BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780898|ref|YP_003065311.1| hypothetical protein
CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62]
         (207 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040575|gb|ACT57371.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG
Sbjct: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL
Sbjct: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM
Sbjct: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180

Query: 181 DITFEKITQLYPNNVSKGDTEQPMNAT 207
           DITFEKITQLYPNNVSKGDTEQPMNAT
Sbjct: 181 DITFEKITQLYPNNVSKGDTEQPMNAT 207


>gi|315122684|ref|YP_004063173.1| hypothetical protein CKC_04680 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496086|gb|ADR52685.1| hypothetical protein CKC_04680 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 207

 Score =  231 bits (588), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/201 (53%), Positives = 153/201 (76%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIE 64
           KK ++N+ + +   LLG+ V+  + LGL+   +T++TQNFH +VP+E+YRSAQP G FIE
Sbjct: 5   KKLKQNIFLSFKISLLGLFVIFPIVLGLFCFILTSYTQNFHVIVPNELYRSAQPTGQFIE 64

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
            + +++GIKSILNLRG+  E W++EEE    +LGIQLINFP+ A++ELN+ +IK+LI IL
Sbjct: 65  TIWEKHGIKSILNLRGENNEPWYREEEMTIRNLGIQLINFPIPASKELNNAEIKKLIDIL 124

Query: 125 KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           + APKPLLIHCK+GADRTGLASA+YLY ++HYPK +A  QLS+ YGH P+    +MDITF
Sbjct: 125 RKAPKPLLIHCKAGADRTGLASALYLYSISHYPKYKASGQLSIFYGHIPLFGARSMDITF 184

Query: 185 EKITQLYPNNVSKGDTEQPMN 205
           EK T+ + N++   + +  +N
Sbjct: 185 EKYTKEFSNDLYIENAKHFLN 205


>gi|206890973|ref|YP_002248592.1| hypothetical protein THEYE_A0750 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206742911|gb|ACI21968.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 190

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 106/150 (70%), Gaps = 1/150 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHKEEEKAANDLGIQL 101
           NFH + P E YRSAQ +   +EY  K+Y IKSILNLRGK P + W+ EE + +++L ++ 
Sbjct: 31  NFHIITPGEAYRSAQLDRDELEYYIKKYNIKSILNLRGKNPNAAWYIEELQVSSELNVKH 90

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            +  LSATREL DE++++LI I K+AP+P+LIHCKSGADR+GL +A++  +V   PK EA
Sbjct: 91  YDIALSATRELTDEEVRKLIEIFKSAPRPVLIHCKSGADRSGLVAAMWKVVVDGEPKSEA 150

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQLY 191
            +QLS+LYGH    KT  MD  F++  + +
Sbjct: 151 RKQLSLLYGHLSTGKTKAMDQFFDEFFEKW 180


>gi|222085806|ref|YP_002544336.1| hypothetical protein Arad_2152 [Agrobacterium radiobacter K84]
 gi|221723254|gb|ACM26410.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 198

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 110/173 (63%), Gaps = 5/173 (2%)

Query: 18  ILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILN 77
           +LL +     ++ G Y   +  +T NFH V+  E+YRS+QP+ + I  L+K+YGIK+I+N
Sbjct: 19  VLLALSPFALIATGFYAHML--WTTNFHPVIAGEVYRSSQPSASTIAELQKQYGIKTIIN 76

Query: 78  LRGK-LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCK 136
           LRG     +W+  E   A +L I  I+F +S+  EL   Q  QL+ I++ APKPLLIHC+
Sbjct: 77  LRGNNTGHAWYDSEVAQAKELNIDHIDFRMSSAHELTQAQAAQLVEIMRDAPKPLLIHCQ 136

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFP--VLKTITMDITFEKI 187
           +G+DRTGLASA+YL  +A   +  A  Q+S++YGH P    +   MD TFEK+
Sbjct: 137 AGSDRTGLASALYLAAIAKTGEATAESQMSIIYGHLPFSFTRAYAMDRTFEKL 189


>gi|15888562|ref|NP_354243.1| hypothetical protein Atu8150 [Agrobacterium tumefaciens str. C58]
 gi|15156276|gb|AAK87028.1| hypothetical protein Atu8150 [Agrobacterium tumefaciens str. C58]
          Length = 195

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 113/175 (64%), Gaps = 8/175 (4%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +G +VL A   G Y   I     NFH VV  + YRS QP+   +    +++GIK+++NLR
Sbjct: 12  MGFIVLAA---GGYLYAIQLLG-NFHEVVAGQFYRSNQPSSEELVRYTEDHGIKTVINLR 67

Query: 80  GK-LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           G    ESW+++E + +  LG+  I+F +SA+REL+  Q+ QL++I++ APKP+LIHCKSG
Sbjct: 68  GSNEAESWYRDEVETSKKLGLNHIDFGMSASRELDMNQVNQLVAIMRDAPKPILIHCKSG 127

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH--FPVLKTI-TMDITFEKITQL 190
           ADRTGLA+A+YL  +A   +EEA  QLS+ YGH   P L     MD T+E   ++
Sbjct: 128 ADRTGLATALYLSRIARLGEEEAESQLSIRYGHVSIPYLSAAYAMDRTWENAEKM 182


>gi|325293519|ref|YP_004279383.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
 gi|325061372|gb|ADY65063.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
          Length = 186

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
           +++ ++KI    LV   V  G + + I   T NFH V+P E+YRSAQP+G  I    K Y
Sbjct: 3   IVLKFLKIAAIGLVALPVLAGAH-MGIGQLTGNFHEVIPGELYRSAQPSGKDITAYAKAY 61

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           GIK+I+NLR +  E W+  E +AA   G++L+++PLS++ +++ E+ + L+++L+ A KP
Sbjct: 62  GIKTIINLRDEKREGWYDAESQAAKKNGVRLVDYPLSSSEKVSVEEAETLVAVLRNAEKP 121

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           +LIHC+ GA+RTGLASA+Y+  VA   +  A  QLS  YGH P+
Sbjct: 122 ILIHCEHGANRTGLASAIYVSAVAGKSEAAAEFQLSPYYGHVPI 165


>gi|325292592|ref|YP_004278456.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
 gi|325060445|gb|ADY64136.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
          Length = 180

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 111/167 (66%), Gaps = 5/167 (2%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK-LPESW 86
           ++ G Y L I     NFH VV  ++YRS QP+   +    +++GIK+++NLRG+   E W
Sbjct: 2   LAAGGYLLAIQLLG-NFHEVVAGQLYRSNQPSSEQLVRYTRDHGIKTVINLRGENESEDW 60

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           +K+E K + +LG+  I+F +SA  EL+  ++ QL++I++ APKP+LIHCKSGADRTGLA+
Sbjct: 61  YKDEIKTSRELGLTHIDFGMSARHELDMTKVNQLVAIMRDAPKPILIHCKSGADRTGLAT 120

Query: 147 AVYLYIVAHYPKEEAHRQLSMLYGHFPV---LKTITMDITFEKITQL 190
           A+YL  VA+  ++ A  QLS+ YGH  +    +T  MD T+E +  +
Sbjct: 121 ALYLGRVAYLGEKAAESQLSVRYGHIGIPYLSETYAMDQTWENVEHM 167


>gi|15889438|ref|NP_355119.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str.
           C58]
 gi|15157300|gb|AAK87904.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str.
           C58]
          Length = 186

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 106/160 (66%), Gaps = 1/160 (0%)

Query: 15  YIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKS 74
           ++KI    LV   V  G + + I   T NFH V+P E+YRSAQP+G  I    K YGIK+
Sbjct: 7   FLKITAIGLVALPVLAGAH-MGIGQLTGNFHEVIPGELYRSAQPSGKDIAAYAKAYGIKT 65

Query: 75  ILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIH 134
           I+NLR +  E W++ E  AA + GI+L+++PLS++ +++ E  + L ++L+ A KP+LIH
Sbjct: 66  IINLRDEKREGWYEAESLAAKNNGIRLVDYPLSSSEKVSVEDSETLAAVLRNAEKPVLIH 125

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           C+ GA+RTGLASA+Y+ +VA   +  A  QLS  YGH P+
Sbjct: 126 CEHGANRTGLASAIYVAVVAGKSEAAAEFQLSPYYGHVPI 165


>gi|222147302|ref|YP_002548259.1| tyrosine/serine protein phosphatase [Agrobacterium vitis S4]
 gi|221734292|gb|ACM35255.1| tyrosine/serine protein phosphatase [Agrobacterium vitis S4]
          Length = 191

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 105/166 (63%), Gaps = 8/166 (4%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH 87
           +S G Y L     T NFH V+P E YRSAQP+   I+     YGIK+I+NLRG  P  W+
Sbjct: 21  LSCGAY-LGYLRLTGNFHEVIPGEFYRSAQPSAADIKDYAGRYGIKTIVNLRGPSPSPWY 79

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
            +E   A +LGI  I+F +SA + L  ++ +QL+++LK+APKP+LIHC+ GADR+GLAS 
Sbjct: 80  AQEVATARELGIGHIDFRMSAGKGLTIDKAEQLVALLKSAPKPILIHCEGGADRSGLASV 139

Query: 148 VYLYIVAHYPKEEAHRQL-SMLYGHFP---VLKTITMD---ITFEK 186
           +YL  +A   ++ A +QL  ++YGH     V K   MD   + FEK
Sbjct: 140 LYLQQIAGVQEDTAEQQLWPVIYGHVGIPYVTKAYAMDRSWLDFEK 185


>gi|260576858|ref|ZP_05844841.1| protein tyrosine/serine phosphatase [Rhodobacter sp. SW2]
 gi|259020895|gb|EEW24208.1| protein tyrosine/serine phosphatase [Rhodobacter sp. SW2]
          Length = 191

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 109/173 (63%), Gaps = 5/173 (2%)

Query: 19  LLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL 78
           L G+L+L  ++L  Y L + ++  NFH V+  E+YRSAQ     I   + ++GI SILNL
Sbjct: 11  LFGLLMLGVLALIAYLLVLYSYN-NFHTVIEGELYRSAQVTPEQIAQYQADHGIASILNL 69

Query: 79  RGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKS 137
           RG  P + W+  E  A+  LGI  ++F +SA + L  +Q K LI++++  PKP+LIHC  
Sbjct: 70  RGAAPGKPWYDAEMAASEKLGITHVDFRMSARKALTADQAKALIALMRDMPKPILIHCLQ 129

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLK---TITMDITFEKI 187
           GADRTGLASA+YL  +A   ++EA  Q+S+ YGHF V K      MD T++ +
Sbjct: 130 GADRTGLASALYLASIAGRSEDEAAGQISIRYGHFSVPKLSEAYPMDETWQMM 182


>gi|260424450|ref|YP_003212651.1| hypothetical protein Ctu_1p00750 [Cronobacter turicensis z3032]
 gi|260219258|emb|CBA34612.1| hypothetical protein Ctu_1p00750 [Cronobacter turicensis z3032]
          Length = 483

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 101/155 (65%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           LG+LV   ++L          T NFH V+  E+YRSAQP+ T I    + Y I++ILNLR
Sbjct: 308 LGLLVAAVLALTGLHAGYEQLTGNFHEVIEGELYRSAQPDATDIAEYSERYHIRTILNLR 367

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGA 139
            +    W+++E+ +A+  GIQL+++PLS+++E++  + ++L  ++KT P+PLLIHC  GA
Sbjct: 368 DEPRGDWYEQEKASADVHGIQLVDYPLSSSKEISVREAEKLAELMKTLPRPLLIHCDHGA 427

Query: 140 DRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           +RTGL SA+YL  VA      A  QLS  YGHFP+
Sbjct: 428 NRTGLVSAIYLDAVAQTSDLIAQLQLSPWYGHFPI 462


>gi|153007388|ref|YP_001368603.1| protein tyrosine/serine phosphatase [Ochrobactrum anthropi ATCC
           49188]
 gi|151559276|gb|ABS12774.1| protein tyrosine/serine phosphatase [Ochrobactrum anthropi ATCC
           49188]
          Length = 197

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 114/171 (66%), Gaps = 5/171 (2%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           LG+LV  +V +G Y  T+  +  N H ++  + YRS QP+   I  L+K YGIK+I+NLR
Sbjct: 20  LGLLVGSSV-MGGYLYTLQ-YKGNVHTIIDGQAYRSNQPDPARIASLQKLYGIKTIINLR 77

Query: 80  GKLPES-WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           G  P S W+ EE   A  LGI+  +F +S+ REL+  Q +QLI++++ A KP+LIHCKSG
Sbjct: 78  GPEPGSKWYDEEIATAKTLGIKHADFEMSSRRELSPAQTRQLIALMQNAEKPVLIHCKSG 137

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH--FPVLKTITMDITFEKI 187
           ADRTGLA+A+Y+  VA   + +A RQ+S+ YGH  FP+  T  M+ TFE I
Sbjct: 138 ADRTGLAAALYVAAVAKGSEGKAERQMSIAYGHFGFPLSPTYAMEKTFEAI 188


>gi|298571356|gb|ADI87699.1| hypothetical protein LW2_0240 [uncultured Nitrospirae bacterium
           MY2-3C]
          Length = 180

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 91/152 (59%), Gaps = 1/152 (0%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHKEEEKAAND 96
           T    NFH +   + YRSAQ     ++Y    YGI+SILNLRG+ P + W++ E + +  
Sbjct: 26  TMAAGNFHVITQGKAYRSAQLEQRQLQYYINNYGIRSILNLRGQNPRAAWYETEVRFSGL 85

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             I   +  LS+ RE    ++ +L+ I   AP+P+LIHC SG+DR+GL +A++  +V   
Sbjct: 86  HNIAHYDIALSSAREPTARELNELMRIFAEAPRPILIHCWSGSDRSGLVAAMWKVVVEKE 145

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           PK +AHRQLS+LYGH P      +D  FEK +
Sbjct: 146 PKAKAHRQLSILYGHLPFGDAAVLDRFFEKWS 177


>gi|327398356|ref|YP_004339225.1| protein tyrosine/serine phosphatase [Hippea maritima DSM 10411]
 gi|327180985|gb|AEA33166.1| protein tyrosine/serine phosphatase [Hippea maritima DSM 10411]
          Length = 381

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 95/145 (65%), Gaps = 3/145 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLGIQL 101
           NFH V    +YRS Q +   + Y  K+Y IKSI+NLRGK   ++W+KEE K +  L +  
Sbjct: 224 NFHTVENGALYRSGQLDKDELLYYIKQYHIKSIVNLRGKQQGKNWYKEEIKLSKQLNLVH 283

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           I+F LS  +     ++ +LI+IL+  PKP+LIHCK+GADR+GL SA++ Y V +YP + +
Sbjct: 284 IDFRLSPNKIAKPRKLIKLINILEKIPKPILIHCKAGADRSGLVSAIWKYYVENYPIKRS 343

Query: 162 HRQLSMLYGHFPVLKTIT--MDITF 184
             QLS+LY HFP L + +  MD +F
Sbjct: 344 DEQLSLLYLHFPYLGSPSEAMDKSF 368


>gi|299133235|ref|ZP_07026430.1| protein tyrosine/serine phosphatase [Afipia sp. 1NLS2]
 gi|298593372|gb|EFI53572.1| protein tyrosine/serine phosphatase [Afipia sp. 1NLS2]
          Length = 227

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 102/172 (59%), Gaps = 4/172 (2%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSIL 76
           KI L ++V  AV   L +      T N H +   + YRSAQ +   +  L  +  I++++
Sbjct: 41  KICLRLIVFGAVC-ALLWAGYLRMTGNVHTIEEGQAYRSAQLSANALLKLIGDKKIRTVI 99

Query: 77  NLRG-KLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           NLRG    ++W+  E +A +  GI  ++  LSA R+L+D+Q+ +L  IL  +PKP+LIHC
Sbjct: 100 NLRGYNGGKNWYDAEIEATHKAGITHVDLALSANRKLSDQQLSRLSDILIKSPKPILIHC 159

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL--KTITMDITFE 185
           + GADR GLA+A+Y  IVA      A  QLS  +GHFP L  +T+ MD T++
Sbjct: 160 EGGADRAGLAAAMYELIVAGRSALVAGTQLSFRFGHFPWLGSRTVAMDQTWD 211


>gi|298292204|ref|YP_003694143.1| protein tyrosine/serine phosphatase [Starkeya novella DSM 506]
 gi|296928715|gb|ADH89524.1| protein tyrosine/serine phosphatase [Starkeya novella DSM 506]
          Length = 191

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 109/186 (58%), Gaps = 10/186 (5%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIK 73
           +  + L G LVL  +  G  +        N H VV  E+YRSA  +   ++ + +  GI+
Sbjct: 11  WLTRGLAGGLVLVGLYAGWAYAN-----GNLHTVVEGELYRSATLSSAQLQEVIESRGIR 65

Query: 74  SILNLRGKLPES-WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLL 132
           +I+NLRG+   S W++EE + A +  ++LI+ P  A+REL D Q+     +L  AP+P+L
Sbjct: 66  TIVNLRGRNAYSAWYREEARVAAETNVKLIDLPWLASRELTDAQVAAFFEVLADAPRPIL 125

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH--FPVLKTITMDITFEKI--T 188
           IHC+SGADRTGLA+A+YL  +    +  A  QLS+L+GH   P      MD TFE++  +
Sbjct: 126 IHCRSGADRTGLAAALYLAAIKKVDEFTAELQLSLLFGHISLPFAPFYAMDETFERLEPS 185

Query: 189 QLYPNN 194
             YP++
Sbjct: 186 LGYPDS 191


>gi|78485859|ref|YP_391784.1| protein tyrosine/serine phosphatase [Thiomicrospira crunogena
           XCL-2]
 gi|78364145|gb|ABB42110.1| protein tyrosine/serine phosphatase [Thiomicrospira crunogena
           XCL-2]
          Length = 220

