HHsearch results for GI: 254780898 and protein with PDBid: 1zcl_A

>1zcl_A Protein tyrosine phosphatase 4A1; PRL-1 PTP4A dual specific phosphatase, hydrolase; 2.90A {Rattus norvegicus} PDB: 1x24_A
Probab=99.77  E-value=2.4e-18  Score=134.49  Aligned_cols=107  Identities=17%  Similarity=0.255  Sum_probs=87.4

Q ss_pred             CHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHH-----CCCCCEEE
Q ss_conf             9899999999749938997378787654445799999669849987526888989899999999994-----27994999
Q gi|254780898|r   59 NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK-----TAPKPLLI  133 (207)
Q Consensus        59 ~~~~~~~l~k~~GIktIInLr~~~~~~~~~~e~~~~~~~gi~~i~ip~~~~~~~~~~~i~~~~~il~-----~~~~PVlV  133 (207)
                      +-+++.+.++++||++||+|..+..      +.+..+..||.+.++|++|..+|+.+.+..+++.++     +.++||+|
T Consensus        49 ti~~f~~~lk~~gv~~IV~l~e~~y------~~~~~~~~gI~~~~~p~~D~~~P~~~~i~~~~~~v~~~~~~~~~~~V~V  122 (180)
T 1zcl_A           49 TLNKFIEELKKYGVTTIVRVCEATY------DTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAV  122 (180)
T ss_dssp             SHHHHHHHHHTTTEEEEEECSCCCS------CSHHHHTTTCEEEECCCCTTSCCCSHHHHHHHHHHHHHHHHSTTCEEEE
T ss_pred             CHHHHHHHHHHCCCEEEEECCCCCC------CHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             4999999999879909998999978------8699997598899951699999799999999999999998489994898


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHH-CCCCC
Q ss_conf             8289988899999999999839998999996100-02642
Q gi|254780898|r  134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF  172 (207)
Q Consensus       134 HC~aG~~RTG~~~alyli~~~g~~~~eA~~el~~-~ygh~  172 (207)
                      ||.+|.||||+++|+|++. .|++.++|+..+.. |.|-+
T Consensus       123 HC~aG~gRTgt~va~yLi~-~g~~~~~Al~~vR~~Rpgai  161 (180)
T 1zcl_A          123 HSVAGLGRAPVLVALALIE-GGMKYEDAVQFIRQKRRGAF  161 (180)
T ss_dssp             EESSSSSHHHHHHHHHHHH-TSSCHHHHHHHHHHSSTTCC
T ss_pred             EECCCCCHHHHHHHHHHHH-HCCCHHHHHHHHHHHCCCCC
T ss_conf             8499977599999999999-29799999999998789987