HHsearch results for GI: 254780898 and protein with PDBid: 3f81_A

>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A*
Probab=99.85  E-value=1.2e-20  Score=149.06  Aligned_cols=139  Identities=19%  Similarity=0.238  Sum_probs=106.8

Q ss_pred             HCCCCCCCCCCEEECCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHCCCEEEEEECCCCCCCC-H---HH
Q ss_conf             0787250289477138999899999999749938997378787654445799999669849987526888989-8---99
Q gi|254780898|r   41 TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELN-D---EQ  116 (207)
Q Consensus        41 ~~Nf~~V~~g~lyRS~qP~~~~~~~l~k~~GIktIInLr~~~~~~~~~~e~~~~~~~gi~~i~ip~~~~~~~~-~---~~  116 (207)
                      ..+|++|.|| ||.|+++++.+.+. ++++||++|||++.+.+......+.+.++..|+.|.++|+.|....+ .   +.
T Consensus        25 ~~~~seI~p~-LylG~~~~a~d~~~-L~~~gI~~Vinl~~~~~~~~~~~~~~~~~~~~i~y~~ip~~D~~~~~i~~~~~~  102 (183)
T 3f81_A           25 SQPCNEVTPR-IYVGNASVAQDIPK-LQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFER  102 (183)
T ss_dssp             SSSEEEEETT-EEEECHHHHTCHHH-HHHHTCCEEEETTBSSSTTSBCCCTGGGTTTTCEEEECCCCCSTTSCGGGGHHH
T ss_pred             CCCCCEEECC-EEECCHHHHCCHHH-HHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCHHHHHHH
T ss_conf             9973132278-25758225469999-998899199978788775556766000136898899986467887338999999


Q ss_pred             HHHHHH-HHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHH
Q ss_conf             999999-9942799499982899888999999999998399989999961000264267424599999
Q gi|254780898|r  117 IKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDIT  183 (207)
Q Consensus       117 i~~~~~-il~~~~~PVlVHC~aG~~RTG~~~alyli~~~g~~~~eA~~el~~~ygh~~~~~~~~ld~~  183 (207)
                      +..+++ ...+.+++|||||.+|.+|||+++++|+|..+||+.++|.+.++-++. +. ++.+++...
T Consensus       103 ~~~fi~~~~~~~~~~VLVHC~~G~~RS~~vv~aYLm~~~~~s~~~A~~~vr~~R~-i~-pn~~f~~qL  168 (183)
T 3f81_A          103 AADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNRE-IG-PNDGFLAQL  168 (183)
T ss_dssp             HHHHHHHHHHSTTCCEEEECSSSSSHHHHHHHHHHHHHHCCCHHHHHHHHHHHSC-CC-CCHHHHHHH
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHCCC-CC-CCHHHHHHH
T ss_conf             9999999986289659998388886658999999999849799999999997699-99-898999999