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 96/157 (61%), Gaps = 4/157 (2%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           F +NFHA+  +  YRS  P+  FI+ L ++ GIK+I++LR       ++ E++A + LGI
Sbjct: 28  FYRNFHAL-SNNAYRSNHPSAAFIQKLHEKKGIKTIISLRRADQTGQYQLEKEACDRLGI 86

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +LIN P+S+    + ++I Q   IL+ A  P+LIHCKSGADR G+ S  Y + + + P +
Sbjct: 87  KLINHPMSSRSFPDVDKILQAKKILEDAEYPILIHCKSGADRAGMMSVFYKHFILNQPIK 146

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEK---ITQLYPN 193
           EA  +L+M YGHF    T  +DI FE      + +PN
Sbjct: 147 EALSELNMKYGHFRWADTGKLDIFFESFLTFEKAHPN 183


>gi|320104233|ref|YP_004179824.1| protein tyrosine/serine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319751515|gb|ADV63275.1| protein tyrosine/serine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 275

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 81/142 (57%), Gaps = 1/142 (0%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHKEE 90
           L   + +    NF  V P   YR AQP G  +E     +GI ++LNLRG  PE  W+ +E
Sbjct: 53  LAIWSQSWIDTNFGVVQPGVAYRCAQPQGDDLERFIDAHGIATVLNLRGGKPEDQWYAKE 112

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            +     G+   + P+SAT+     Q+  ++ +L+ AP+P+LIHCK+GADRTGLASA+  
Sbjct: 113 VETVQKRGVTYYDLPMSATKRPERRQMLWILDVLRDAPRPILIHCKAGADRTGLASALQK 172

Query: 151 YIVAHYPKEEAHRQLSMLYGHF 172
            ++   P  +A    ++ +GHF
Sbjct: 173 LVIQGEPPRQALSAFTLRHGHF 194


>gi|149915807|ref|ZP_01904332.1| protein tyrosine/serine phosphatase [Roseobacter sp. AzwK-3b]
 gi|149810389|gb|EDM70234.1| protein tyrosine/serine phosphatase [Roseobacter sp. AzwK-3b]
          Length = 233

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 83/147 (56%), Gaps = 2/147 (1%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF+ V P ++YRS QP       LKK+ GIK+ILNLRG    + +  EE++   LG+ L+
Sbjct: 55  NFYQVAP-DVYRSNQPTHERFVKLKKK-GIKTILNLRGAGGTAHYLVEEESCRTLGLTLV 112

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           N  L A +     +IK LI   +   KP ++HCKSGADR G A+A+YL ++   P  EA 
Sbjct: 113 NVNLMARQAAPGTEIKALIRAFREIEKPFVMHCKSGADRAGFAAAIYLLVIEGRPVSEAR 172

Query: 163 RQLSMLYGHFPVLKTITMDITFEKITQ 189
           R L + Y H    KT  +D   ++  Q
Sbjct: 173 RMLGVKYIHLKWSKTGVLDHILDRYEQ 199


>gi|312113878|ref|YP_004011474.1| protein tyrosine/serine phosphatase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219007|gb|ADP70375.1| protein tyrosine/serine phosphatase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 253

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 96/178 (53%), Gaps = 13/178 (7%)

Query: 30  LGLYFLTITTFTQ---NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW 86
             L+F+    F     N H + P  ++RSAQP+   I +L K  GIK+++NLRG+     
Sbjct: 50  FDLFFMDHHFFRSIYSNRHQIAP-GVWRSAQPSPAHIAWLAKR-GIKTVVNLRGERDCGS 107

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           ++ E +A    GI+LINF L +      + I+Q  ++      P+L HCKSGADR G+ S
Sbjct: 108 YRLEAEACERHGIRLINFQLQSRMVPRVDVIRQARALFDEIEYPVLFHCKSGADRAGMMS 167

Query: 147 AVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPM 204
           A+ +Y+    P E+A +QLS+ +GH    +T  +D  FE+            +TE+PM
Sbjct: 168 ALLMYMKEGQPIEQAAKQLSLKFGHIRSSETGVLDYLFERYL--------ADNTEEPM 217


>gi|296536753|ref|ZP_06898809.1| protein tyrosine/serine phosphatase [Roseomonas cervicalis ATCC
           49957]
 gi|296262920|gb|EFH09489.1| protein tyrosine/serine phosphatase [Roseomonas cervicalis ATCC
           49957]
          Length = 222

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 84/163 (51%), Gaps = 14/163 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE-------EKAA 94
           +N+  V P  +YRS  P+   +    +  G++SI+NLRG      H+E           A
Sbjct: 31  RNWGVVAPGRLYRSNHPSPWQLRRAARTLGLRSIINLRG------HRESCGSDALGRAMA 84

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
            +LG+  ++ PL +    + +++ +L  I +  P P+LIHCKSGADRTGLA+ V+L +  
Sbjct: 85  AELGLSHVDAPLESRGAPHKDRLLRLAGIFRDLPGPVLIHCKSGADRTGLAAGVWLLLQG 144

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
             P EEA RQLS  +GH    KT  +D  F         N  K
Sbjct: 145 R-PVEEAMRQLSWRHGHVSASKTGILDAFFRDYAAFQKANGPK 186


>gi|320104940|ref|YP_004180531.1| hypothetical protein Isop_3424 [Isosphaera pallida ATCC 43644]
 gi|319752222|gb|ADV63982.1| hypothetical protein Isop_3424 [Isosphaera pallida ATCC 43644]
          Length = 265

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 90/164 (54%), Gaps = 1/164 (0%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSIL 76
           ++  G L+L A      F+       NF  + P E+YRSAQ +   ++ +  ++GI+++L
Sbjct: 28  RVWAGRLMLLAGLAVAGFVGWRVAIGNFAVIEPGELYRSAQLSAAQLDRVIADHGIRAVL 87

Query: 77  NLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           NLRG  P E W++ E       G   I+  +S+    +  Q+ +++ IL+TAP+PLLIHC
Sbjct: 88  NLRGHNPDEPWYRNEVATTLKRGATQIDVAMSSCDWASRAQMNEIVRILETAPRPLLIHC 147

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTIT 179
             G++RTGL SA+ + +      EEA RQ S  Y + P    +T
Sbjct: 148 WHGSERTGLVSALAILLRPGSTLEEAERQFSWRYLYVPFGDGVT 191


>gi|163795969|ref|ZP_02189932.1| hypothetical protein BAL199_28110 [alpha proteobacterium BAL199]
 gi|159178724|gb|EDP63262.1| hypothetical protein BAL199_28110 [alpha proteobacterium BAL199]
          Length = 228

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG-KLPESWHKEEEKAANDLGIQLINFPL 106
           V   ++R+AQP    ++   KE GI++ILNLRG ++    ++ E +A   LG+ LI+FP+
Sbjct: 44  VADGVWRAAQPGPGHLDQFAKE-GIRTILNLRGPRVECGAYRLEREACARLGLTLIDFPI 102

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
            +   L+ E +   I +      PLL+HCKSGADRTG  + +YL+     P  +A  QLS
Sbjct: 103 RSRAALDRETVLAAIDLWDGLELPLLMHCKSGADRTGFMATLYLWQRTGLPLRQAMEQLS 162

Query: 167 MLYGHFPVLKTITMDITFE 185
             YGH    KT  +D  FE
Sbjct: 163 WRYGHIRQAKTGVIDFFFE 181


>gi|84503445|ref|ZP_01001505.1| hypothetical protein OB2597_03809 [Oceanicola batsensis HTCC2597]
 gi|84388232|gb|EAQ01184.1| hypothetical protein OB2597_03809 [Oceanicola batsensis HTCC2597]
          Length = 212

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 85/153 (55%), Gaps = 4/153 (2%)

Query: 43  NFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           N H V P  ++RS  PN   F  Y  ++ GI++ILNLRG      ++ EE+   + GI+L
Sbjct: 37  NLHEVAP-GVWRSNHPNERRFTRY--RDMGIRTILNLRGAEDNVTYRWEERLCAEHGIRL 93

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
               L A R    E I+Q++++L+ A +PLL HCKSGADR GL SA+YL ++   P + A
Sbjct: 94  HAVRLDARRAPQVEPIQQVLAVLRQAERPLLFHCKSGADRAGLVSALYLLVIEGQPADIA 153

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
            + LS  + HF    T  +D   E   + +  +
Sbjct: 154 RKMLSRRFLHFRSSMTGVLDHFLESYARAHSRS 186


>gi|220935425|ref|YP_002514324.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996735|gb|ACL73337.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 244

 Score = 98.6 bits (244), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 87/168 (51%), Gaps = 6/168 (3%)

Query: 19  LLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL 78
            LG   L  V  G     I     N H V P  +YRSAQP+   ++ +  + G+K+I+NL
Sbjct: 37  FLGRFELLLVDHGF----IRALYSNRHQVAPG-MYRSAQPSPAHVKQMA-DLGVKTIVNL 90

Query: 79  RGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           RG+     +  E +A    GI+L+NF +S+ R    E +     + +    P L+HCKSG
Sbjct: 91  RGEGDTGAYLLEAEACRRFGIELVNFSVSSKRAPPRETLLAAARMFQELNYPALMHCKSG 150

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEK 186
           ADR GL SAVYL +      +EA  QL + YGH  + +T  +D  F +
Sbjct: 151 ADRAGLMSAVYLAMHERRDADEAAAQLRLRYGHLRIGRTGVLDEIFRQ 198


>gi|84515251|ref|ZP_01002613.1| hypothetical protein SKA53_01296 [Loktanella vestfoldensis SKA53]
 gi|84510534|gb|EAQ06989.1| hypothetical protein SKA53_01296 [Loktanella vestfoldensis SKA53]
          Length = 235

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 79/140 (56%), Gaps = 4/140 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGT-FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           NF  V P  +YRS  PN + F  Y   + GIK++LNLRG   +  H  E ++   LG+ L
Sbjct: 51  NFDLVAP-GVYRSNHPNHSRFAAY--AQMGIKTVLNLRGAALQPHHLFEVESCATLGLTL 107

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           +N  ++A R  + +++  L+    T  +P L+HCKSGADRTGLA+A+YL      P  +A
Sbjct: 108 VNVQMAARRAPDRDELLALLDAFATMERPFLMHCKSGADRTGLAAAIYLLHYQDAPIAQA 167

Query: 162 HRQLSMLYGHFPVLKTITMD 181
            RQLS  Y H     T  +D
Sbjct: 168 KRQLSFRYVHIRRTSTGILD 187


>gi|288573895|ref|ZP_06392252.1| protein tyrosine/serine phosphatase [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288569636|gb|EFC91193.1| protein tyrosine/serine phosphatase [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 188

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 82/135 (60%), Gaps = 2/135 (1%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG-KLPESWHKEEEKAANDLGIQL 101
           NFH V    +YRSAQ N   +    + + IKSI+NLRG +    W++ E++ +   GI  
Sbjct: 23  NFHTVSKGVLYRSAQLNLDRLSRYVETHSIKSIVNLRGPQAGRRWYRREKEFSLSKGIVH 82

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY-LYIVAHYPKEE 160
            +F LSA R++  +++ +++  ++ APKP+LIHC +GADRTGL +A++ L      P + 
Sbjct: 83  ADFDLSAIRKIPVQELDRILEFMRNAPKPILIHCYAGADRTGLIAALWRLAEDRDAPLQA 142

Query: 161 AHRQLSMLYGHFPVL 175
            +RQL  + GHF  L
Sbjct: 143 LNRQLCWMKGHFSTL 157


>gi|310816645|ref|YP_003964609.1| protein tyrosine/serine phosphatase [Ketogulonicigenium vulgare
           Y25]
 gi|308755380|gb|ADO43309.1| protein tyrosine/serine phosphatase [Ketogulonicigenium vulgare
           Y25]
          Length = 205

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 90/171 (52%), Gaps = 7/171 (4%)

Query: 29  SLGLYFL--TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW 86
           +L   FL   +  +T    A V  +++RS       +  L+ + GIK+IL LRG  P + 
Sbjct: 16  TLDFLFLDHAVLRYTWCNQAKVCDDVWRSNHAGFGRLRRLRDQ-GIKAILTLRGSSPSAA 74

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           ++ E  A + LG+ L +  L A R    +++ +L +  +  P+P L+HCKSGADR GLA 
Sbjct: 75  NRFEAAACHTLGLHLYSVSLEARRAPKRDEVLRLFNTFRALPRPFLMHCKSGADRAGLAG 134

Query: 147 AVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           A+YL  +     E+A +QLS+ Y H    +T  +D     +  LY N+  +
Sbjct: 135 ALYLLGMQGATIEQARKQLSLRYLHIRASQTGVLD----HVLDLYENDFRR 181


>gi|198282552|ref|YP_002218873.1| protein tyrosine/serine phosphatase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218668152|ref|YP_002424743.1| hypothetical protein AFE_0236 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247073|gb|ACH82666.1| protein tyrosine/serine phosphatase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218520365|gb|ACK80951.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 226

 Score = 94.7 bits (234), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 86/148 (58%), Gaps = 4/148 (2%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-KEEEKAANDLG 98
           F  NFH + P  ++RSAQP+   + + +++YG+ ++LNLR   P   H + E++A + LG
Sbjct: 31  FYANFHEIAP-GVFRSAQPSPVQLRHWQQKYGLCTVLNLRAPAPHEPHYRLEQEACDALG 89

Query: 99  IQLINFPLSATRELND-EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  +      +R+L + +++   I++L   P+P L+HCKSGADR G  S +YL++V   P
Sbjct: 90  MTHLTLHGFGSRDLPERDKLLAGIAVLDQLPQPFLLHCKSGADRAGFISVLYLHLVLGIP 149

Query: 158 KEEAHRQLSML-YGHFPVLKTITMDITF 184
              A RQL +  +GH     T  +D  F
Sbjct: 150 LSAAQRQLRLWPFGHIRHANTGILDWFF 177


>gi|84500026|ref|ZP_00998292.1| hypothetical protein OB2597_08799 [Oceanicola batsensis HTCC2597]
 gi|84391960|gb|EAQ04228.1| hypothetical protein OB2597_08799 [Oceanicola batsensis HTCC2597]
          Length = 226

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 81/157 (51%), Gaps = 4/157 (2%)

Query: 27  AVSLGLYF--LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE 84
           A +  LYF    + T   NF  + P ++YRS  P    +  +K   GI ++LNLRG    
Sbjct: 31  ARTYNLYFDHAVLRTVWGNFFQISP-DVYRSNHPTHARLARMKAR-GITTVLNLRGTESG 88

Query: 85  SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
           + +  E  +  +LG+ +++  L A      E I  LI   +   KP ++HCKSGADR G 
Sbjct: 89  APYLTERVSCGELGLTMVDCNLIARAAAPKEDILNLIDCFRRIEKPFVMHCKSGADRAGF 148

Query: 145 ASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMD 181
           ASA+YL ++   P E A R LS  Y HF   +T  +D
Sbjct: 149 ASAIYLMVIEGEPVERARRMLSPRYIHFRWTRTGILD 185


>gi|294084698|ref|YP_003551456.1| hypothetical protein SAR116_1129 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664271|gb|ADE39372.1| conserved hypothetical tyrosine/serine phosphatase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 219

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 77/146 (52%), Gaps = 2/146 (1%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           F  N H + P  ++R+ QP    +  +    GIK+I+NLRG   +   + E +A    GI
Sbjct: 30  FWHNRHEIAPG-MWRANQPGPVEVSRIAAS-GIKTIINLRGPRDDGVWQLEAEACAKAGI 87

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            L++F   +    +   +    +I K   KP L+HCKSGADR GL SA+Y+ +    P  
Sbjct: 88  TLLDFTARSRAAPDKAMLHDAKAIFKAIEKPALMHCKSGADRAGLMSALYMLVAEERPAR 147

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFE 185
           EA +QL+  YGH    KT  +D+ F+
Sbjct: 148 EAAKQLAWKYGHVKQAKTGLLDVFFK 173


>gi|300024092|ref|YP_003756703.1| protein tyrosine/serine phosphatase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525913|gb|ADJ24382.1| protein tyrosine/serine phosphatase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 245

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 81/163 (49%), Gaps = 1/163 (0%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP 83
            LC   +      I     N    +  +++RSAQP    + +L +  G+K+I+NLRG+  
Sbjct: 38  ALCYAEMLFVDYGIARIAYNNRHRISKDVWRSAQPAPHHVGWLARR-GVKTIINLRGEQS 96

Query: 84  ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
                 E++A    GI L++  L +        ++ +  +LK    P+L+HCKSGADR G
Sbjct: 97  FGTRWLEQQACARHGITLVDLALKSRAPPTTADLRAMRDVLKNVEYPILLHCKSGADRAG 156

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEK 186
           + S +  +     P EEA +QLS+ YGH     T  +D  FE+
Sbjct: 157 IMSVIVRHERDGVPIEEAKKQLSLRYGHIRSADTGVLDAVFER 199


>gi|126732786|ref|ZP_01748581.1| protein tyrosine/serine phosphatase [Sagittula stellata E-37]
 gi|126706782|gb|EBA05853.1| protein tyrosine/serine phosphatase [Sagittula stellata E-37]
          Length = 240

 Score = 92.0 bits (227), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 77/140 (55%), Gaps = 4/140 (2%)

Query: 43  NFHAVVPHEIYRSAQP-NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           NF  + P  +YRS QP +G F  Y K   GI++++NLRG    + +  E ++   LG+ L
Sbjct: 51  NFFEIAPG-VYRSNQPTHGRFERYAK--MGIRTVINLRGPDVRAQYLFERESCETLGLTL 107

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           ++  L A       +I+ +I  L+ A KP++ HCKSGADR G  +A+YL I    P E A
Sbjct: 108 VDAKLWARTAAPRSKIEAVIDALRAAEKPVMFHCKSGADRAGFVAAMYLLIFEDAPLEVA 167

