BLAST/PSIBLAST alignment of GI: 254780898 and GI: 15889438 at iteration 1
>gi|15889438|ref|NP_355119.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str. C58] Length = 186
>gi|15157300|gb|AAK87904.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str. C58] Length = 186
 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 106/160 (66%), Gaps = 1/160 (0%)

Query: 15  YIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKS 74
           ++KI    LV   V  G + + I   T NFH V+P E+YRSAQP+G  I    K YGIK+
Sbjct: 7   FLKITAIGLVALPVLAGAH-MGIGQLTGNFHEVIPGELYRSAQPSGKDIAAYAKAYGIKT 65

Query: 75  ILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIH 134
           I+NLR +  E W++ E  AA + GI+L+++PLS++ +++ E  + L ++L+ A KP+LIH
Sbjct: 66  IINLRDEKREGWYEAESLAAKNNGIRLVDYPLSSSEKVSVEDSETLAAVLRNAEKPVLIH 125

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           C+ GA+RTGLASA+Y+ +VA   +  A  QLS  YGH P+
Sbjct: 126 CEHGANRTGLASAIYVAVVAGKSEAAAEFQLSPYYGHVPI 165