HHsearch results for GI: 254780898 and protein with PDBid: 2img_A

>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens}
Probab=99.91  E-value=2.8e-23  Score=165.50  Aligned_cols=125  Identities=20%  Similarity=0.308  Sum_probs=104.5

Q ss_pred             HCCCCCCCCCCEEECCCCC-HHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHH
Q ss_conf             0787250289477138999-899999999749938997378787654445799999669849987526888989899999
Q gi|254780898|r   41 TQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ  119 (207)
Q Consensus        41 ~~Nf~~V~~g~lyRS~qP~-~~~~~~l~k~~GIktIInLr~~~~~~~~~~e~~~~~~~gi~~i~ip~~~~~~~~~~~i~~  119 (207)
                      -+||+||+||++++|+.|+ +++++ .++++||++||||+.+.+...       ....|+.+.++|+.|...|+.+++..
T Consensus         6 p~~f~wI~pg~l~g~~~P~~~~~~~-~l~~~gI~~Vv~l~~~~~~~~-------~~~~~i~~~~~p~~D~~~p~~~~~~~   77 (151)
T 2img_A            6 PPNFSWVLPGRLAGLALPRLPAHYQ-FLLDLGVRHLVSLTERGPPHS-------DSCPGLTLHRLRIPDFCPPAPDQIDR   77 (151)
T ss_dssp             CTTCEEEETTTEEEESCCCSHHHHH-HHHHTTEEEEEECSSSCCTTG-------GGCTTSEEEECCCCTTCCCCHHHHHH
T ss_pred             CCCCCEECCCEEEEECCCCCHHHHH-HHHHCCCCEEEECCCCCCCCH-------HHCCCCEEEEEECCCCCCCCHHHHHH
T ss_conf             9999788079899989999979999-999769999998379998704-------64199479997525899989999999


Q ss_pred             HHHHHHC---CCCCEEEECCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHH-CCCCCC
Q ss_conf             9999942---79949998289988899999999999839998999996100-026426
Q gi|254780898|r  120 LISILKT---APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP  173 (207)
Q Consensus       120 ~~~il~~---~~~PVlVHC~aG~~RTG~~~alyli~~~g~~~~eA~~el~~-~ygh~~  173 (207)
                      +.+++++   .+++|||||.+|.+|||+++++|||...||+.++|++.+.- +.+-+.
T Consensus        78 ~~~~i~~~~~~~~~VlVHC~~G~~RSg~v~~ayLm~~~~~~~~~Al~~vr~~Rp~~v~  135 (151)
T 2img_A           78 FVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIE  135 (151)
T ss_dssp             HHHHHHHHHHTTCEEEEECSSSSSHHHHHHHHHHHHHHCCCHHHHHHHHHHHSTTCSC
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCC
T ss_conf             9999999986599289986898876799999999998499999999999987879999