Query: 162 HRQLSMLYGHFPVLKTITMD 181
            +QL + Y H    KT   D
Sbjct: 168 QKQLGLKYIHLDFTKTGVQD 187


>gi|254440390|ref|ZP_05053884.1| hypothetical protein OA307_5260 [Octadecabacter antarcticus 307]
 gi|198255836|gb|EDY80150.1| hypothetical protein OA307_5260 [Octadecabacter antarcticus 307]
          Length = 235

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 74/143 (51%), Gaps = 2/143 (1%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           F  N   + P  ++RS  P       L    GI +I++LRG     W   E++A    GI
Sbjct: 60  FWTNMFEIAP-GVWRSNHPTAKRFPALTAR-GIHTIISLRGSTTTPWALLEKEACTRHGI 117

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +L    L +    N   ++ LI + ++  KP+L HCKSGADRTGLAS +YL ++ + P E
Sbjct: 118 RLETVALKSQSAPNRRDLQALIGLFRSVEKPVLFHCKSGADRTGLASVMYLLVIENQPLE 177

Query: 160 EAHRQLSMLYGHFPVLKTITMDI 182
           +A + LS  Y H    K   +D+
Sbjct: 178 QARKMLSWRYAHLSWTKAGVLDM 200


>gi|149194653|ref|ZP_01871748.1| protein tyrosine/serine phosphatase [Caminibacter mediatlanticus
           TB-2]
 gi|149135076|gb|EDM23557.1| protein tyrosine/serine phosphatase [Caminibacter mediatlanticus
           TB-2]
          Length = 210

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           I+ FT NFH +     YRSAQP    +E + K+Y IK++LN+RG+  ++    +++    
Sbjct: 15  ISLFTFNFHKI-DDNFYRSAQPTDKHLEEIIKKYNIKTVLNVRGEEHKNILASQKEICKK 73

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             ++LI   L +    + E+I +L  IL T+  P+L+HCKSG+DRTGL + +Y + +   
Sbjct: 74  YNVELITIKLHSRGIPSKEKINRLYEILTTSKYPMLVHCKSGSDRTGLVATLYCHWIKGK 133

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
             +E  +  +  Y HF   KT  +D  FE+  +    N
Sbjct: 134 DIKEIKQLKAFPYLHFKHSKTGLIDKYFEEYLKFKQKN 171


>gi|83950364|ref|ZP_00959097.1| hypothetical protein ISM_04680 [Roseovarius nubinhibens ISM]
 gi|83838263|gb|EAP77559.1| hypothetical protein ISM_04680 [Roseovarius nubinhibens ISM]
          Length = 227

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 2/145 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + T   NF  V P  ++RS  P     E LK   G +S+LNLRG    + +  E ++   
Sbjct: 43  LRTVWTNFFEVAPG-VWRSNHPTHRRFEKLKA-MGFRSVLNLRGSGGAAHYLTEVESCEK 100

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG+ L+N  L A      E I  L+   +   KP ++HCKSGADR G ASA++L ++   
Sbjct: 101 LGLTLVNVTLHARYAAPREDILTLLEAFRQIEKPFVMHCKSGADRAGFASAIWLLVMEGR 160

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMD 181
           P  EA R LS  Y H    KT  +D
Sbjct: 161 PVSEARRMLSFKYVHIRRSKTGVLD 185


>gi|209963868|ref|YP_002296783.1| hypothetical protein RC1_0533 [Rhodospirillum centenum SW]
 gi|209957334|gb|ACI97970.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 237

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 77/136 (56%), Gaps = 2/136 (1%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW-HKEEEKAANDLGIQLINFPLSATR 110
           +YRS+QP    I   K+  GI++++NLRG+  +   +  EE+A  + GI L++FP+++  
Sbjct: 57  MYRSSQPTPAHIAAAKR-MGIRTVINLRGRRDDCGSYFLEERACREHGITLVDFPVNSRD 115

Query: 111 ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYG 170
                 +     I      P+L+HCK+G+DR G  SA+Y+ +    P EEA RQL+  YG
Sbjct: 116 APRKHILHAARDIWAGVEYPVLMHCKAGSDRVGFMSALYMLVHEKRPLEEAVRQLNWRYG 175

Query: 171 HFPVLKTITMDITFEK 186
           H    KT  +D  FE+
Sbjct: 176 HLRAAKTGILDQFFEE 191


>gi|254461851|ref|ZP_05075267.1| protein tyrosine/serine phosphatase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678440|gb|EDZ42927.1| protein tyrosine/serine phosphatase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 231

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 75/127 (59%), Gaps = 3/127 (2%)

Query: 52  IYRSAQP-NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATR 110
           ++RS QP +  F+ Y  ++ GIKS++NLRG  P + +  EE++   LG++L N  L A  
Sbjct: 59  VWRSNQPTHKRFMRY--RDLGIKSVINLRGTDPRAHYLFEEESCRILGLKLHNTKLWART 116

Query: 111 ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYG 170
             N E I  ++ ++++  +P + HCKSGADR G  +A+Y  +      EEA RQLS+ + 
Sbjct: 117 AANRENIVAVLDLMRSVERPFMFHCKSGADRAGFCAAMYQIVFDGVSVEEAKRQLSIKFI 176

Query: 171 HFPVLKT 177
           H    KT
Sbjct: 177 HLKWSKT 183


>gi|288961764|ref|YP_003452074.1| protein tyrosine/serine phosphatase [Azospirillum sp. B510]
 gi|288914044|dbj|BAI75530.1| protein tyrosine/serine phosphatase [Azospirillum sp. B510]
          Length = 215

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 2/143 (1%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H V  + + R++QP+ + I    +  G+K+ILNLRG    + +  E +A    G+QLI
Sbjct: 28  NTHRVSANMV-RASQPSPSHIAAAARS-GVKTILNLRGSRDCASYILEAEACRAHGLQLI 85

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +FP+++      E + +   + K    P L+HCKSGADR G  + +YL+     P E A 
Sbjct: 86  DFPVNSRDMPRKETLLKARELFKGMNYPALMHCKSGADRAGFMATLYLFAHEGQPLERAM 145

Query: 163 RQLSMLYGHFPVLKTITMDITFE 185
           +QLS  YGHF   KT  +D  FE
Sbjct: 146 KQLSWKYGHFKQAKTGILDYFFE 168


>gi|83859487|ref|ZP_00953008.1| hypothetical protein OA2633_13820 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852934|gb|EAP90787.1| hypothetical protein OA2633_13820 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 220

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 84/162 (51%), Gaps = 4/162 (2%)

Query: 31  GLYFLTITTFTQNFHAV--VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWH 87
           GL +       Q FH +  V  E++R  QP+   +  LK + G K+ILNLRG  P   ++
Sbjct: 17  GLMWGDHGVLRQRFHNMHRVGGEMWRGNQPSPKRLRELK-DMGFKTILNLRGTQPGRHYY 75

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
             E    +++G+ +++ P  +      E+I+ LI++      P  +HCKSGADR G+ + 
Sbjct: 76  DLEHFTCDEIGLDIVDLPWGSREAPYVERIEHLITVFDEIAYPAFMHCKSGADRAGIVAV 135

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           +Y  +    P EEA +QLS  YGH    KT  +D  F+   Q
Sbjct: 136 MYKLLHEKAPFEEAVQQLSFKYGHIKQGKTGMLDHFFDLYRQ 177


>gi|119898606|ref|YP_933819.1| putative tyrosine/serine phosphatase [Azoarcus sp. BH72]
 gi|119671019|emb|CAL94932.1| conserved hypothetical tyrosine/serine phosphatase [Azoarcus sp.
           BH72]
          Length = 234

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
            I     NFHA+    +YR +QP+   I      +GI+SI+NLRG      +  EE+A  
Sbjct: 39  AIRAVYNNFHALGG-GMYRCSQPSPAQIRRYHARHGIRSIINLRGVHDYGSYFFEEEACA 97

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            LGI L +  L +    + E+I ++  +      P L+HCKSGADR GL +A+Y  +   
Sbjct: 98  RLGIALHSVKLYSRVPPSVEEIHRMRDLFAGLQYPALLHCKSGADRAGLGAALYRILQLG 157

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           +P  EA R+LS  YGH    +T  +D  F
Sbjct: 158 HPVREAMRELSWKYGHSKRARTGILDFFF 186


>gi|89057701|ref|YP_512155.1| protein tyrosine/serine phosphatase [Jannaschia sp. CCS1]
 gi|88866255|gb|ABD57131.1| protein tyrosine/serine phosphatase [Jannaschia sp. CCS1]
          Length = 244

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 74/144 (51%), Gaps = 4/144 (2%)

Query: 43  NFHAVVPHEIYRSAQP-NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           NF  + P  ++RS  P    F  Y ++  GIK+IL LRG      H  E +A  D G+  
Sbjct: 56  NFDEIAP-GVFRSNHPTRARFKAYAER--GIKTILTLRGGEDRPHHLLEVEACRDFGLTF 112

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
              P+SA       Q+  +  +L    +P LIHCKSGADRTGL SA+YL    + P ++A
Sbjct: 113 ECVPMSARHAPTVAQLSAVFEVLDRIERPFLIHCKSGADRTGLVSAIYLMHYENIPFDQA 172

Query: 162 HRQLSMLYGHFPVLKTITMDITFE 185
             QLS  Y H    +T  +D+  E
Sbjct: 173 RVQLSFRYIHIRRSQTGILDVFLE 196


>gi|254449478|ref|ZP_05062915.1| protein tyrosine/serine phosphatase [Octadecabacter antarcticus
           238]
 gi|198263884|gb|EDY88154.1| protein tyrosine/serine phosphatase [Octadecabacter antarcticus
           238]
          Length = 223

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 73/148 (49%), Gaps = 2/148 (1%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           +  N   + P  ++RS  P    +  L ++ G  +I+ LRG     W   E +A   LG+
Sbjct: 48  YWTNMFEIAP-GVWRSNHPTAARLTALAQQ-GTHTIITLRGNRTTPWALLEHEACTRLGL 105

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +L    L +    N   ++ LI + +   KP+L HCKSGADRTGLAS +YL ++   P  
Sbjct: 106 RLETLALRSQHAPNRHDLQTLIDLFRRVEKPVLFHCKSGADRTGLASVIYLLVIEKQPLA 165

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKI 187
           +A + LS  Y H    K   +D+  +  
Sbjct: 166 QARKMLSWRYVHLSWTKAGVLDLLLDDF 193


>gi|170740880|ref|YP_001769535.1| protein tyrosine/serine phosphatase [Methylobacterium sp. 4-46]
 gi|168195154|gb|ACA17101.1| protein tyrosine/serine phosphatase [Methylobacterium sp. 4-46]
          Length = 241

 Score = 87.8 bits (216), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 94/192 (48%), Gaps = 23/192 (11%)

Query: 1   MIKIKKP---RKNLLIFYIKILL---GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYR 54
           + + +KP   R++ L  ++ +LL   GVL L  +              N H V    ++R
Sbjct: 19  IARWEKPIAGRRSRLRAWVNMLLVDHGVLRLAYL--------------NRHRVGRGLVWR 64

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQLINFPLSATRELN 113
           SAQP      + K+ +G+++I++LRG     SW  + E A    G+ L  F + +    N
Sbjct: 65  SAQPAPHDFSWFKR-HGVRTIVSLRGGREHGSWQLQRE-ACEREGLVLREFVVRSREAPN 122

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFP 173
            E +        +   P L+HCKSGADR G A+A+YL +    P  EA RQLS  +GHF 
Sbjct: 123 REMLLGARDFFASVEYPALLHCKSGADRAGFAAALYLILHEGRPVAEAARQLSPRFGHFR 182

Query: 174 VLKTITMDITFE 185
             KT  +D  FE
Sbjct: 183 FAKTGILDAFFE 194


>gi|260427419|ref|ZP_05781398.1| protein tyrosine/serine phosphatase [Citreicella sp. SE45]
 gi|260421911|gb|EEX15162.1| protein tyrosine/serine phosphatase [Citreicella sp. SE45]
          Length = 231

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + T   NF  + P  ++RS  P     E   K  GIK+++ LRG+   S +  E+++   
Sbjct: 45  LRTVWTNFWEIAPG-VWRSNHPTHRRFEKYAK-MGIKTVITLRGEEKFSHYLFEKESCEA 102

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG++L +  L A       +I  LI  ++T  +P++ HCKSGADR G ASAVYL +    
Sbjct: 103 LGLKLEHAKLWARMAPKRARILHLIETMRTVERPMMFHCKSGADRAGFASAVYLMVFEGV 162

Query: 157 PKEEAHRQLSMLYGHFPVLKT 177
           P EEA +QL + Y H    KT
Sbjct: 163 PVEEARKQLGLKYIHLEFTKT 183


>gi|330991160|ref|ZP_08315113.1| hypothetical protein SXCC_01067 [Gluconacetobacter sp. SXCC-1]
 gi|329761746|gb|EGG78237.1| hypothetical protein SXCC_01067 [Gluconacetobacter sp. SXCC-1]
          Length = 220

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 74/142 (52%), Gaps = 1/142 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+P  +YR   P    +    + YG+K+++NLRG           +AA  LG+  I
Sbjct: 33  NFRVVIPGRVYRCNHPTPWRLRLATRRYGLKTLVNLRGHRRCGSDALSREAAQALGLTHI 92

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +    +    + ++I++   I +T   P+L+HCKSGADRTGLA+ + +       + +A 
Sbjct: 93  DMAFESRNAPHRDRIERFERIYRTIRFPMLMHCKSGADRTGLAAGLVILFEGGTAR-QAL 151

Query: 163 RQLSMLYGHFPVLKTITMDITF 184
           RQLS   GHF   +T  +D  F
Sbjct: 152 RQLSWKNGHFNSSRTGVLDAFF 173


>gi|148260026|ref|YP_001234153.1| protein tyrosine/serine phosphatase [Acidiphilium cryptum JF-5]
 gi|326403018|ref|YP_004283099.1| putative phosphatase [Acidiphilium multivorum AIU301]
 gi|146401707|gb|ABQ30234.1| protein tyrosine/serine phosphatase [Acidiphilium cryptum JF-5]
 gi|325049879|dbj|BAJ80217.1| putative phosphatase [Acidiphilium multivorum AIU301]
          Length = 229

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 75/139 (53%), Gaps = 1/139 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P    +   ++  GI +++NLRG+          +AA  LG+   
Sbjct: 36  NFAPVKPGALYRSNHPVPFQLAKFRRLVGINTLINLRGECRNGSDALSREAARRLGLDFY 95

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +  L +    + ++I +L  I++T  +P L+HCKSGADR G+ASA+++ I       EA 
Sbjct: 96  DMALESRGAPHRDRILRLAEIIRTMRRPALVHCKSGADRAGIASALFVLIEGG-SVAEAR 154

Query: 163 RQLSMLYGHFPVLKTITMD 181
           RQLS+ +GH     T  +D
Sbjct: 155 RQLSLRFGHIRQSNTGILD 173


>gi|254293374|ref|YP_003059397.1| protein tyrosine/serine phosphatase [Hirschia baltica ATCC 49814]
 gi|254041905|gb|ACT58700.1| protein tyrosine/serine phosphatase [Hirschia baltica ATCC 49814]
          Length = 231

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +N H +   E+YR  QP+   +    KE GIK+I+NLRG+ P+ ++  E++A  +  I L
Sbjct: 37  RNLHQI-SDEMYRGNQPSPKQVAAYAKELGIKTIINLRGESPKGYYVLEKEACEENRIDL 95

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           I+F + +      ++I     +      P  +HCKSGADR G+ S +Y++     P  EA
Sbjct: 96  IDFQMFSRDTPTPKKIHDAKYLFDNIAYPAFMHCKSGADRAGIMSVLYMHFRQGLPIAEA 155

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQL 190
             QLS  Y H    KT  +D  F++   L
Sbjct: 156 VEQLSFKYLHVKQGKTGMLDFFFQQYIDL 184


>gi|168702681|ref|ZP_02734958.1| hypothetical protein GobsU_24351 [Gemmata obscuriglobus UQM 2246]
          Length = 343

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 76/144 (52%), Gaps = 1/144 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQL 101
           N H V+P  +YR+AQ     +  L  E G+++++NLRG   + +W+  E +  +   +  
Sbjct: 48  NEHTVIPGRVYRTAQLKPEQLRELIAEKGVRTVVNLRGVCTDTAWYLGECRTTHAANVNQ 107

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            +   SA R     ++++L+ +L     P++ HC+ GADRTGLAS V + +        A
Sbjct: 108 EDITFSAKRFPAPGEVRRLVEVLDHTAYPIVFHCQRGADRTGLASTVAVLLHTDADLATA 167

Query: 162 HRQLSMLYGHFPVLKTITMDITFE 185
            RQL   YGH  V +T  +D  F+
Sbjct: 168 RRQLWPRYGHVAVGRTAVLDAFFD 191


>gi|114763435|ref|ZP_01442842.1| hypothetical protein 1100011001336_R2601_17659 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543973|gb|EAU46984.1| hypothetical protein R2601_17659 [Roseovarius sp. HTCC2601]
          Length = 231

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 75/141 (53%), Gaps = 2/141 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + T   NF  + P  ++RS  P     E   K  GIK+++ LRG+   S +  E+++   
Sbjct: 45  LRTVWTNFWQIAPG-VWRSNHPTHRRFEKYAK-MGIKTVITLRGEEKFSHYLFEKESCEK 102

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG+ L +  L A      E+I  LI  L+ A +P++ HCKSGADR G ASAVYL +    
Sbjct: 103 LGLTLKHAKLWARSAPKRERILTLIDTLREAERPMMFHCKSGADRAGFASAVYLMVFEGV 162

Query: 157 PKEEAHRQLSMLYGHFPVLKT 177
           P E A +QL + Y H    +T
Sbjct: 163 PVEVARKQLGLKYIHLEFTRT 183


>gi|220922853|ref|YP_002498155.1| protein tyrosine/serine phosphatase [Methylobacterium nodulans ORS
           2060]
 gi|219947460|gb|ACL57852.1| protein tyrosine/serine phosphatase [Methylobacterium nodulans ORS
           2060]
          Length = 241

