE 40 DG L+ ++ P ++ +A+ Sbjct: 1 DGYALSREDIKNPKFQKLIAKNLKL 25 >2k5e_A Uncharacterized protein; helix protein, structural genomic, structural genomics, PSI-2, protein structure initiative; NMR {Methanococcus jannaschii} (A:) Length = 73 Score = 26.2 bits (58), Expect = 1.7 Identities = 8/41 (19%), Positives = 14/41 (34%) Query: 28 PNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLS 68 P + + + SLE+ + L VE+ L Sbjct: 19 PGVAGVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILR 59 >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} (A:142-749) Length = 608 Score = 25.2 bits (53), Expect = 3.6 Identities = 5/34 (14%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Query: 22 IANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEA 55 + + + +RK + ++K LL + + Sbjct: 5 FSMALCDQEKTFRQQRKEHIRESMK-KLLGPKNS 37 >2gtt_A Nucleoprotein; protein-RNA complex, viral protein, RNA binding protein; 3.49A {Rabies virus} (A:227-450) Length = 224 Score = 24.8 bits (54), Expect = 3.8 Identities = 6/22 (27%), Positives = 10/22 (45%) Query: 48 GLLSLEEACQIYTLTVEEFLSW 69 GL+S + LT E + + Sbjct: 12 GLVSFTGFIKQINLTAREAILY 33 >3hhw_K Nucleoprotein; protein complex, template, replication, negative strand RNA virus, chaperone, cytoplasm, phosphoprotein; HET: TAR; 2.70A {Vesicular stomatitis indiana virus} PDB: 2qvj_A* 3hhz_K 2gic_A (K:215-421) Length = 207 Score = 24.8 bits (54), Expect = 4.1 Identities = 5/22 (22%), Positives = 11/22 (50%) Query: 48 GLLSLEEACQIYTLTVEEFLSW 69 L + C+I ++ E+ +W Sbjct: 12 ALATFGHLCKITGMSTEDVTTW 33 >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} (A:1-43,A:187-413) Length = 270 Score = 24.4 bits (52), Expect = 5.4 Identities = 10/31 (32%), Positives = 12/31 (38%) Query: 15 PDGSPLTIANLPPPNTRRWVARRKAEVVAAV 45 DG P PP T + AE V A+ Sbjct: 240 TDGEPTREGGAPPSGTSQPDEAGAAEAVTAI 270 >2cuy_A Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus HB8} (A:1-123,A:194-305) Length = 235 Score = 24.3 bits (52), Expect = 5.8 Identities = 8/26 (30%), Positives = 11/26 (42%) Query: 33 WVARRKAEVVAAVKGGLLSLEEACQI 58 E A V G L LE+A ++ Sbjct: 85 AAGHSLGEWTAHVAAGTLELEDALRL 110 >3b59_A Glyoxalase/bleomycin resistance protein/dioxygenase; 11004Z, NYSGXRC, PSI-2, structural genomics; 2.53A {Novosphingobium aromaticivorans DSM12444} (A:1-134) Length = 134 Score = 24.4 bits (52), Expect = 6.1 Identities = 6/26 (23%), Positives = 11/26 (42%) Query: 11 YVIGPDGSPLTIANLPPPNTRRWVAR 36 PDG +++ +R +AR Sbjct: 109 RFFSPDGLLFEVSSDVAKGAKRDLAR 134 >5csm_A Chorismate mutase; chorismate pyruvatemutase, allosteric protein, complex (isomerase/peptide), transition state analog; HET: TRP; 2.00A {Saccharomyces cerevisiae} (A:) Length = 256 Score = 24.3 bits (53), Expect = 6.6 Identities = 5/27 (18%), Positives = 9/27 (33%) Query: 2 TEKIQSHMKYVIGPDGSPLTIANLPPP 28 E S ++ PD +P + Sbjct: 67 LEIAHSRIRRFESPDETPFFPDKIQKS 93 >3ezo_A Malonyl COA-acyl carrier protein transacylase; ssgcid, acyl-carrier-protein S-malonyltransferase, acyltransferase, transferase; 2.05A {Burkholderia pseudomallei 1710B} (A:1-132,A:207-318) Length = 244 Score = 24.3 bits (52), Expect = 6.7 Identities = 5/26 (19%), Positives = 9/26 (34%) Query: 33 WVARRKAEVVAAVKGGLLSLEEACQI 58 E A V G ++ +A + Sbjct: 94 VAGHSLGEYTALVAAGAIAFRDALPL 119 >2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5; 2.73A {Saccharopolyspora erythraea} (A:550-674,A:746-852) Length = 232 Score = 23.9 bits (51), Expect = 7.3 Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 33 WVARRKAEVVAAVKGGLLSLEEACQI 58 V + E+ AA G L+LE+A ++ Sbjct: 89 VVGHSQGEIAAAHVAGALTLEDAAKL 114 >2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* (G:135-313,G:492-559) Length = 247 Score = 23.9 bits (51), Expect = 8.5 Identities = 4/19 (21%), Positives = 4/19 (21%) Query: 40 EVVAAVKGGLLSLEEACQI 58 V A S E Sbjct: 139 LVTAVAIAETDSWESFFVS 157 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:144-317,B:429-553) Length = 299 Score = 23.9 bits (51), Expect = 8.9 Identities = 4/20 (20%), Positives = 4/20 (20%) Query: 39 AEVVAAVKGGLLSLEEACQI 58 V A S E Sbjct: 133 GLVTAVAIAETDSWESFFVS 152 >2fi0_A Conserved domain protein; structural genomics,streptococcus pneumoniae, PSI, protein structure initiative; 2.10A {Streptococcus pneumoniae TIGR4} (A:) Length = 81 Score = 23.5 bits (51), Expect = 9.4 Identities = 7/70 (10%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Query: 5 IQSHMKYVIGPDGSPLTIANLPP--PNTRRWVARR-----KAEVVAAVKGGLLSLEEACQ 57 ++ M +I + +A + P + ++ G +SL++ + Sbjct: 1 MEVVMDNIIDVS---IPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRKVSLKQGSK 57 Query: 58 IYTLTVEEFL 67 + +++ + Sbjct: 58 LAGTPMDKIV 67 >2qc3_A MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP transacylase, , nucleophilic attack; 2.30A {Mycobacterium tuberculosis H37RV} PDB: 2qj3_A (A:1-128,A:196-303) Length = 236 Score = 23.8 bits (51), Expect = 9.6 Identities = 4/26 (15%), Positives = 11/26 (42%) Query: 33 WVARRKAEVVAAVKGGLLSLEEACQI 58 E+ A G+++ ++A + Sbjct: 88 VAGHSVGEIAAYAIAGVIAADDAVAL 113 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.132 0.389 Gapped Lambda K H 0.267 0.0664 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 717,208 Number of extensions: 28302 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's gapped: 127 Number of HSP's successfully gapped: 24 Length of query: 91 Length of database: 4,956,049 Length adjustment: 52 Effective length of query: 39 Effective length of database: 3,198,189 Effective search space: 124729371 Effective search space used: 124729371 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.2 bits)