RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780897|ref|YP_003065310.1| trigger factor [Candidatus Liberibacter asiaticus str. psy62] (473 letters) >gnl|CDD|30890 COG0544, Tig, FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones]. Length = 441 Score = 232 bits (593), Expect = 2e-61 Identities = 117/450 (26%), Positives = 232/450 (51%), Gaps = 12/450 (2%) Query: 1 MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGK 60 M+V + EGL+ L V +P+ + + ++ ++ + K I GFR GKVP I+ YG+ Sbjct: 1 MKVTVEKLEGLEVRLTVEVPAEEIKKALDKALKKLAKKVKIPGFRKGKVPRKVIEQRYGE 60 Query: 61 SILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDI 120 ++ + ++E++ E E + + + A +P I I E E D + ++ Sbjct: 61 AVRQDVLNELLPEAFEEAIKEEGLKPAGQPEIEITEFEKG---------EDFEFTAEVEV 111 Query: 121 LPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVS 180 P++E+ + ++V + + EV ++++D ++ ++ K E E +E GD+VT+D+ S Sbjct: 112 YPEVELGDYKGIEVEKPVVEVTDEDVDEELEKLRKRFATLEPVEGAAENGDRVTIDFEGS 171 Query: 181 VDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKV 240 VD E +N +GS + LVG+K G++K+I+ FPED+ ++LAGK+ Sbjct: 172 VDGEEFEGGKAENFSLELGSGRFIPGFEDQLVGMKAGEEKDIKVTFPEDYHAEELAGKEA 231 Query: 241 RLNFSIKEVFSPLPVVVNNDLAVRLG-FESESAMRGLCSQKIKQHSEFLVRQKVKRQILD 299 +KEV ++++ A +LG ++ ++ + +++ + +K K Q+LD Sbjct: 232 TFKVKVKEVKKRELPELDDEFAKKLGEEDTLEELKEKLRKNLERELKEATLEKRKEQLLD 291 Query: 300 YISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQ-YYHMLAKRRV 358 + FD+PESLVE E + +L++ ++ S EE+L+ + A++RV Sbjct: 292 ALVEANDFDLPESLVEAEIDNLLKQALQQLQQQGIDSLEASGESEEELREEFKEEAEKRV 351 Query: 359 LTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGH-EKKMLDHFQKYPNALAELRAPIF 417 G++L I ++ +EVTEEE+++ + + ++ G ++++ + L L+A I Sbjct: 352 KLGLLLEEIAKEEKLEVTEEEIKAEIEELARQYGGEQPEEVIKLYYNNQELLDALKADIL 411 Query: 418 EDKVIDHILKSVQIVDRKVTFDQLFDNSSE 447 E+K +D +L + + V K + N +E Sbjct: 412 EEKAVDLLLANKKKVTEKEVSFEELMNEAE 441 >gnl|CDD|147704 pfam05697, Trigger_N, Bacterial trigger factor protein (TF). In the E. coli cytosol, a fraction of the newly synthesized proteins requires the activity of molecular chaperones for folding to the native state. The major chaperones implicated in this folding process are the ribosome-associated Trigger Factor (TF), and the DnaK and GroEL chaperones with their respective co-chaperones. Trigger Factor is an ATP-independent chaperone and displays chaperone and peptidyl-prolyl-cis-trans-isomerase (PPIase) activities in vitro. It is composed of at least three domains, an N-terminal domain which mediates association with the large ribosomal subunit, a central substrate binding and PPIase domain with homology to FKBP proteins, and a C-terminal domain of unknown function. The positioning of TF at the peptide exit channel, together with its ability to interact with nascent chains as short as 57 residues renders TF a prime candidate for being the first chaperone that binds to the nascent polypeptide chains. This family represents the N-terminal region of the protein. Length = 144 Score = 109 bits (275), Expect = 2e-24 Identities = 41/153 (26%), Positives = 82/153 (53%), Gaps = 9/153 (5%) Query: 1 MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGK 60 M+V + EGL+ +L V +P+ + ++ ++ ++++ K I GFR GKVP S +K YGK Sbjct: 1 MKVTVEKLEGLEVKLTVEVPAEEVEEAVDKALKELAKKVKIPGFRKGKVPRSVVKKRYGK 60 Query: 61 SILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDI 120 I E ++++++E E L + R +P I E E DL+ +++ Sbjct: 61 EIYQEALEDLLQEAYEEALKEEKLRPIGQPEIEEVELEEG---------KDLEFTAEFEV 111 Query: 121 LPQIEISSFDDLQVTQDICEVDEKEIDRQMAEI 153 P++E+ + L+V + EV ++++D ++ + Sbjct: 112 YPEVELGDYKGLEVEKPEVEVTDEDVDEELERL 144 >gnl|CDD|147705 pfam05698, Trigger_C, Bacterial trigger factor protein (TF) C-terminus. In the E. coli cytosol, a fraction of the newly synthesized proteins requires the activity of molecular chaperones for folding to the native state. The major chaperones implicated in this folding process are the ribosome-associated Trigger Factor (TF), and the DnaK and GroEL chaperones with their respective co-chaperones. Trigger Factor is an ATP-independent chaperone and displays chaperone and peptidyl-prolyl-cis-trans-isomerase (PPIase) activities in vitro. It is composed of at least three domains, an N-terminal domain which mediates association with the large ribosomal subunit, a central substrate binding and PPIase domain with homology to FKBP proteins, and a C-terminal domain of unknown function. The positioning of TF at the peptide exit channel, together with its ability to interact with nascent chains as short as 57 residues renders TF a prime candidate for being the first chaperone that binds to the nascent polypeptide chains. This family represents the C-terminal region of the protein. Length = 162 Score = 89.6 bits (223), Expect = 2e-18 Identities = 32/152 (21%), Positives = 77/152 (50%), Gaps = 5/152 (3%) Query: 280 KIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNV 339 ++++ + +++K ILD + ++PESLVE E + +L++ ++ + Sbjct: 12 QLEEEKKEATAEELKEAILDKLVENAEIELPESLVEEEIDRLLRQFLQQLQGQGLDLEEY 71 Query: 340 DSIDEEDLQYYHM----LAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHE 395 S+ + A++RV G++L I ++ IEVT+EE++ + + ++ Sbjct: 72 LSLSGSSEEELREEFKEEAEKRVKLGLILEEIAKEEKIEVTDEEIKEEIEELASQYGMEP 131 Query: 396 KKMLDHFQKYPNALAELRAPIFEDKVIDHILK 427 +++ + ++K A L+ + E+K +D +L+ Sbjct: 132 EEVKEFYKKNEQLSA-LKEDLLEEKAVDLLLE 162 >gnl|CDD|144003 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase. Length = 95 Score = 38.4 bits (90), Expect = 0.004 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Query: 161 EVKETESEIGDKVTVDYTVSVDNVILEDQS---KKNVQFIVGSADLFSETTEILVGLKTG 217 + + GD VTV YT +++ + D S K +F +GS + E L+G+K G Sbjct: 1 GDGPRKPKKGDTVTVHYTGKLEDGTVFDSSYDRGKPFEFTLGSGQVIPGWDEGLLGMKVG 60 Query: 218 DQKEIE 223 +++++ Sbjct: 61 EKRKLT 66 >gnl|CDD|31248 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones]. Length = 174 Score = 34.8 bits (80), Expect = 0.049 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Query: 168 EIGDKVTVDYTVSVDNVILEDQSKKNVQ---FIVGSADLFSETTEILVGLKTGDQKEIE 223 E GD V++ YT+ V++ + D + +N FIVG+ L E L+G + G++ +E Sbjct: 4 EKGDVVSLHYTLKVEDGEVVDTTDENYGPLTFIVGAGQLIPGLEEALLGKEVGEEFTVE 62 >gnl|CDD|36139 KOG0921, KOG0921, KOG0921, Dosage compensation complex, subunit