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 94/193 (48%), Gaps = 23/193 (11%)

Query: 1   MIKIKKP---RKNLLIFYIKILL---GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYR 54
           + + +KP   R+N L  ++ +LL   GVL L  +              N H +    ++R
Sbjct: 19  IARWEKPIAGRRNRLRAWVNMLLVDHGVLRLAYL--------------NRHRIGRGLLWR 64

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQLINFPLSATRELN 113
           SAQP    + + K++ G+++I++LRG     SW  + E    + G+ L  F + +    +
Sbjct: 65  SAQPAPHDLAWFKRQ-GLRTIISLRGGREHGSWQLQREACERE-GLLLREFVVRSREAPD 122

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFP 173
              +            P LIHCKSGADR G A+A+YL +    P  EA RQLS  YGHF 
Sbjct: 123 RAMLLSARDFFAGVEYPALIHCKSGADRAGFAAALYLILHEGRPVAEAARQLSPRYGHFR 182

Query: 174 VLKTITMDITFEK 186
             KT  +D  F++
Sbjct: 183 FAKTGILDAFFDR 195


>gi|170750050|ref|YP_001756310.1| protein tyrosine/serine phosphatase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656572|gb|ACB25627.1| protein tyrosine/serine phosphatase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 241

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQL 101
           N H V    ++RSAQP    +   + E G+++I++LRG     SW  + E A    G++L
Sbjct: 53  NRHRVGSGALWRSAQPGPHQLARFRAE-GVRTIISLRGGREHGSWPLQRE-ACERHGLKL 110

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + F L +    +   I    +       P ++HCKSGADR GLASA+YL +    P  EA
Sbjct: 111 VEFVLRSREAPDRATILGAKAFFAGIEYPAVMHCKSGADRAGLASALYLILHEGRPVAEA 170

Query: 162 HRQLSMLYGHFPVLKTITMDITFEK 186
            RQLS  YGH    KT  +D  F +
Sbjct: 171 ARQLSARYGHLRFAKTGILDAFFAR 195


>gi|209544250|ref|YP_002276479.1| protein tyrosine/serine phosphatase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531927|gb|ACI51864.1| protein tyrosine/serine phosphatase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 220

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 77/142 (54%), Gaps = 1/142 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF AV+P ++YR   P    +    + YG+++++NLRG           +AA+ +G+  +
Sbjct: 33  NFAAVIPGKVYRCNHPTPRRLAAATRRYGLRTLVNLRGHRRCGSDALSREAASRIGLTHL 92

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +    +    + ++I +  ++  T   P+L+HCKSGADR GLAS + + +      E+A 
Sbjct: 93  DMAFESRGAPHRDRILRFAAMYATLDFPMLMHCKSGADRAGLASGLVI-LFEGGTAEQAL 151

Query: 163 RQLSMLYGHFPVLKTITMDITF 184
           RQLS  +GHF   +T  +D  F
Sbjct: 152 RQLSWRFGHFNRSRTGILDAFF 173


>gi|167648492|ref|YP_001686155.1| protein tyrosine/serine phosphatase [Caulobacter sp. K31]
 gi|167350922|gb|ABZ73657.1| protein tyrosine/serine phosphatase [Caulobacter sp. K31]
          Length = 221

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 82/145 (56%), Gaps = 2/145 (1%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +N H + P E+ R+ QP    +   KK+ G+K+++NLRG    S++  E+ A   LG+++
Sbjct: 32  KNDHWISP-ELVRTNQPWPHQLAAWKKK-GVKTVINLRGGFDGSFYALEKHACQQLGLKM 89

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           ++F +++      E++     + ++   P L+HCKSGADR G+ S +Y +     P EEA
Sbjct: 90  VDFVITSREVPIKERVLGARDLFESIEYPALMHCKSGADRAGIMSVLYAHYRLGLPIEEA 149

Query: 162 HRQLSMLYGHFPVLKTITMDITFEK 186
             QLS+ Y H    KT  +D  FE+
Sbjct: 150 VEQLSLKYLHIKQGKTGVLDYVFER 174


>gi|254420876|ref|ZP_05034600.1| hypothetical protein BBAL3_3186 [Brevundimonas sp. BAL3]
 gi|196187053|gb|EDX82029.1| hypothetical protein BBAL3_3186 [Brevundimonas sp. BAL3]
          Length = 221

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 90/169 (53%), Gaps = 7/169 (4%)

Query: 33  YFLTITTFTQ----NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           YF     F +    N H + P ++ R+ QP+   + Y KK+ G+K+++NLRG+  E ++ 
Sbjct: 19  YFWADHAFLRLAFSNAHWLGP-DLVRTNQPSPRQLAYWKKK-GVKTVINLRGQRDEGYYW 76

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            E++A   LG+ LI+ PL +      ++I +   +  T   P+LIHCKSGADR G+ +  
Sbjct: 77  LEKEACERLGLTLIDAPLDSRDPPETDRIHRARRLFTTIEYPVLIHCKSGADRAGMMAVF 136

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEK-ITQLYPNNVS 196
           Y +     P   A  +LS  Y H     T  +D T EK ++++ P  +S
Sbjct: 137 YRHFHLGEPISVAMAELSKKYLHSREGLTGVLDYTLEKYVSEIEPRGIS 185


>gi|162147197|ref|YP_001601658.1| hypothetical protein GDI_1402 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785774|emb|CAP55345.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 239

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 77/142 (54%), Gaps = 1/142 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF AV+P ++YR   P    +    + YG+++++NLRG           +AA+ +G+  +
Sbjct: 52  NFAAVIPGKVYRCNHPTPRRLAAATRRYGLRTLVNLRGHRRCGSDALSREAASRIGLTHL 111

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +    +    + ++I +  ++  T   P+L+HCKSGADR GLAS + + +      E+A 
Sbjct: 112 DMAFESRGAPHRDRILRFAAMYATLDFPMLMHCKSGADRAGLASGLVI-LFEGGTAEQAL 170

Query: 163 RQLSMLYGHFPVLKTITMDITF 184
           RQLS  +GHF   +T  +D  F
Sbjct: 171 RQLSWRFGHFNRSRTGILDAFF 192


>gi|114797931|ref|YP_760077.1| hypothetical protein HNE_1360 [Hyphomonas neptunium ATCC 15444]
 gi|114738105|gb|ABI76230.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 237

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 77/143 (53%), Gaps = 1/143 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P E++R+ QP+   +    +E GIK+ILNLRG   + ++  E++A    GI LI
Sbjct: 45  NLHQISP-EMWRANQPSPKQVLAHARERGIKTILNLRGPTTKGFYLLEKEACEAAGIDLI 103

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +F + +      E++     + +    P L+HCKSGADR G+ + +Y  +    P EEA 
Sbjct: 104 DFQMYSREPPTVEKVFGARDLFERIRYPALMHCKSGADRAGIMAVLYKLLREKLPYEEAI 163

Query: 163 RQLSMLYGHFPVLKTITMDITFE 185
            QLS  Y H    KT  +D  FE
Sbjct: 164 EQLSGRYLHIRHGKTGVLDAFFE 186


>gi|295691195|ref|YP_003594888.1| protein tyrosine/serine phosphatase [Caulobacter segnis ATCC 21756]
 gi|295433098|gb|ADG12270.1| protein tyrosine/serine phosphatase [Caulobacter segnis ATCC 21756]
          Length = 221

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 77/144 (53%), Gaps = 2/144 (1%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P E+ R+ QP    + + KK+ GIK+I+NLRG    S++  E+ A   LG+  +
Sbjct: 33  NAHWISP-EMVRANQPWPFQLAWWKKQ-GIKTIVNLRGGFDGSFYALEKDACQRLGLNFV 90

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +F +++      E+++    + +T   P L+HCKSGADR G+ S  Y +     P  EA 
Sbjct: 91  DFTITSREVPIRERVRGAKELFETIEYPALMHCKSGADRAGIMSVFYAHYRLGQPIREAM 150

Query: 163 RQLSMLYGHFPVLKTITMDITFEK 186
           +QL   Y H     T  +D  FE+
Sbjct: 151 KQLGPRYLHIKHGNTGVLDYVFEQ 174


>gi|254561265|ref|YP_003068360.1| hypothetical protein METDI2844 [Methylobacterium extorquens DM4]
 gi|254268543|emb|CAX24500.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 241

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 75/143 (52%), Gaps = 3/143 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQL 101
           N H +    ++RSAQP    + + K++ G+++I++LRG     SW  + E A    G+ L
Sbjct: 53  NRHRIGTGLVWRSAQPTPHQLAWFKRQ-GVRTIVSLRGGREHGSWPLQRE-ACERQGLNL 110

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + F L +    + E +            P ++HCKSGADR GLA+ ++L +    P  EA
Sbjct: 111 VEFVLRSREAPSRETLLAARDFFDGLEYPAVMHCKSGADRAGLAATLFLILHEGRPVREA 170

Query: 162 HRQLSMLYGHFPVLKTITMDITF 184
            RQLS  YGHF   KT  +D  F
Sbjct: 171 LRQLSPRYGHFRFAKTGILDAFF 193


>gi|163851502|ref|YP_001639545.1| hypothetical protein Mext_2078 [Methylobacterium extorquens PA1]
 gi|218530309|ref|YP_002421125.1| protein tyrosine/serine phosphatase [Methylobacterium
           chloromethanicum CM4]
 gi|240138669|ref|YP_002963141.1| hypothetical protein MexAM1_META1p2063 [Methylobacterium extorquens
           AM1]
 gi|163663107|gb|ABY30474.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
 gi|218522612|gb|ACK83197.1| protein tyrosine/serine phosphatase [Methylobacterium
           chloromethanicum CM4]
 gi|240008638|gb|ACS39864.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 241

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 75/143 (52%), Gaps = 3/143 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQL 101
           N H +    ++RSAQP    + + K++ G+++I++LRG     SW  + E A    G+ L
Sbjct: 53  NRHRIGTGLVWRSAQPTPHQLAWFKRQ-GVRTIVSLRGGREHGSWPLQRE-ACERQGLNL 110

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + F L +    + E +            P ++HCKSGADR GLA+ ++L +    P  EA
Sbjct: 111 VEFVLRSREAPSRETLLAARDFFAGLEYPAVMHCKSGADRAGLAATLFLILHEGRPVREA 170

Query: 162 HRQLSMLYGHFPVLKTITMDITF 184
            RQLS  YGHF   KT  +D  F
Sbjct: 171 LRQLSPRYGHFRFAKTGILDAFF 193


>gi|188581291|ref|YP_001924736.1| protein tyrosine/serine phosphatase [Methylobacterium populi BJ001]
 gi|179344789|gb|ACB80201.1| protein tyrosine/serine phosphatase [Methylobacterium populi BJ001]
          Length = 241

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 75/143 (52%), Gaps = 3/143 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQL 101
           N H +    ++RSAQP    + + K++ G+++I++LRG     SW  + E A    G+ L
Sbjct: 53  NRHRIGTGLVWRSAQPTPHQLAWFKRQ-GVRTIVSLRGGREHGSWPLQRE-ACERQGLTL 110

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + F L +    + E +            P ++HCKSGADR GLA+ ++L +    P  EA
Sbjct: 111 VEFVLRSREAPSRETLLAARDFFAGLEYPAVMHCKSGADRAGLAATLFLILHEGRPVREA 170

Query: 162 HRQLSMLYGHFPVLKTITMDITF 184
            RQLS  YGHF   KT  +D  F
Sbjct: 171 LRQLSPRYGHFRFAKTGILDAFF 193


>gi|329890440|ref|ZP_08268783.1| protein tyrosine/serine phosphatase [Brevundimonas diminuta ATCC
           11568]
 gi|328845741|gb|EGF95305.1| protein tyrosine/serine phosphatase [Brevundimonas diminuta ATCC
           11568]
          Length = 221

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 89/163 (54%), Gaps = 4/163 (2%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
           T FT N H + P ++ R+ QP+   + + K++ G+++++NLRG+  E+++  E+ A   L
Sbjct: 29  TAFT-NAHWLGP-DLVRTNQPSPRQLAWWKRQ-GVRTVVNLRGQRDEAYYWLEKDACERL 85

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           G+ LI+ PL +      +++++  ++ +T   P LIHCKSGADR G+ +  Y +     P
Sbjct: 86  GLTLIDAPLDSRDPPGKDRVRRAKALFQTMEYPALIHCKSGADRAGMMAVFYRHFHLGEP 145

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEK-ITQLYPNNVSKGD 199
              A  +L     H     T  +D T EK + ++ P  VS  D
Sbjct: 146 ISAAMEELGKRTLHSREGLTGVLDYTLEKYVAEVEPTGVSFED 188


>gi|258541139|ref|YP_003186572.1| hypothetical protein APA01_00350 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632217|dbj|BAH98192.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635274|dbj|BAI01243.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638329|dbj|BAI04291.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641383|dbj|BAI07338.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644438|dbj|BAI10386.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647493|dbj|BAI13434.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256650546|dbj|BAI16480.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653537|dbj|BAI19464.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 220

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 75/142 (52%), Gaps = 1/142 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NFHAV+P ++YR   P    ++   +  G+++++NLRG            AA  LG+  +
Sbjct: 33  NFHAVIPGKVYRCNHPTPARLKRAMERLGLRTLVNLRGHRKCGSDALSRNAARGLGLHHV 92

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +    +    + ++I +   + +    P+L+HCKSGADR GLAS + + +      ++A 
Sbjct: 93  DMAFESRGAPHKDRILRFADMYQKLDFPMLMHCKSGADRAGLASGL-VVLFEGGSAQQAL 151

Query: 163 RQLSMLYGHFPVLKTITMDITF 184
           ++LS  YGHF   +T  +D  F
Sbjct: 152 KELSWKYGHFRSSRTGILDAFF 173


>gi|329114750|ref|ZP_08243507.1| Protein Tyrosine/Serine Phosphatase [Acetobacter pomorum DM001]
 gi|326695881|gb|EGE47565.1| Protein Tyrosine/Serine Phosphatase [Acetobacter pomorum DM001]
          Length = 226

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 74/142 (52%), Gaps = 1/142 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NFHAV+P ++YR   P    ++      G+++++NLRG            AA  LG+  I
Sbjct: 39  NFHAVIPGKVYRCNHPTPARLKRAMGRLGLRTLVNLRGHRKCGSDALSRNAARGLGLHHI 98

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +    +    + ++I +   + +    P+L+HCKSGADR GLAS + + +      ++A 
Sbjct: 99  DMAFESRGAPHKDRILRFADMYQKLDFPILMHCKSGADRAGLASGL-VVLFEGGSAQQAL 157

Query: 163 RQLSMLYGHFPVLKTITMDITF 184
           ++LS  YGHF   +T  +D  F
Sbjct: 158 KELSWKYGHFRSSRTGILDAFF 179


>gi|296114433|ref|ZP_06833087.1| protein tyrosine/serine phosphatase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295979194|gb|EFG85918.1| protein tyrosine/serine phosphatase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 220

 Score = 82.0 bits (201), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 75/142 (52%), Gaps = 1/142 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+P  +YR   P    +    +   +K+++NLRG           +AA+ LG++ I
Sbjct: 33  NFRTVIPGRVYRCNHPTPWRLAMATRRLHLKTLVNLRGHRQCGSDALSREAAHRLGLKHI 92

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +    +    + ++I++   I +T   P+L+HCKSGADRTGLA+ + L +      ++A 
Sbjct: 93  DMAFESRNAPHRDRIERFEKIYRTLTFPMLMHCKSGADRTGLAAGLVL-LFEGGTADDAL 151

Query: 163 RQLSMLYGHFPVLKTITMDITF 184
           RQLS   GHF   +T  +D  F
Sbjct: 152 RQLSWKNGHFNRSRTGVLDAFF 173


>gi|114569186|ref|YP_755866.1| hypothetical protein Mmar10_0635 [Maricaulis maris MCS10]
 gi|114339648|gb|ABI64928.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 241

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 81/149 (54%), Gaps = 8/149 (5%)

Query: 42  QNFHAVVPHEI----YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAAND 96
           Q FH +  HE+    +R+ QP+   +E L  + G K+ILN+RG  P   ++  E++A   
Sbjct: 49  QKFHNM--HEVGGGMWRANQPSPERLEQLAAD-GFKTILNIRGTQPGVCYYDLEKEACEK 105

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            G+ +I+ P  +      +++++ + I ++   P LIHCKSGADR G+ S +Y       
Sbjct: 106 HGLTMIDMPFGSREAPYVDRMQRAVKIFESIEYPALIHCKSGADRAGIISVLYALTKLKL 165

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFE 185
           P +EA + LS+ Y H    KT  +D  FE
Sbjct: 166 PYDEAIKHLSLKYLHVKAGKTGVLDYFFE 194


>gi|197103982|ref|YP_002129359.1| hypothetical protein PHZ_c0516 [Phenylobacterium zucineum HLK1]
 gi|196477402|gb|ACG76930.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 227

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 75/139 (53%), Gaps = 1/139 (0%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  E+ R+ QP    +   K   GIK+I+NLRG    S+H  E+ A   LG+ +++F ++
Sbjct: 43  ISEELVRANQPWPHQLAAWKAR-GIKTIINLRGGFDASFHALEKDACQRLGLTMVDFTIT 101

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM 167
           +    + +++     + +T   P ++HCKSGADR G+ S +Y++        EA  QL +
Sbjct: 102 SREVPSVQRVLGAKRLFETIEYPAMMHCKSGADRAGIMSVLYMHFRKGKTIREAMDQLHL 161

