HHsearch results for GI: 254780898 and protein with PDBid: 3f41_A

>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida}
Probab=99.16  E-value=4e-10  Score=82.73  Aligned_cols=113  Identities=19%  Similarity=0.255  Sum_probs=94.0

Q ss_pred             CEEECCCCCHHHHHHHHHHCCCC----EEEECCCCCC-------------CC----------------------------
Q ss_conf             47713899989999999974993----8997378787-------------65----------------------------
Q gi|254780898|r   51 EIYRSAQPNGTFIEYLKKEYGIK----SILNLRGKLP-------------ES----------------------------   85 (207)
Q Consensus        51 ~lyRS~qP~~~~~~~l~k~~GIk----tIInLr~~~~-------------~~----------------------------   85 (207)
                      .+..|+||++.++..+++..+-+    .|||||.+.-             .+                            
T Consensus        87 ~iSGs~qfS~~~l~~i~~~i~~~~~pi~vvdLReEshgyiNg~pvs~~~~~n~~N~G~s~~~v~~~E~~~l~~l~~~~~~  166 (629)
T 3f41_A           87 NVSASSCFSEKELEAILKKVPVKPSQFYDVDLRGESHGYLNGTAVSWFANHDWGNDGRTEDIIIPLEKEQLASLKGSTVK  166 (629)
T ss_dssp             CEEEESCCCHHHHHHHHHHSSSCGGGEEEEEEECSCEEEETTEEEEEECGGGCTTTTCCHHHHHHHHHHHHHTTSSCSEE
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCEEEECCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCE
T ss_conf             31412678989999999973777786699986878866788905787577787677858999999999999998666866


Q ss_pred             ---------------------CCHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCC--CEEEECCCCCCHH
Q ss_conf             ---------------------44457999996698499875268889898999999999942799--4999828998889
Q gi|254780898|r   86 ---------------------WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRT  142 (207)
Q Consensus        86 ---------------------~~~~e~~~~~~~gi~~i~ip~~~~~~~~~~~i~~~~~il~~~~~--PVlVHC~aG~~RT  142 (207)
                                           ....|.+.++..|+.|+.+|+.+...|.++++..|+.++.+.+.  .+++||++|.|||
T Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~V~tEeel~~~~~~~Y~Rlpvtd~~~P~~~~~D~fv~~~r~~p~~~~l~FhCq~G~GRT  246 (629)
T 3f41_A          167 SIYRFDDKKNVILSPVYVNYNKVRTEEEMVKQHGANYFRLTLQDHFRPDDPDVDKFLEFYKSLPKDAWLHYHCYAGMGRT  246 (629)
T ss_dssp             EEEEEETTTTEEEEEEEEECSCEECHHHHHHTTTCEEEEEEECTTSCCCHHHHHHHHHHHHTSCTTCEEEEECSSSSHHH
T ss_pred             EEECCCCCCCCCCCCCEECCCCCCCHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHH
T ss_conf             75203444556788623116133449999874597189952688889886889999999972999973999778999606


Q ss_pred             HHHHHHHHHHH--CCCCHHHHHH
Q ss_conf             99999999998--3999899999
Q gi|254780898|r  143 GLASAVYLYIV--AHYPKEEAHR  163 (207)
Q Consensus       143 G~~~alyli~~--~g~~~~eA~~  163 (207)
                      .++.++|.|+.  ...+.+++..
T Consensus       247 Tt~Mvm~dm~~n~~~vs~~eii~  269 (629)
T 3f41_A          247 TIFMVMHDILKNAKDVSFDDIIQ  269 (629)
T ss_dssp             HHHHHHHHHHHHTTTSCHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             48899999860654367799999