MLE [Transcription]. Length = 1282 Score = 29.5 bits (65), Expect = 2.1 Identities = 15/76 (19%), Positives = 30/76 (39%) Query: 125 EISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSVDNV 184 ++ ++Q I E + + D + +I V + SEI V + V + Sbjct: 342 PLAFMSMESISQRIMEKERFKRDEALDKITAQREELPVAQYRSEILQAVAENRVVIIKGE 401 Query: 185 ILEDQSKKNVQFIVGS 200 +S + QF++ S Sbjct: 402 TGCGKSTQVAQFLLES 417 >gnl|CDD|31094 COG0751, GlyS, Glycyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis]. Length = 691 Score = 29.4 bits (66), Expect = 2.4 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Query: 377 EEEMQSALYQQLGRFPGHEKKMLDH--FQKYPNALAELRAPI--FEDKVI 422 EE+ + AL++ L + L +Q ALAELR PI F D V+ Sbjct: 608 EEDAEKALFEALQALKPKVAEALAEKDYQDALAALAELRPPIDEFFDNVM 657 >gnl|CDD|32793 COG2974, RdgC, DNA recombination-dependent growth factor C [DNA replication, recombination, and repair]. Length = 303 Score = 29.1 bits (65), Expect = 2.9 Identities = 16/76 (21%), Positives = 36/76 (47%), Gaps = 15/76 (19%) Query: 13 RELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIK 72 R+ + I+P++ + D+ +IE+I +K +G + K +K D+++ Sbjct: 68 RKEEKILPASVVKDALEAKIEEIEAK---QGRKLKKKEKDELK------------DDVVH 112 Query: 73 EIVPEILSKRDERAAM 88 E++P S+ + A Sbjct: 113 ELLPRAFSRSSQTFAW 128 >gnl|CDD|34230 COG4592, FepB, ABC-type Fe2+-enterobactin transport system, periplasmic component [Inorganic ion transport and metabolism]. Length = 319 Score = 27.3 bits (60), Expect = 8.5 Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 383 ALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPI 416 +L QLG GHEK+ ++ LAE++ I Sbjct: 154 SLATQLGEATGHEKQAEARIAQFDKQLAEVKQQI 187 >gnl|CDD|30790 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 589 Score = 27.1 bits (60), Expect = 9.4 Identities = 17/49 (34%), Positives = 25/49 (51%) Query: 120 ILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESE 168 I P IE + D V + I D +I+++M EIAK N+ E + E Sbjct: 50 IGPVIEEGFYYDFDVKEPITPEDLLKIEKEMKEIAKENLPIEREVVSRE 98 >gnl|CDD|37967 KOG2756, KOG2756, KOG2756, Predicted Mg2+-dependent phosphodiesterase TTRAP [Signal transduction mechanisms]. Length = 349 Score = 27.3 bits (60), Expect = 9.6 Identities = 16/72 (22%), Positives = 32/72 (44%), Gaps = 9/72 (12%) Query: 51 LSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTV 110 + H +LY ++ ++E++P S +R++ IT +E L + V Sbjct: 122 VCHYLALYSPDVI------FLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRV 175 Query: 111 DLKLRLSYDILP 122 +K S +I+P Sbjct: 176 KVK---SQEIIP 184 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.133 0.354 Gapped Lambda K H 0.267 0.0753 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,383,433 Number of extensions: 287502 Number of successful extensions: 622 Number of sequences better than 10.0: 1 Number of HSP's gapped: 613 Number of HSP's successfully gapped: 26 Length of query: 473 Length of database: 6,263,737 Length adjustment: 97 Effective length of query: 376 Effective length of database: 4,167,664 Effective search space: 1567041664 Effective search space used: 1567041664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 59 (26.5 bits)