Query: 168 LYGHFPVLKTITMDITFEK 186
            Y H    KT  +D TFE+
Sbjct: 162 RYLHVKQGKTGVLDYTFER 180


>gi|223940368|ref|ZP_03632223.1| protein tyrosine/serine phosphatase [bacterium Ellin514]
 gi|223890973|gb|EEF57479.1| protein tyrosine/serine phosphatase [bacterium Ellin514]
          Length = 188

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 78/139 (56%), Gaps = 8/139 (5%)

Query: 15  YIKILL---GVLVLCAVSL-GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
           ++KI L   G+L++ A+++ G   L       NF   V   +YR AQP+   I+ LK+  
Sbjct: 13  WLKISLLSVGLLLIVAMNVAGRRGLPAQEGIYNF-GKVSEGLYRGAQPDEAGIQNLKR-L 70

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           GIK+I+NLR  +P+     EE  A+  GI   N PL       DEQ+K ++++++T P P
Sbjct: 71  GIKTIVNLR--MPDDVLSGEETQAHANGITYTNVPLRGLGRPTDEQVKNVLALIETLPAP 128

Query: 131 LLIHCKSGADRTGLASAVY 149
           + +HC+ G DRTG   A Y
Sbjct: 129 VFVHCQHGCDRTGTIVACY 147


>gi|89067809|ref|ZP_01155253.1| hypothetical protein OG2516_05128 [Oceanicola granulosus HTCC2516]
 gi|89046407|gb|EAR52463.1| hypothetical protein OG2516_05128 [Oceanicola granulosus HTCC2516]
          Length = 242

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 71/123 (57%), Gaps = 4/123 (3%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESWHKEEEKAANDLGIQLINFPLSAT 109
           ++RS QP    +  L+  +G+ +ILNLRG+          EE AA  LG++L++  L+AT
Sbjct: 59  VWRSNQPTFRRLRELRDRHGVHTILNLRGEDVFAHYLFLREECAA--LGLRLVDVKLNAT 116

Query: 110 RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY 169
                E++ +L+       +P L+HCKSGADRTGLA+A+++ +      E+A  QL   +
Sbjct: 117 TAPTRERLVELLEAFDRVERPFLMHCKSGADRTGLAAALWMMLKEGQSLEQARDQLHRRH 176

Query: 170 GHF 172
            H+
Sbjct: 177 WHY 179


>gi|16124561|ref|NP_419125.1| hypothetical protein CC_0306 [Caulobacter crescentus CB15]
 gi|221233247|ref|YP_002515683.1| hypothetical protein CCNA_00308 [Caulobacter crescentus NA1000]
 gi|13421449|gb|AAK22293.1| hypothetical protein CC_0306 [Caulobacter crescentus CB15]
 gi|220962419|gb|ACL93775.1| hypothetical protein CCNA_00308 [Caulobacter crescentus NA1000]
          Length = 221

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 75/144 (52%), Gaps = 2/144 (1%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P E+ R+ QP    + + KK  GIK+I+NLRG    S++  E+ A   LG+  +
Sbjct: 33  NAHWISP-ELVRANQPWPFQLAWWKKR-GIKTIVNLRGGFDGSFYALEKDACERLGLNFV 90

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +F +++      E+++    + +    P L+HCKSGADR G+ S  Y +     P  EA 
Sbjct: 91  DFVITSREVPIRERVRGAKELFERIEYPALMHCKSGADRAGIMSVFYAHYRLGQPIREAM 150

Query: 163 RQLSMLYGHFPVLKTITMDITFEK 186
           +QL   Y H     T  +D  FE+
Sbjct: 151 QQLGPRYLHIKHGNTGVLDYVFEQ 174


>gi|126735048|ref|ZP_01750794.1| protein tyrosine/serine phosphatase [Roseobacter sp. CCS2]
 gi|126715603|gb|EBA12468.1| protein tyrosine/serine phosphatase [Roseobacter sp. CCS2]
          Length = 267

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 76/146 (52%), Gaps = 4/146 (2%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           + TF  NF A +   +YRS  P+   F  Y     GIK++LNLRG   +  +  E ++  
Sbjct: 77  LRTFWHNF-AQISDGVYRSNHPDHKRFAAYAA--MGIKTVLNLRGVHRQPHYLFEAESCE 133

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            L ++L+   +SA      E++  +++   T  +P L+HCKSGADRTGL +A+YL     
Sbjct: 134 RLSLKLVTIHMSARDAPRKEKLIDVMNAFDTMERPFLMHCKSGADRTGLVAALYLMTKEG 193

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMD 181
               EA +QLS  Y H     T  +D
Sbjct: 194 QSVAEARKQLSFRYLHIRRSSTGILD 219


>gi|255263931|ref|ZP_05343273.1| protein tyrosine/serine phosphatase [Thalassiobium sp. R2A62]
 gi|255106266|gb|EET48940.1| protein tyrosine/serine phosphatase [Thalassiobium sp. R2A62]
          Length = 230

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 68/127 (53%), Gaps = 1/127 (0%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           F  NF   +   +YRS   +           G+K+I+NLRG      +  E++     GI
Sbjct: 48  FWTNFR-TLDTGVYRSNHGDAARFGADIDRLGLKTIINLRGASKAGHYYAEKELCTAKGI 106

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            LI+  L+A +    + +  L+  L+T  +P+LIHCKSGADR GL SA+Y  IV  +P +
Sbjct: 107 TLIDIRLNARKAPRQQALLDLVDALETTERPVLIHCKSGADRAGLGSALYRMIVMGHPTK 166

Query: 160 EAHRQLS 166
           +A  +LS
Sbjct: 167 DARSELS 173


>gi|114328740|ref|YP_745897.1| hypothetical protein GbCGDNIH1_2076 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316914|gb|ABI62974.1| hypothetical protein GbCGDNIH1_2076 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 219

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 75/148 (50%), Gaps = 2/148 (1%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N+  V+P  +YRS  P    +    + +GI++++NLRG            AA  LG+  
Sbjct: 32  DNWAEVLP-GLYRSNHPTPGRLAAAVRRHGIRTLINLRGHRQCGSDALSRDAAQRLGMAH 90

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           ++    +    + ++I +  SIL+    P L+HCKSGADR GLAS + + +       +A
Sbjct: 91  VDMAFESRGAPHRDRILRFASILQQIEYPALMHCKSGADRAGLASGLAIVLTGG-TAAQA 149

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQ 189
            RQLS  +GHF   +T  +D  F +  +
Sbjct: 150 LRQLSWRFGHFNRSRTGILDAFFVRYAR 177


>gi|255019986|ref|ZP_05292059.1| hypothetical protein ACA_1196 [Acidithiobacillus caldus ATCC 51756]
 gi|254970515|gb|EET28004.1| hypothetical protein ACA_1196 [Acidithiobacillus caldus ATCC 51756]
          Length = 228

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 75/145 (51%), Gaps = 4/145 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLGIQL 101
           NFH V     YRSAQP    +    + YG++++LNLR     E   + E++  + LG++ 
Sbjct: 36  NFHEVG-MGAYRSAQPAPYQLRRWHRRYGLRAVLNLRAPAAHEPQFQLEQEVCDALGMEH 94

Query: 102 INFPLSATREL-NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           +      +R+L   EQ  + I  L+  P+P L+HCKSGADR G  S +Y ++      EE
Sbjct: 95  VLLHGIGSRDLPRREQFLEAIETLERLPRPFLMHCKSGADRAGFMSVLYSHLQLGQSLEE 154

Query: 161 AHRQLSML-YGHFPVLKTITMDITF 184
           A  QL +  YGH     T  +D  F
Sbjct: 155 ASAQLRIWPYGHIRHANTGILDWFF 179


>gi|304320094|ref|YP_003853737.1| hypothetical protein PB2503_02597 [Parvularcula bermudensis
           HTCC2503]
 gi|303298997|gb|ADM08596.1| hypothetical protein PB2503_02597 [Parvularcula bermudensis
           HTCC2503]
          Length = 233

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 6/152 (3%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE----EEK 92
           + T   N H + P  + R+ QP+   I    +E G+K+++NLRG   +         E++
Sbjct: 31  LRTLYDNTHEL-PGGMRRTYQPSPGRIARYAQE-GVKTLINLRGIKTDGRQSGVYWLEKE 88

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           A    GI L++    +      E +  L +  ++   P ++HCKSGADR GLA+ +YL++
Sbjct: 89  ACEAAGIALVDLRAYSREAPKPEFLVDLDACFRSIAYPAVMHCKSGADRAGLAAVLYLFL 148

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
              +P EEA  QL+  YGH    KT  +D  F
Sbjct: 149 KEGWPLEEALAQLTYRYGHVKSGKTGVLDHFF 180


>gi|302382966|ref|YP_003818789.1| protein tyrosine/serine phosphatase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193594|gb|ADL01166.1| protein tyrosine/serine phosphatase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 221

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 81/156 (51%), Gaps = 3/156 (1%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N H + P ++ R+ QP+   +E   +  GI++++NLRG+  E ++  E+ A   LG+ L
Sbjct: 32  SNAHWIGP-DLVRTNQPSPRQLEGWARR-GIRTVINLRGERDEGYYWLEKAACERLGLTL 89

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           I+ PL +    + +++++   +  +   P LIHCKSGADR GL +  Y +     P   A
Sbjct: 90  IDAPLDSRDPPSKDRVRRARDLFASIEYPALIHCKSGADRAGLMAVFYRHFHLGEPISVA 149

Query: 162 HRQLSMLYGHFPVLKTITMDITFEK-ITQLYPNNVS 196
            ++LS  Y H     T  +D   E  I ++ P  V 
Sbjct: 150 RQELSKRYLHSREGLTGVLDHFVETYIDEVEPTGVG 185


>gi|269120643|ref|YP_003308820.1| protein tyrosine/serine phosphatase [Sebaldella termitidis ATCC
           33386]
 gi|268614521|gb|ACZ08889.1| protein tyrosine/serine phosphatase [Sebaldella termitidis ATCC
           33386]
          Length = 182

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 78/131 (59%), Gaps = 10/131 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF+ V    IYRSAQP+   +E L    G+K+++NLR      +H +  +A N   ++L
Sbjct: 36  RNFYKV-SDGIYRSAQPDRKNME-LMDIIGVKTVINLR-----RYHSDMNEAKN-TSLKL 87

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
               ++  + + DE I ++++++K + KP+LIHC  G+DRTG+  A+Y  +   + KEEA
Sbjct: 88  ERVKMNPGK-IKDEDIAEILTLIKNSDKPVLIHCWHGSDRTGVVVAMYRIVFEGFSKEEA 146

Query: 162 HRQL-SMLYGH 171
            ++L    YGH
Sbjct: 147 IKELREEKYGH 157


>gi|329851178|ref|ZP_08265935.1| protein tyrosine/serine phosphatase [Asticcacaulis biprosthecum
           C19]
 gi|328840024|gb|EGF89596.1| protein tyrosine/serine phosphatase [Asticcacaulis biprosthecum
           C19]
          Length = 229

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 85/161 (52%), Gaps = 4/161 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P ++ R+ QP    +   KK+ GI++++NLRG    S++  E+ A   LG+ L 
Sbjct: 42  NAHWIGP-DMVRTNQPWPFQLASWKKK-GIRTVINLRGG-KGSFYYMEKYACEKLGLILE 98

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +F L++      ++++   ++ +    P L+HCKSGADR G+ S +Y +     P E A 
Sbjct: 99  DFGLTSRSLPTAQEMRDAKALFERIQYPALLHCKSGADRAGMMSVLYCHFHLKQPIEVAA 158

Query: 163 RQLSMLYGHFPVLKTITMDITFE-KITQLYPNNVSKGDTEQ 202
           +QLSM Y H     T  +D  FE  +  + P  V+  D  Q
Sbjct: 159 QQLSMKYLHMKAGMTGVLDHLFEVYLRDVAPTGVAFYDWTQ 199


>gi|303326383|ref|ZP_07356826.1| protein tyrosine/serine phosphatase [Desulfovibrio sp. 3_1_syn3]
 gi|302864299|gb|EFL87230.1| protein tyrosine/serine phosphatase [Desulfovibrio sp. 3_1_syn3]
          Length = 185

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 11/145 (7%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI-NFPL 106
           V  E+YRS QP G  +    +  GIK++L+LR           + A +  G  L+ N P+
Sbjct: 12  VDSEVYRSGQPEGEGLRS-AENLGIKTVLSLRSP-------NRDDALDKSGDLLLRNVPM 63

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ-L 165
            +    +DE I   + I+  APKP+L+HC+ GADRTGL  A+Y  +   + KE+A ++ L
Sbjct: 64  HSW-NTHDEDIISALRIIHDAPKPILVHCRHGADRTGLIMAMYRVVFQGWTKEQAKKEML 122

Query: 166 SMLYGHFPVLKTITMDITFEKITQL 190
              YG   V   IT  I    I  +
Sbjct: 123 EGGYGFHAVWVNITRRIDKADIAAI 147


>gi|319796308|ref|YP_004157948.1| protein tyrosine/serine phosphatase [Variovorax paradoxus EPS]
 gi|315598771|gb|ADU39837.1| protein tyrosine/serine phosphatase [Variovorax paradoxus EPS]
          Length = 180

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 77/140 (55%), Gaps = 12/140 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +N H + P  +YRSAQP    +  L+   GI++I++LR         ++ K     GI+L
Sbjct: 24  ENLHRITP-TLYRSAQPRRANVAALQ-SLGIRTIVSLRS------FNDDRKVFAGSGIRL 75

Query: 102 INFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +  P++ T  ++D ++ + +  ++ A K  P+LIHC  GADRTG+ +AVY   V  + KE
Sbjct: 76  VRVPIN-TWSIDDAKVLRALVAIREAEKQGPVLIHCMHGADRTGVVAAVYRMAVQGWDKE 134

Query: 160 EA-HRQLSMLYGHFPVLKTI 178
            A H  L   YG+  + + I
Sbjct: 135 SARHEMLRGGYGYHTLWRNI 154


>gi|116623982|ref|YP_826138.1| hypothetical protein Acid_4894 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116227144|gb|ABJ85853.1| protein of unknown function DUF442 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 180

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLT----ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKE 69
           F  + +L  LVLC   L    L     I     NFH V  H +YR  QP+    E+L K 
Sbjct: 4   FKNRRILAALVLCCSILTWQALAETPAIAIPIPNFHQVNEH-VYRGGQPSPETWEHLAK- 61

Query: 70  YGIKSILNLRGKLPESWH-KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
            G+K++++LR +  E     +E +A    G+  +N P+       D+QI +++++L T  
Sbjct: 62  IGVKTVIDLRREGEEEHSVAQEAEAVKKAGMTYVNVPMKGVVAPTDDQIAKVMALLNTN- 120

Query: 129 KPLLIHCKSGADRTGLASAVY 149
           +P+ +HCK G+DRTG   A Y
Sbjct: 121 EPVFVHCKRGSDRTGAVIACY 141


>gi|220936409|ref|YP_002515308.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997719|gb|ACL74321.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 223

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 85/166 (51%), Gaps = 14/166 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHKEEEKAANDLGIQL 101
           NFH +     +RS QP+   +      +GI++++NLRG+ P++     E  A   LG++L
Sbjct: 34  NFHRIS-ERAFRSGQPSPRHLSLRIPRHGIRTVINLRGEEPDNPMLALEADACERLGVRL 92

Query: 102 INFPLSATREL-NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            +   + +R+L   E I Q   +L+    P+  HCKSGADR GL + +YL+ +   P E+
Sbjct: 93  EHL-RTYSRDLPTREVIHQAHELLQRIEYPVWFHCKSGADRAGLMATLYLHWIEGVPLEQ 151

Query: 161 AHRQLSML-YGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMN 205
             RQL +  Y H+   KT  +D  FE           K   E+PM+
Sbjct: 152 T-RQLKLWPYFHYRYAKTGLLDYFFETYL--------KDTAERPMS 188


>gi|149369956|ref|ZP_01889807.1| hypothetical protein SCB49_02744 [unidentified eubacterium SCB49]
 gi|149356447|gb|EDM45003.1| hypothetical protein SCB49_02744 [unidentified eubacterium SCB49]
          Length = 186

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 81/146 (55%), Gaps = 14/146 (9%)

Query: 22  VLVLCAVSLGLYF---LTITTF-TQNFHAV--VPHEIYRSAQPNGTFIEYLKKEYGIKSI 75
           + +L  +S G  F   +    F +++F+ +  +   +YRS QP+    + L+ +YG K+I
Sbjct: 11  IFILALLSFGFSFAQDMNSKKFESRDFNNLFQINDSLYRSDQPSKKAFKELE-DYGFKTI 69

Query: 76  LNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           +N R        +++++ A D  ++L++ P+  T ++ +  I + +  LK A KP+LIHC
Sbjct: 70  INFRR------FRDDKRKARDTNLKLVHLPMQ-TAKVTETDIIEALKALKDAKKPVLIHC 122

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEA 161
             G+DRTG+  A Y  +  ++ KE A
Sbjct: 123 WHGSDRTGVVIASYRIVFENWTKEAA 148


>gi|262371722|ref|ZP_06065001.1| protein tyrosine/serine phosphatase [Acinetobacter junii SH205]
 gi|262311747|gb|EEY92832.1| protein tyrosine/serine phosphatase [Acinetobacter junii SH205]
          Length = 194

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 78/151 (51%), Gaps = 13/151 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF+ +   ++YRS QPN   I  LKK Y I++++NLR +       E+ K   +  + 
Sbjct: 41  THNFYQI-SQDVYRSEQPNSELIPLLKK-YQIETVINLRAR------NEDAKVLQNQSLN 92

Query: 101 LINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           L++ P+  T  +N +   Q  Q I I K   + +L+HC  G+DRTG   A+Y  I  ++ 
Sbjct: 93  LVHIPIQ-TWAINRQDLLQAMQAIQIAKNNNQKVLVHCYHGSDRTGATIAMYRIIFENWS 151

