RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780896|ref|YP_003065309.1| ABC transporter membrane spanning protein (branched chain amino acid) [Candidatus Liberibacter asiaticus str. psy62] (351 letters) >2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics, NPPSFA; 2.70A {Thermus thermophilus HB8} (A:124-312) Length = 189 Score = 26.8 bits (58), Expect = 4.3 Identities = 7/74 (9%), Positives = 13/74 (17%) Query: 190 MCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFF 249 + L A A R+ K + +A Sbjct: 109 VPTLRAHAEAVSVEFARPVTPEAAREVLKEAPGVEVVDEPEAKRYPMPLTASGKWDVEVG 168 Query: 250 AASRDRISPDMFKF 263 + + F Sbjct: 169 RIRKSLAFENGLDF 182 >2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A (A:544-613,A:740-769) Length = 100 Score = 26.2 bits (58), Expect = 6.4 Identities = 11/36 (30%), Positives = 15/36 (41%), Gaps = 14/36 (38%) Query: 164 RSLIRF--------------FRFPSSFVIYEIFMYY 185 R LIR FRF +F +Y FM++ Sbjct: 9 RQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFH 44 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 26.3 bits (58), Expect = 7.0 Identities = 7/35 (20%), Positives = 12/35 (34%), Gaps = 15/35 (42%) Query: 105 ACGMIMGLPSLK----FRGDYLAIATLIMSEIFQN 135 + +M + SL +RG + M Q Sbjct: 1 SLADVMSIESLVEVVFYRG-------MTM----QV 24 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.333 0.144 0.433 Gapped Lambda K H 0.267 0.0375 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,540,002 Number of extensions: 110782 Number of successful extensions: 350 Number of sequences better than 10.0: 1 Number of HSP's gapped: 348 Number of HSP's successfully gapped: 21 Length of query: 351 Length of database: 4,956,049 Length adjustment: 89 Effective length of query: 262 Effective length of database: 1,947,404 Effective search space: 510219848 Effective search space used: 510219848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 55 (25.9 bits)