Query: 158 KEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
            E A +++    YG+  + K I    T E +
Sbjct: 152 IENAVKEMKQGGYGYHIIWKNIENLFTSENV 182


>gi|158523189|ref|YP_001531059.1| protein tyrosine/serine phosphatase [Desulfococcus oleovorans Hxd3]
 gi|158512015|gb|ABW68982.1| protein tyrosine/serine phosphatase [Desulfococcus oleovorans Hxd3]
          Length = 192

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 69/136 (50%), Gaps = 11/136 (8%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           I T  +N+H V   ++YRSAQPN   +  ++  +GI+ +LNLR          ++  A  
Sbjct: 37  INTDLKNWHRV-DDKVYRSAQPNAEEMNAVES-FGIEEVLNLRNLF------SDDDEAEG 88

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            G+ L   P SA R +  EQ+ + + I+  A  P+L+HC  GADRTG   A +      +
Sbjct: 89  TGLVLHRIPSSAGR-MTREQVTEALKIINDAKGPILVHCWHGADRTGAVVAAWRMAAHGW 147

Query: 157 PKEEAHRQLSMLYGHF 172
             E A  +  M+ G F
Sbjct: 148 SAEAAIDE--MVNGGF 161


>gi|237722313|ref|ZP_04552794.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_2_4]
 gi|262407523|ref|ZP_06084071.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_1_22]
 gi|294646817|ref|ZP_06724438.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294808854|ref|ZP_06767583.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|298483703|ref|ZP_07001877.1| protein tyrosine/serine phosphatase [Bacteroides sp. D22]
 gi|229448123|gb|EEO53914.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_2_4]
 gi|262354331|gb|EEZ03423.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_1_22]
 gi|292637762|gb|EFF56159.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294443896|gb|EFG12634.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|295087592|emb|CBK69115.1| Protein tyrosine/serine phosphatase [Bacteroides xylanisolvens
           XB1A]
 gi|298270120|gb|EFI11707.1| protein tyrosine/serine phosphatase [Bacteroides sp. D22]
          Length = 187

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 88/182 (48%), Gaps = 24/182 (13%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAV--------------VPHEIYRSAQPNGTFIEYLKKE 69
           +L ++ LG+ F +I+ F+QN                  +   +YRS QP+    + L+K 
Sbjct: 5   ILLSLLLGVIF-SISIFSQNLKVEKITLPDSELTNLYKIDSGVYRSEQPSHEDFKALEK- 62

Query: 70  YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK 129
           YGI   LNLR +     H ++++AA    ++L      A   +N+EQ+ + + I+K    
Sbjct: 63  YGIGEALNLRNR-----HSDDDEAAG-TNVKLHRVKTKA-HSINEEQLIEALRIIKNRKA 115

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTITMDITFEKIT 188
           P++IHC  G+DRTG   A+Y  +  +  KE+A H      +G   + K I   I    I 
Sbjct: 116 PIVIHCHHGSDRTGAVCALYRVVFQNVSKEDAIHEMTEGGFGFHRIYKNIIRRIKEADIE 175

Query: 189 QL 190
           Q+
Sbjct: 176 QI 177


>gi|218782027|ref|YP_002433345.1| protein tyrosine/serine phosphatase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763411|gb|ACL05877.1| protein tyrosine/serine phosphatase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 194

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 79/147 (53%), Gaps = 13/147 (8%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V   +YR AQP     + L+  +GIK+++NLR        + +E+ A D  + L+  P+ 
Sbjct: 51  VSDSLYRGAQPKAEGFKSLEA-HGIKTVVNLRIT------QGDERYAGDTSMNLVGIPMF 103

Query: 108 ATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
              E  +E + Q + + +  A  P+ +HC+ G+DRTG  +A Y  +V  +P E+A  +++
Sbjct: 104 PW-EPEEEDVIQFLRLTQDPATAPVFLHCRHGSDRTGALTACYRVVVCGWPLEQAVEEMT 162

Query: 167 M-LYGHFPVLKTITM---DITFEKITQ 189
              +G+ P+  T+     D+ F++I +
Sbjct: 163 KGGFGYHPIWWTLPRDLEDLDFDRIRR 189


>gi|315500495|ref|YP_004089298.1| protein tyrosine/serine phosphatase [Asticcacaulis excentricus CB
           48]
 gi|315418507|gb|ADU15147.1| protein tyrosine/serine phosphatase [Asticcacaulis excentricus CB
           48]
          Length = 239

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 89/194 (45%), Gaps = 22/194 (11%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAV----------VPHE 51
           +K+ K RK   +F      G+           F T   F  N HA           +  +
Sbjct: 10  VKLFKKRKTPKVFDTSTQWGL-----------FKTYLAFLWNDHAYLRLGFTNAHWIDDK 58

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           + R+ QP    + + KK   I++++NLRG    ++   E  A   LG+ L++F +++   
Sbjct: 59  MVRTNQPWPFQLAWFKKHDRIRTVINLRGG-QGAFFALERHACQTLGLNLVDFIVTSRDV 117

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
            + E I +   +  +   P L+HCKSGADR G+ S +Y ++   +P  EA ++L +   H
Sbjct: 118 PSAEAILEAEKLFDSIQYPALMHCKSGADRAGIMSVLYRHLHLKHPLREAVQELGLRTLH 177

Query: 172 FPVLKTITMDITFE 185
               KT  +D  F+
Sbjct: 178 MKAGKTGVLDYIFD 191


>gi|58039233|ref|YP_191197.1| hypothetical protein GOX0767 [Gluconobacter oxydans 621H]
 gi|58001647|gb|AAW60541.1| Hypothetical protein GOX0767 [Gluconobacter oxydans 621H]
          Length = 220

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 69/142 (48%), Gaps = 1/142 (0%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N   VVP +++R   P    +  L +   +K+++NLRG            A+  LG+  +
Sbjct: 33  NLAPVVPGKVWRCNHPTPARLRSLTRRLHLKTLVNLRGHRKCGSDALSRGASAKLGLTHL 92

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +    +    + ++I +   + +T   P+L+HCKSGADR GLAS + L        ++A 
Sbjct: 93  DMAFESRGAPHRDRILRFYDMYQTLAFPMLMHCKSGADRAGLASGLVLMFEGG-TAQDAL 151

Query: 163 RQLSMLYGHFPVLKTITMDITF 184
            QL   +GHF   +T  +D  F
Sbjct: 152 GQLHWRFGHFNRSRTGILDAFF 173


>gi|77920431|ref|YP_358246.1| hypothetical protein Pcar_2841 [Pelobacter carbinolicus DSM 2380]
 gi|77546514|gb|ABA90076.1| protein tyrosine/serine phosphatase [Pelobacter carbinolicus DSM
           2380]
          Length = 693

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 69/124 (55%), Gaps = 8/124 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H +    +YRSAQP  T ++ L+ + GIK++LNLR     S+H  + KA  + G+   
Sbjct: 37  NLHKL-DENLYRSAQPTATGMKNLE-QMGIKTVLNLR-----SFH-SDRKAIGNTGLGYE 88

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +  + A     ++ I+ L  +      PLL+HC  GADRTG   AVY  +V  + KE+A 
Sbjct: 89  HLYMKAWHPEREDIIRFLRIVTDPERSPLLVHCLHGADRTGTMCAVYRIVVQGWTKEQAL 148

Query: 163 RQLS 166
           R+++
Sbjct: 149 REMT 152


>gi|237715910|ref|ZP_04546391.1| protein tyrosine/serine phosphatase [Bacteroides sp. D1]
 gi|229443557|gb|EEO49348.1| protein tyrosine/serine phosphatase [Bacteroides sp. D1]
          Length = 181

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 84/176 (47%), Gaps = 24/176 (13%)

Query: 30  LGLYFLTITTFTQNFHAV--------------VPHEIYRSAQPNGTFIEYLKKEYGIKSI 75
           LG+ F +I+ F+QN                  +   +YRS QP+    + L+K YGI   
Sbjct: 5   LGVIF-SISIFSQNLKVEKITLPDSELTNLYKIDSGVYRSEQPSHEDFKALEK-YGIGEA 62

Query: 76  LNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           LNLR +     H ++++AA    ++L      A   +N+EQ+ + + I+K    P++IHC
Sbjct: 63  LNLRNR-----HSDDDEAAG-TNVKLHRVKTKA-HSINEEQLIEALRIIKNRKAPIVIHC 115

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTITMDITFEKITQL 190
             G+DRTG   A+Y  +  +  KE+A H      +G   + K I   I    I Q+
Sbjct: 116 HHGSDRTGAVCALYRVVFQNVSKEDAIHEMTEGGFGFHRIYKNIIRRIKEADIEQI 171


>gi|78061402|ref|YP_371310.1| protein tyrosine/serine phosphatase [Burkholderia sp. 383]
 gi|77969287|gb|ABB10666.1| protein tyrosine/serine phosphatase [Burkholderia sp. 383]
          Length = 194

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 78/141 (55%), Gaps = 14/141 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE-KAANDLGIQL 101
           N H + P  +YRSAQ + + +  L+K  GI+ +++ R     S+H ++   A   + +Q 
Sbjct: 46  NLHRITP-TLYRSAQLSRSDVPELQK-LGIRKVISFR-----SFHADDTILAGTQIRMQR 98

Query: 102 INFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           I      T ++ DE +   +  L+TA +  P+LIHC+ GADRTGL SA+Y  +   + +E
Sbjct: 99  IRIN---TWDIRDEDMVAALKALRTADQDGPVLIHCQHGADRTGLVSALYRMVYQGWTRE 155

Query: 160 EAHRQLSM-LYGHFPVLKTIT 179
           +A  +L    YG  P+ + IT
Sbjct: 156 QALDELQHGGYGFHPIWQNIT 176


>gi|299146344|ref|ZP_07039412.1| protein tyrosine/serine phosphatase [Bacteroides sp. 3_1_23]
 gi|298516835|gb|EFI40716.1| protein tyrosine/serine phosphatase [Bacteroides sp. 3_1_23]
          Length = 196

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 88/190 (46%), Gaps = 26/190 (13%)

Query: 25  LCAVSLGLYFLTITTFTQNFHA--------------VVPHEIYRSAQPNGTFIEYLKKEY 70
           LC +++    L+++ F QN  A               +   +YRS QP+    + L+K Y
Sbjct: 17  LCLLAI---VLSVSLFGQNLKADKIILFDSDLTNLYQIDSGVYRSEQPSKEGFKALEK-Y 72

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           GI  +LNLR +     H ++++A     I+L      A   ++++Q+ Q + I+K    P
Sbjct: 73  GIGEVLNLRNR-----HSDDDEAKG-TSIKLHRVKTKA-HSISEKQLIQALRIIKNRKAP 125

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTITMDITFEKITQ 189
           ++ HC  G+DRTG+  A Y  I  +  KE+A H      YG   + K I   I    + Q
Sbjct: 126 IVFHCHHGSDRTGVVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNIIRRIKEANVEQ 185

Query: 190 LYPNNVSKGD 199
           +    +  G+
Sbjct: 186 IRKEVMEGGE 195


>gi|297470462|ref|XP_002683965.1| PREDICTED: LKHP9428-like [Bos taurus]
 gi|296491789|gb|DAA33822.1| LKHP9428-like [Bos taurus]
          Length = 174

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 82/156 (52%), Gaps = 13/156 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ V  ++++RS QPN   I  LK+ + I +I+NLR K        +E    
Sbjct: 17  TLVSQTHNFYQV-SNDVFRSEQPNAAMIPELKR-HEIGTIINLRAK------NSDELVFK 68

Query: 96  DLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           +    L++ P+  T  +N +   ++ Q I I K   + +L+HC  G+DRTG + A+Y  I
Sbjct: 69  NENFNLVHIPID-TWAINRQDLLEVMQQIKIAKQNNQRVLLHCYHGSDRTGASVAMYRII 127

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
             H+  ++A +++    YG+  + K I    T E +
Sbjct: 128 FEHWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENV 163


>gi|160883262|ref|ZP_02064265.1| hypothetical protein BACOVA_01231 [Bacteroides ovatus ATCC 8483]
 gi|260171024|ref|ZP_05757436.1| hypothetical protein BacD2_04084 [Bacteroides sp. D2]
 gi|156111246|gb|EDO12991.1| hypothetical protein BACOVA_01231 [Bacteroides ovatus ATCC 8483]
          Length = 196

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 87/190 (45%), Gaps = 26/190 (13%)

Query: 25  LCAVSLGLYFLTITTFTQNFHA--------------VVPHEIYRSAQPNGTFIEYLKKEY 70
           LC +++    L+++ F QN  A               +   +YRS QP+    + L+K Y
Sbjct: 17  LCLLAI---VLSVSLFGQNLKADKIILSDSDLTNLYQIDSGVYRSEQPSKEGFKALEK-Y 72

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           GI  +LNLR +     H ++++A     I+L      A   ++++Q+ Q + I+K    P
Sbjct: 73  GIGEVLNLRNR-----HSDDDEAKG-TSIKLHRVKTKA-HSISEKQLIQALRIIKNRKAP 125

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTITMDITFEKITQ 189
           ++ HC  G+DRTG   A Y  I  +  KE+A H      YG   + K I   I    + Q
Sbjct: 126 IVFHCHHGSDRTGAVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNIIRRIKEANVEQ 185

Query: 190 LYPNNVSKGD 199
           +    +  G+
Sbjct: 186 IRKEVMEGGE 195


>gi|315919344|ref|ZP_07915584.1| protein tyrosine/serine phosphatase [Bacteroides sp. D2]
 gi|313693219|gb|EFS30054.1| protein tyrosine/serine phosphatase [Bacteroides sp. D2]
          Length = 186

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 87/190 (45%), Gaps = 26/190 (13%)

Query: 25  LCAVSLGLYFLTITTFTQNFHA--------------VVPHEIYRSAQPNGTFIEYLKKEY 70
           LC +++    L+++ F QN  A               +   +YRS QP+    + L+K Y
Sbjct: 7   LCLLAI---VLSVSLFGQNLKADKIILSDSDLTNLYQIDSGVYRSEQPSKEGFKALEK-Y 62

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           GI  +LNLR +     H ++++A     I+L      A   ++++Q+ Q + I+K    P
Sbjct: 63  GIGEVLNLRNR-----HSDDDEAKG-TSIKLHRVKTKA-HSISEKQLIQALRIIKNRKAP 115

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTITMDITFEKITQ 189
           ++ HC  G+DRTG   A Y  I  +  KE+A H      YG   + K I   I    + Q
Sbjct: 116 IVFHCHHGSDRTGAVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNIIRRIKEANVEQ 175

Query: 190 LYPNNVSKGD 199
           +    +  G+
Sbjct: 176 IRKEVMEGGE 185


>gi|294670992|ref|ZP_06735848.1| hypothetical protein NEIELOOT_02698 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307479|gb|EFE48722.1| hypothetical protein NEIELOOT_02698 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 197

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 93/187 (49%), Gaps = 18/187 (9%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQ---PNGTFIEYLK 67
           +LI    + + V    A  + + + T      N + +   ++YRS Q    +   ++ L 
Sbjct: 6   VLILATALSVNVCAENAADMSMKWATPVKQDANLYRL-DDKLYRSEQLTRSDAAAVQGL- 63

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAA-NDLGIQLINFPLSATRELNDEQIKQLISILKT 126
              GIKS++NLR      + +++   A +  GI L N PL   R +  + I + + +++ 
Sbjct: 64  ---GIKSVINLR-----FFDRDDNATALSGSGIALFNKPLLTWR-IKPKHIAETLYLIEQ 114

Query: 127 APK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML-YGHFPVLKTITMDIT 183
             K  P+LIHC  GADRTGL S +Y  I  ++P EEA R++    YG+  + + I    T
Sbjct: 115 QQKQGPVLIHCYHGADRTGLISGMYRVIYQNWPIEEAKREMQQGPYGYHSIWRNIANMFT 174

Query: 184 FEKITQL 190
            EK+ ++
Sbjct: 175 EEKVAKV 181


>gi|153807935|ref|ZP_01960603.1| hypothetical protein BACCAC_02221 [Bacteroides caccae ATCC 43185]
 gi|149129544|gb|EDM20758.1| hypothetical protein BACCAC_02221 [Bacteroides caccae ATCC 43185]
          Length = 188

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 82/157 (52%), Gaps = 23/157 (14%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHA--------------VVPHEIYRSAQPNGTFIEYLKKE 69
           +L ++  G+ F +++ F+QN  A               +   +YRS QP+ +  + L+K 
Sbjct: 5   ILLSLLWGVIF-SLSLFSQNLKAEKITLPDSKLNNLYKIDSGVYRSEQPSHSDFKALEK- 62

Query: 70  YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK 129
           YGI   LNLR +     H + ++A     ++L    + A   +++EQ+   + I+K    
Sbjct: 63  YGIGESLNLRNR-----HSDNDEATGTT-VKLHRVKMKA-HSVDEEQLITALRIIKNRKS 115

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
           P++IHC  G+DRTG+  A+Y  I  +  KE+A R+++
Sbjct: 116 PIVIHCHHGSDRTGVVCALYRIIFQNVSKEDAIREMT 152


>gi|293372029|ref|ZP_06618428.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|292633040|gb|EFF51622.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
          Length = 187

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 71/140 (50%), Gaps = 9/140 (6%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +YRS QP+    + L+K YGI   LNLR +     H ++++AA    ++L      A   
Sbjct: 46  VYRSEQPSHEDFKALEK-YGIGEALNLRNR-----HSDDDEAAG-TNVKLHRVKTKA-HS 97

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYG 170
           +N+EQ+ + + I+K    P++IHC  G+DRTG   A+Y  +  +  K +A H      +G
Sbjct: 98  INEEQLIEALRIIKNRKAPIVIHCHHGSDRTGAVCALYRVVFQNVSKGDAIHEMTEGGFG 157

Query: 171 HFPVLKTITMDITFEKITQL 190
              + K I   I    I Q+
Sbjct: 158 FHRIYKNIIRRIKEADIEQI 177


>gi|329119556|ref|ZP_08248240.1| protein tyrosine/serine phosphatase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464343|gb|EGF10644.1| protein tyrosine/serine phosphatase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 192

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (52%), Gaps = 9/146 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  ++YRS Q       ++K   GIKS++NLR       H     A    G +L N PL 
Sbjct: 42  IDDKLYRSEQLTRADAPHIKA-LGIKSVVNLRYFDRNDNHT----ALAQSGAELFNQPLL 96

Query: 108 ATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
             R +  +QI Q + +++   +  P+LIHC  GADRTGL +A+Y  +  ++P EEA R++
Sbjct: 97  TWR-ITPKQIAQTLHLIEQRRRHGPVLIHCYHGADRTGLIAAMYRIVYQNWPIEEARREM 155

Query: 166 SML-YGHFPVLKTITMDITFEKITQL 190
               YG+  + + +    T +K+ Q+
Sbjct: 156 QQGPYGYHSIWRNLGKLFTADKVRQV 181


>gi|325520902|gb|EGC99881.1| protein tyrosine/serine phosphatase [Burkholderia sp. TJI49]
          Length = 195

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 79/144 (54%), Gaps = 12/144 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T   N + + P  +YRSAQ + + +  L+K  GI+ +++ R     ++H ++   A    
Sbjct: 44  TRVNNLYRITP-SLYRSAQLSRSDVPQLEK-LGIRKVISFR-----AFHSDDSILAG-TQ 95

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHY 156
           I ++  P++ T  + D  +   + +L+TA +  P+LIHC+ GADRTGL SA+   +   +
Sbjct: 96  ITMLRIPIN-TWHIRDRDMVAALKVLRTADQDGPVLIHCQHGADRTGLVSALCRVVYQGW 154

Query: 157 PKEEAHRQLSM-LYGHFPVLKTIT 179
            +E+A  +L    YG  PV + IT
Sbjct: 155 TREQALDELQHGGYGFHPVWRNIT 178


>gi|304322339|ref|YP_003855982.1| protein tyrosine/serine phosphatase [Parvularcula bermudensis
           HTCC2503]
 gi|303301241|gb|ADM10840.1| protein tyrosine/serine phosphatase [Parvularcula bermudensis
           HTCC2503]
          Length = 210

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 75/159 (47%), Gaps = 19/159 (11%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESW 86
           ++L L         +N   V    + RS QP    +  L+  YG++ ++NL RG      
Sbjct: 1   MALALAGCVSVPDVRNLQIVDDGALLRSGQPTPLGLAELRDRYGVRMVINLDRGT----- 55

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK----PLLIHCKSGADRT 142
             +E   A  LG+  +  P +AT  L  E +  L++ L+ A +    P+L+HC+SG DRT
Sbjct: 56  SDDEMVVALALGLDYLAIP-TATYGLERENLVTLLAALRQAERDGRTPVLVHCRSGQDRT 114

Query: 143 GLASAVYLYIVAHYPKEEAHRQL--------SMLYGHFP 173
           G A AV+  I   +  E+A  ++         +L+ H P
Sbjct: 115 GAAVAVFRTIEEDWSAEDAEAEMQRYRHWTHEILFPHLP 153


>gi|254412857|ref|ZP_05026630.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196180592|gb|EDX75583.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 150

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 67/127 (52%), Gaps = 19/127 (14%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           LT+ T     + V P ++ ++AQ             G+KS+LNLR +  E +  +E++ A
Sbjct: 11  LTVAT-----NQVTPEQLQQAAQ------------AGVKSVLNLRSREEEGFASDEKQQA 53

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
              G+Q +N P+     L +E + Q++  ++  PKP LIHCKSG  R+G+ + +Y+    
Sbjct: 54  EAAGLQYVNIPVKPDA-LTEELVSQVLQQIEELPKPALIHCKSGL-RSGMMALMYVATRE 111

Query: 155 HYPKEEA 161
               E+A
Sbjct: 112 GMTAEQA 118


>gi|260548832|ref|ZP_05823054.1| protein tyrosine/serine phosphatase [Acinetobacter sp. RUH2624]
 gi|260408000|gb|EEX01471.1| protein tyrosine/serine phosphatase [Acinetobacter sp. RUH2624]
          Length = 192

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 81/156 (51%), Gaps = 13/156 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ V  ++++RS QPN   I  LK  + I +I+NLR K        +E    
Sbjct: 35  TLVSQTHNFYQV-SNDVFRSEQPNAAMIPELK-HHQIGTIINLRAK------DSDELVFK 86

Query: 96  DLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           +    L++ P+  T  +N +   ++ Q I I K   + +L+HC  G+DRTG + A+Y  I
Sbjct: 87  NENFNLVHIPID-TWAINRQDLLEVMQQIKIAKQNHQRVLLHCYHGSDRTGASVAMYRII 145

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
              +  ++A +++    YG+  + K I +  T E +
Sbjct: 146 FEDWTIDDAVKEMKQGGYGYHIIWKNIDLLFTPENV 181


>gi|222053184|ref|YP_002535546.1| protein tyrosine/serine phosphatase [Geobacter sp. FRC-32]
 gi|221562473|gb|ACM18445.1| protein tyrosine/serine phosphatase [Geobacter sp. FRC-32]
          Length = 200

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 63/116 (54%), Gaps = 10/116 (8%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA-ANDLGIQLINFPLSATR 110
           IYR AQP       LKK  GIK++++LR         E EKA     G++ I  P++ +R
Sbjct: 68  IYRGAQPGADGYATLKK-MGIKTVIDLR-------TSESEKAQVEAAGMRAIAVPIAMSR 119

Query: 111 ELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
           +   E++  ++++L   A +P+ +HC+ G DRTG+  A Y   V  +   EA +++
Sbjct: 120 DGLKEKVDGVVALLADPANQPIFVHCRHGQDRTGIVVAAYRMKVDKWSLAEAEKEM 175


>gi|253567614|ref|ZP_04845025.1| tyrosine/serine phosphatase [Bacteroides sp. 1_1_6]
 gi|251841687|gb|EES69767.1| tyrosine/serine phosphatase [Bacteroides sp. 1_1_6]
          Length = 186

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 81/156 (51%), Gaps = 25/156 (16%)

Query: 28  VSLGLYFLTITTFT---QNFHA---VVPHE-----------IYRSAQPNGTFIEYLKKEY 70
           + LGL+   + +F+   QN +A    VP             +YRS QP+    + L+K Y
Sbjct: 8   IWLGLFIGIVMSFSVYGQNINAEKITVPDSKLTNLYQIDSGVYRSEQPSDADFKALEK-Y 66

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           GI+ +LNLR +     H ++++AA    I+L    + A   ++++Q+   + I+K    P
Sbjct: 67  GIREVLNLRNR-----HSDDDEAAG-TKIKLYRLKMKA-HSVSEDQLINALRIIKNRKGP 119

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
           ++ HC  G+DRTG   A+Y  +     K++A ++++
Sbjct: 120 IVFHCHHGSDRTGAVCAMYRIVFQGVSKQKAIQEMT 155


>gi|186683839|ref|YP_001867035.1| hypothetical protein Npun_R3702 [Nostoc punctiforme PCC 73102]
 gi|186466291|gb|ACC82092.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
          Length = 159

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 62/120 (51%), Gaps = 7/120 (5%)

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT-RELNDEQIKQLISILKTA 127
           + G KS+LNLR      + K+E+K A  LG+   N PL    + LN+E I ++++ L+  
Sbjct: 27  QEGFKSVLNLRSPDELGFSKDEQKVAEALGLHYKNVPLKVDLKNLNEEAITKILTTLEEI 86

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF------PVLKTITMD 181
           PKP ++HC +G   TG+A           P+E   R  ++ +G F      P L+ + +D
Sbjct: 87  PKPAVVHCAAGMRSTGIALLSIAIQEGLTPEETLARAKNLGFGFFEHAGVSPRLRQLFVD 146


>gi|149176972|ref|ZP_01855581.1| hypothetical protein PM8797T_07122 [Planctomyces maris DSM 8797]
 gi|148844227|gb|EDL58581.1| hypothetical protein PM8797T_07122 [Planctomyces maris DSM 8797]
          Length = 225

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 94/191 (49%), Gaps = 8/191 (4%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIE 64
           K PR++ L F I +++  L+   V +    L      + F  V   +IYRS Q +   IE
Sbjct: 16  KSPRRHKL-FKISLIVCALIGTGVLIWEEVLEDRIVAKRFGVVEQGKIYRSGQISSYLIE 74

Query: 65  YLKKEYGIKSILNLRGK-LPESWHKEEEKAANDLGI--QLINFPLSATRELND--EQIKQ 119
            +  E  I+ ++ L G  L + + K E + A  L I  Q+++     T +++D  E + +
Sbjct: 75  PVLSENKIEKVIALNGSDLQKPYLKAEVQTAKKLHIDHQVLHLIGDGTGDVDDYAEAVAE 134

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTIT 179
           ++   K A KP+L+HC +GA RTG   A Y  +V     EEA+++L + Y   P      
Sbjct: 135 IMRCEK-AGKPVLVHCAAGAQRTGGVIAAYRMLVQKKTPEEAYQEL-LQYDWKPHKDQAL 192

Query: 180 MDITFEKITQL 190
           +D   + + QL
Sbjct: 193 IDYLNQNLAQL 203


>gi|149194664|ref|ZP_01871759.1| hypothetical protein CMTB2_04767 [Caminibacter mediatlanticus TB-2]
 gi|149135087|gb|EDM23568.1| hypothetical protein CMTB2_04767 [Caminibacter mediatlanticus TB-2]
          Length = 166

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 1/87 (1%)

Query: 63  IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           +E + K+Y IKS+LNLRG+    +  EEE     LG++     +S+    + E++++L++
Sbjct: 5   LEKIIKKYDIKSVLNLRGRGNYLYDLEEE-ICKKLGVEYKVITISSRVLPSYEKLEELVN 63

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAVY 149
            LK + KPLL HCK+GADRTG  + ++
Sbjct: 64  YLKNSKKPLLFHCKAGADRTGFVAVLW 90


>gi|325280120|ref|YP_004252662.1| hypothetical protein Odosp_1446 [Odoribacter splanchnicus DSM
           20712]
 gi|324311929|gb|ADY32482.1| hypothetical protein Odosp_1446 [Odoribacter splanchnicus DSM
           20712]
          Length = 170

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 58/110 (52%), Gaps = 8/110 (7%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +YRS QP+      L+K +G++ ILNLR      +H +  K A    + L + P  AT  
Sbjct: 34  VYRSDQPSAACFRELEK-FGMREILNLR-----CYHTDT-KEAQGTSLILHHLPTRATLL 86

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             D+ +  +  I++    PLL HC  G+DRTG  +A+Y  +  H PK+ A
Sbjct: 87  RLDDLVTAM-QIIRDRKGPLLFHCWHGSDRTGAVAAMYRMVFQHVPKQHA 135


>gi|255066578|ref|ZP_05318433.1| protein tyrosine/serine phosphatase [Neisseria sicca ATCC 29256]
 gi|255049162|gb|EET44626.1| protein tyrosine/serine phosphatase [Neisseria sicca ATCC 29256]
          Length = 176

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 77/149 (51%), Gaps = 15/149 (10%)

Query: 48  VPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           +  ++YRS QP   +G  IE+L    GI+S++NLR         + E       + L+N 
Sbjct: 26  IDDKLYRSEQPVAEDGELIEHL----GIRSVINLRFFD----RNDNETHLKGRNLMLLNR 77

Query: 105 PLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           PL  T ++  + I Q + +++   K  P+L+HC  GADRTGL S +Y  I   +  EEA 
Sbjct: 78  PL-LTWKIKPKDIAQTLFLIEKQQKYGPVLVHCYHGADRTGLISGMYRIIYQGWSVEEAR 136

Query: 163 RQLSML-YGHFPVLKTITMDITFEKITQL 190
            ++    YG+  + K I    T EK+ ++
Sbjct: 137 LEMQHGPYGYHSIWKNIENLFTEEKVQEV 165


>gi|281356890|ref|ZP_06243380.1| protein tyrosine/serine phosphatase [Victivallis vadensis ATCC
           BAA-548]
 gi|281316448|gb|EFB00472.1| protein tyrosine/serine phosphatase [Victivallis vadensis ATCC
           BAA-548]
          Length = 180

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 73/147 (49%), Gaps = 27/147 (18%)

Query: 43  NFHAVVPH-EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL---- 97
           NF AV     I+RS QP     E L K  G KSILNLR     ++H       +DL    
Sbjct: 27  NFKAVDEELGIFRSGQPGRKEFEALAKR-GFKSILNLR-----NYH-------SDLKLIR 73

Query: 98  GIQLINFPLSA-TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           G++L  F     T  + ++ +   + I++ APKPLLIHC  G+DRTG   A +   V ++
Sbjct: 74  GLELKEFRCGVNTGSVTEKDLLNAVRIVRDAPKPLLIHCWHGSDRTGTVVAAFRIAVQNW 133

Query: 157 PKEEAHRQLSM--------LYGHFPVL 175
             E+A  ++ +        +YG+  VL
Sbjct: 134 EVEKAIAEMRLPENGYHEKIYGNLLVL 160


>gi|29345614|ref|NP_809117.1| hypothetical protein BT_0204 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29337506|gb|AAO75311.1| protein tyrosine/serine phosphatase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 169

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +YRS QP+    + L+K YGI+ +LNLR +     H ++++AA    I+L    + A   
Sbjct: 32  VYRSEQPSDADFKALEK-YGIREVLNLRNR-----HSDDDEAAG-TKIKLYRLKMKA-HS 83

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYG 170
           ++++Q+   + I+K    P++ HC  G+DRTG   A+Y  +     K++A ++++   +G
Sbjct: 84  VSEDQLINALRIIKNRKGPIVFHCHHGSDRTGAVCAMYRIVFQGVSKQKAIQEMTEGGFG 143

Query: 171 HFPVLKTITMDITFEKITQL 190
              + K I   I    I ++
Sbjct: 144 FHRIYKNIIRTIEKADIERI 163


>gi|78221312|ref|YP_383059.1| protein tyrosine/serine phosphatase [Geobacter metallireducens
           GS-15]
 gi|78192567|gb|ABB30334.1| protein tyrosine/serine phosphatase [Geobacter metallireducens
           GS-15]
          Length = 202

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 68/124 (54%), Gaps = 9/124 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N   V P  IYR AQP     E L+K  GI+++++LR    ES  +E E A    G++ I
Sbjct: 61  NGGRVAPG-IYRGAQPGPEGYETLRK-MGIRTVIDLR--TTESEQREVEAA----GMKAI 112

Query: 103 NFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             P++ +R+   E++ +++ ++   A +P+ +HC+ G DRTG+  A Y   V  +   +A
Sbjct: 113 AIPIAMSRDGLREKVDRVVVLMADPANQPVFVHCRHGQDRTGIVVAAYRMKVEGWSLADA 172

Query: 162 HRQL 165
             ++
Sbjct: 173 EAEM 176


>gi|298384534|ref|ZP_06994094.1| protein tyrosine/serine phosphatase [Bacteroides sp. 1_1_14]
 gi|298262813|gb|EFI05677.1| protein tyrosine/serine phosphatase [Bacteroides sp. 1_1_14]
          Length = 186

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 80/156 (51%), Gaps = 25/156 (16%)

Query: 28  VSLGLYFLTITTFT---QNFHA---VVPHE-----------IYRSAQPNGTFIEYLKKEY 70
           + LGL+   + +F+   QN +A    VP             +YRS QP+    + L+K Y
Sbjct: 8   IWLGLFIGIVMSFSVYGQNINAEKITVPDSKLTNLYQIDSGVYRSEQPSDADFKALEK-Y 66

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           GI+ +LNLR +     H ++++AA    I+L    + A   +++ Q+   + I+K    P
Sbjct: 67  GIREVLNLRNR-----HSDDDEAAG-TKIKLYRLKMKA-HSVSEGQLINALRIIKNRKGP 119

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
           ++ HC  G+DRTG   A+Y  +     K++A ++++
Sbjct: 120 IVFHCHHGSDRTGAVCAMYRIVFQGVSKQKAIQEMT 155


>gi|251792715|ref|YP_003007441.1| protein tyrosine/serine phosphatase [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534108|gb|ACS97354.1| protein tyrosine/serine phosphatase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 204

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 80/161 (49%), Gaps = 10/161 (6%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
           ++ T+ +  +N + +     YRS Q +    E L  +  IK+I+NLR          +E+
Sbjct: 43  HWATVISENENLYRI-DDNFYRSEQLDRQ-AEPLLNKLNIKTIVNLRFFD----RNNDEQ 96

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYL 150
           A     I LIN PL  T  +N  ++  ++  ++   K  P+L+HC  GADRTGL  A+Y 
Sbjct: 97  AFGHKNINLINTPL-LTWSINTREVADILWQIRQHQKDGPVLVHCYHGADRTGLIVAMYR 155

Query: 151 YIVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQL 190
            I  ++   EA R++    YG+  + K I    T E + ++
Sbjct: 156 VIYQNWDLNEAKREMQQAPYGYHSIWKNIDNFFTEENVAKI 196


>gi|119489654|ref|ZP_01622413.1| hypothetical protein L8106_13055 [Lyngbya sp. PCC 8106]
 gi|119454391|gb|EAW35540.1| hypothetical protein L8106_13055 [Lyngbya sp. PCC 8106]
          Length = 150

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 5/111 (4%)

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           + G KS+LN R    E +  +EEK A   G++ +N P+ A   + DE  +++I  +   P
Sbjct: 28  QAGFKSVLNFRSPQEEGFLSDEEKQAEAAGLEYVNIPVKANG-ITDELAEKIIEQIDQLP 86

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKE---EAHRQLSMLYGHFPVLK 176
           KP+L+HCKSG  R+G  + +Y+ I      +   E  +++      FP +K
Sbjct: 87  KPILLHCKSGL-RSGAMALMYIAIKEKISADIILEQGKEMGFDCNKFPEMK 136


>gi|226954408|ref|ZP_03824872.1| phosphatase [Acinetobacter sp. ATCC 27244]
 gi|226834856|gb|EEH67239.1| phosphatase [Acinetobacter sp. ATCC 27244]
          Length = 196

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 77/147 (52%), Gaps = 13/147 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +   ++YRS QP+   I  LK ++ I +++NLR +       ++     
Sbjct: 40  TLISNTHNFYQI-SQDVYRSEQPDAELIASLK-QHQIHTVINLRAR------NKDANVFK 91

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYLYI 152
           D    L++ P+  T  +N + +   +  ++TA +    +L+HC  G+DRTG   A+Y  I
Sbjct: 92  DQDFNLVHIPI-YTWAINRDDLLTAMRAIQTAKQQNQKVLVHCYHGSDRTGATIAMYRII 150

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTI 178
             ++  E+A +++    YG+  + K I
Sbjct: 151 FENWSIEDAVKEMKQGGYGYHVIWKNI 177


>gi|294651422|ref|ZP_06728736.1| phosphatase [Acinetobacter haemolyticus ATCC 19194]
 gi|292822668|gb|EFF81557.1| phosphatase [Acinetobacter haemolyticus ATCC 19194]
          Length = 197

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 77/147 (52%), Gaps = 13/147 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +   ++YRS QP+   I  LK ++ I +++NLR +       ++     
Sbjct: 40  TLISNTHNFYQI-SQDVYRSEQPDAELIASLK-QHQIHTVINLRAR------NKDANVFK 91

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYLYI 152
           D    L++ P+  T  +N + +   +  ++TA +    +L+HC  G+DRTG   A+Y  I
Sbjct: 92  DQDFNLVHIPI-YTWAINRDDLLTAMRAIQTAKQQNQKVLVHCYHGSDRTGATIAMYRII 150

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTI 178
             ++  E+A +++    YG+  + K I
Sbjct: 151 FENWSIEDAVKEMKQGGYGYHVIWKNI 177


>gi|293611065|ref|ZP_06693364.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826717|gb|EFF85083.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 192

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 82/155 (52%), Gaps = 11/155 (7%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           ++ + T NF+ +  +++YRS QP+   I  LK ++ I +I+NLR K  +S   + E    
Sbjct: 35  SLVSQTHNFYQI-SNDVYRSEQPDTAMISELK-DHQIGTIINLRAKDADSLVFKNE---- 88

Query: 96  DLGIQLINFPLS--ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
                L++ P++  A    +  ++ Q I I K   + +L+HC  G+DRTG + A+Y  I 
Sbjct: 89  --NFNLVHIPINTWAIDRQDLLEVMQQIKIAKQNDQRVLLHCYHGSDRTGASVAMYRIIF 146

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
            ++  ++A +++    YG+  + K I    T E +
Sbjct: 147 ENWTIDDAVKEMKQGGYGYHIIWKNIDRLFTPENV 181


>gi|75910356|ref|YP_324652.1| hypothetical protein Ava_4158 [Anabaena variabilis ATCC 29413]
 gi|75704081|gb|ABA23757.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 157

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 54/99 (54%), Gaps = 13/99 (13%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           V+P ++ +++Q             G KS+LNLR      +   E++ A  LG++ +N PL
Sbjct: 17  VIPEQLEQASQE------------GFKSVLNLRSPDELGFSHNEQQVAEALGLKYVNVPL 64

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLA 145
               +LN+E I +++  LKT PKP L+HC +    TG+A
Sbjct: 65  K-LEDLNEELITEVLKALKTLPKPTLVHCAAAMRSTGIA 102


>gi|260557159|ref|ZP_05829375.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           19606]
 gi|260409265|gb|EEX02567.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           19606]
          Length = 192

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 82/160 (51%), Gaps = 21/160 (13%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +  ++++RS QP+   I  LK  Y I +++NLR K           A++
Sbjct: 35  TLVSQTHNFYQI-SNDVFRSEQPDAAMIPELK-HYQIGTVINLRAK-----------ASD 81

Query: 96  DL-----GIQLINFPLS--ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           DL        L++ P++  A    +  ++ Q I + K   + +L+HC  G+DRTG + A+
Sbjct: 82  DLVFKNENFNLVHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAM 141

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
           Y  I  ++  ++A +++    YG+  + K I    T E +
Sbjct: 142 YRIIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENV 181


>gi|325123389|gb|ADY82912.1| conserved hypothetical tyrosine/serine phosphatase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 174

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 81/155 (52%), Gaps = 11/155 (7%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           ++ + T NF+ +  +++YRS QP+   I  LK  + I +I+NLR K  +S   + E    
Sbjct: 17  SLVSQTHNFYQI-SNDVYRSEQPDTAMISELKN-HQIGTIINLRAKDADSLVFKNE---- 70

Query: 96  DLGIQLINFPLS--ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
                L++ P++  A    +  ++ Q I I K   + +L+HC  G+DRTG + A+Y  I 
Sbjct: 71  --NFNLVHIPINTWAIDRQDLLEVMQQIKIAKQNDQRVLLHCYHGSDRTGASVAMYRIIF 128

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
            ++  ++A +++    YG+  + K I    T E +
Sbjct: 129 ENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENV 163


>gi|226502498|ref|NP_001142818.1| hypothetical protein LOC100275198 [Zea mays]
 gi|195610178|gb|ACG26919.1| hypothetical protein [Zea mays]
          Length = 149

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 53/91 (58%), Gaps = 1/91 (1%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  ++  ++QP+   ++  K++ GI S+LNLR    +++ KEE   A  LG+Q  N  + 
Sbjct: 10  ITKDLLYASQPDAESLKQTKEQKGIASVLNLRDTEEQTFMKEEGDVAQQLGLQYKNVCVK 69

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           +  EL +    Q+I  ++T PKP+LIHC  G
Sbjct: 70  SLGELKN-AASQIIEAIETMPKPILIHCIQG 99


>gi|299768829|ref|YP_003730855.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter sp. DR1]
 gi|298698917|gb|ADI89482.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter sp. DR1]
          Length = 192

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 84/156 (53%), Gaps = 13/156 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + + NF+ +  ++++RS QP+   I  LK  + I +I+NLR K  ++   + E    
Sbjct: 35  TLVSQSHNFYQI-SNDVFRSEQPSAAMISELKN-HQIGTIINLRAKDADTLVFKNE---- 88

Query: 96  DLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
                L++ P++ T  +N +   ++ Q I I K + + +L+HC  G+DRTG + A+Y  I
Sbjct: 89  --NFNLVHIPIN-TWAINRQDLLEVMQQIKIAKQSNQRVLLHCYHGSDRTGASVAMYRII 145

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
             ++  ++A +++    YG+  + K I    T E +
Sbjct: 146 FENWAIDDAVKEMKEGGYGYHIIWKNIDRLFTPENV 181


>gi|229587628|ref|YP_002869747.1| hypothetical protein PFLU0050 [Pseudomonas fluorescens SBW25]
 gi|229359494|emb|CAY46335.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 221

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 12/127 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P  +YRSA P+G     L+K   I +++N    LPES   +  K+ N   +QL 
Sbjct: 48  NLHQMTP-TLYRSALPDGNAAPLLEK-LKIGTVINF---LPES-DADWLKSPNIRQVQLS 101

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
                 T  ++D  +   +  ++ A    P+L+HCK G+DRTGL +A+Y  ++  + KE+
Sbjct: 102 ----YRTNHVDDSDVLAALRAIREAEANGPVLMHCKHGSDRTGLMAAMYRVVIQGWSKED 157

Query: 161 AHRQLSM 167
           A  ++S+
Sbjct: 158 ALNEMSL 164


>gi|262281114|ref|ZP_06058896.1| protein tyrosine/serine phosphatase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257345|gb|EEY76081.1| protein tyrosine/serine phosphatase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 193

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 78/151 (51%), Gaps = 21/151 (13%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + + NF+ +    ++RS QP+ T +  LK+ + I +I+NLR +           A++
Sbjct: 35  TLVSQSHNFYQI-SDTVFRSEQPDATMVPELKR-HQISTIINLRAR-----------ASD 81

Query: 96  DLGIQLINFPLS-------ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           DL  +  NF L+       A    +  ++ Q I I K   + +L+HC  G+DRTG + A+
Sbjct: 82  DLVFKNENFNLAHIPINTWAIDRQDLLEVMQQIKIAKQNNQRVLLHCYHGSDRTGASVAM 141

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
           Y  I  ++  ++A +++    YG+  + K I
Sbjct: 142 YRIIFENWAIDDAVKEMKQGGYGYHIIWKNI 172


>gi|169794794|ref|YP_001712587.1| putative phosphatase [Acinetobacter baumannii AYE]
 gi|184159433|ref|YP_001847772.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ACICU]
 gi|213157879|ref|YP_002320677.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           AB0057]
 gi|215482338|ref|YP_002324520.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB307-0294]
 gi|301346256|ref|ZP_07226997.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB056]
 gi|301512777|ref|ZP_07238014.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB058]
 gi|301597753|ref|ZP_07242761.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB059]
 gi|332852245|ref|ZP_08434050.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013150]
 gi|332870468|ref|ZP_08439232.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013113]
 gi|332876274|ref|ZP_08444049.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6014059]
 gi|169147721|emb|CAM85584.1| conserved hypothetical protein; putative phosphatase [Acinetobacter
           baumannii AYE]
 gi|183211027|gb|ACC58425.1| Protein tyrosine/serine phosphatase [Acinetobacter baumannii ACICU]
 gi|213057039|gb|ACJ41941.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           AB0057]
 gi|213985690|gb|ACJ55989.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB307-0294]
 gi|322509346|gb|ADX04800.1| putative phosphatase [Acinetobacter baumannii 1656-2]
 gi|323519371|gb|ADX93752.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332729375|gb|EGJ60715.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013150]
 gi|332732205|gb|EGJ63473.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013113]
 gi|332735546|gb|EGJ66598.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6014059]
          Length = 192

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 82/160 (51%), Gaps = 21/160 (13%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +  ++++RS QP+   I  LK  + I +I+NLR K           A++
Sbjct: 35  TLVSQTHNFYQI-SNDVFRSEQPDAAMIPELK-HHQIGTIINLRAK-----------ASD 81

Query: 96  DL-----GIQLINFPLS--ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           DL        L++ P++  A    +  ++ Q I + K   + +L+HC  G+DRTG + A+
Sbjct: 82  DLVFKNENFNLVHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAM 141

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
           Y  I  ++  ++A +++    YG+  + K I    T E +
Sbjct: 142 YRIIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENV 181


>gi|317062979|ref|ZP_07927464.1| protein tyrosine/serine phosphatase [Fusobacterium ulcerans ATCC
           49185]
 gi|313688655|gb|EFS25490.1| protein tyrosine/serine phosphatase [Fusobacterium ulcerans ATCC
           49185]
          Length = 193

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 79/154 (51%), Gaps = 13/154 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF+ V    ++RS QP    ++ ++  +GI ++++LR +      K+ E A N   + L
Sbjct: 40  DNFYKV-SETLFRSEQPTEDGMKNIEA-FGIGTVISLRSR-----QKDVELAKN-TELNL 91

Query: 102 INFPLSATRELNDEQIKQLISILKTAP----KPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           I+  + A     ++ +K +  +    P    KP+LIHC  GADRTG+  A+Y  +  ++ 
Sbjct: 92  IHVSMRAWNPKYEDAVKVMYFLNPNNPETNKKPILIHCYHGADRTGMMVALYRMVYQNWE 151

Query: 158 KEEA-HRQLSMLYGHFPVLKTITMDITFEKITQL 190
           +EEA +  L+  YG+  + K I   I    + QL
Sbjct: 152 REEALNEMLNGGYGYHSMWKDIVTFIKTVDVEQL 185


>gi|257468724|ref|ZP_05632818.1| hypothetical protein FulcA4_05240 [Fusobacterium ulcerans ATCC
           49185]
          Length = 204

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 79/154 (51%), Gaps = 13/154 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF+ V    ++RS QP    ++ ++  +GI ++++LR +      K+ E A N   + L
Sbjct: 51  DNFYKV-SETLFRSEQPTEDGMKNIEA-FGIGTVISLRSR-----QKDVELAKN-TELNL 102

Query: 102 INFPLSATRELNDEQIKQLISILKTAP----KPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           I+  + A     ++ +K +  +    P    KP+LIHC  GADRTG+  A+Y  +  ++ 
Sbjct: 103 IHVSMRAWNPKYEDAVKVMYFLNPNNPETNKKPILIHCYHGADRTGMMVALYRMVYQNWE 162

Query: 158 KEEA-HRQLSMLYGHFPVLKTITMDITFEKITQL 190
           +EEA +  L+  YG+  + K I   I    + QL
Sbjct: 163 REEALNEMLNGGYGYHSMWKDIVTFIKTVDVEQL 196


>gi|253559464|gb|ACT32424.1| hypothetical protein [Pseudomonas fluorescens]
          Length = 226

 Score = 57.8 bits (138), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 70/126 (55%), Gaps = 12/126 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRS+ P+G  +  L K   I +++     LPES    +++  +  GI+ +
Sbjct: 45  NLYQMSP-TLYRSSLPDGAALPLLSK-LRIGTVITF---LPES----DKRWLSTPGIEQV 95

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
             P   T  ++D  I + +  ++ A    P+L+HCK G+DRTGL +A+Y  +V  + KE+
Sbjct: 96  QLPYR-TNHVDDSDILRALRAVQAAEAKGPVLMHCKHGSDRTGLVAAMYRVVVQGWSKED 154

Query: 161 AHRQLS 166
           A  +++
Sbjct: 155 ALNEMT 160


>gi|241759893|ref|ZP_04757993.1| protein tyrosine/serine phosphatase [Neisseria flavescens SK114]
 gi|241319901|gb|EER56297.1| protein tyrosine/serine phosphatase [Neisseria flavescens SK114]
          Length = 196

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 77/146 (52%), Gaps = 10/146 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  ++YRS QP     E + K  GI+S++NLR      + + ++      G+ L+N PL 
Sbjct: 47  IDDKLYRSEQPVAEDGEAIVK-LGIQSVINLR-----FFDRNDDDYLKAYGLTLLNRPL- 99

Query: 108 ATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            +  +  ++I +++ +++   +   +LIHC  GADRTGL + +Y  I   +  EEA  ++
Sbjct: 100 LSWSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRIIYQGWTVEEAKAEM 159

Query: 166 SML-YGHFPVLKTITMDITFEKITQL 190
               YG+  + K I    T EK+ Q+
Sbjct: 160 QHGPYGYHSIWKNIANLFTEEKVKQV 185


>gi|298369990|ref|ZP_06981306.1| protein tyrosine/serine phosphatase [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281450|gb|EFI22939.1| protein tyrosine/serine phosphatase [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 183

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 76/154 (49%), Gaps = 25/154 (16%)

Query: 48  VPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND-----LGI 99
           +  ++YRS QP   +G  IE L    GIKS++NLR           ++  ND      G+
Sbjct: 32  IDDKLYRSEQPVADDGDTIEKL----GIKSVINLR---------YFDRNNNDSHLKNRGL 78

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYP 157
            L+N PL + R +  E I Q + +++   +   +LIHC  GADRTGL S +Y  I   + 
Sbjct: 79  TLLNRPLRSWR-IKPEDIAQTLYLIEKQQQQGAVLIHCYHGADRTGLISGMYRIIYQGWT 137

Query: 158 KEEAHRQ-LSMLYGHFPVLKTITMDITFEKITQL 190
             +A  + L   YG+  + K I    T + + Q+
Sbjct: 138 VADAKEEMLHGPYGYHSIWKNIANLFTEKTVKQV 171


>gi|169632471|ref|YP_001706207.1| putative phosphatase [Acinetobacter baumannii SDF]
 gi|169151263|emb|CAO99956.1| conserved hypothetical protein; putative phosphatase [Acinetobacter
           baumannii]
          Length = 192

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 82/160 (51%), Gaps = 21/160 (13%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +  ++++RS QP+   I  LK  + I +I+NLR K           A++
Sbjct: 35  TLVSQTHNFYQI-SNDVFRSEQPDAAMIPELK-HHQIGTIINLRAK-----------ASD 81

Query: 96  DL-----GIQLINFPLS--ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           DL        LI+ P++  A    +  ++ Q I + K   + +L+HC  G+DRTG + ++
Sbjct: 82  DLVFKNENFNLIHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVSM 141

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
           Y  I  ++  ++A +++    YG+  + K I    T E +
Sbjct: 142 YRIIFENWVIDDAVKEMKQGGYGYHIIWKNIDRLFTPENV 181


>gi|330806771|ref|YP_004351233.1| hypothetical protein PSEBR_a100 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374879|gb|AEA66229.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 226

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 70/126 (55%), Gaps = 12/126 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRS+ P+G  +  L K   I +++     LPES    +++  +  GI+ +
Sbjct: 45  NLYQMSP-TLYRSSLPDGAALPLLTK-LRIGTVITF---LPES----DKRWLSTPGIEQV 95

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
             P   T  ++D  I + +  ++ A    P+L+HCK G+DRTGL +A+Y  +V  + KE+
Sbjct: 96  QLPYR-TNHVDDSDILRALRAVQAAEAKGPVLMHCKHGSDRTGLVAAMYRVVVQGWSKED 154

Query: 161 AHRQLS 166
           A  +++
Sbjct: 155 ALNEMT 160


>gi|167584148|ref|ZP_02376536.1| protein tyrosine/serine phosphatase [Burkholderia ubonensis Bu]
          Length = 201

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 74/140 (52%), Gaps = 12/140 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P  +YRSA  +   +  L+K  GI+ +++ R     ++H +E   A    I + 
Sbjct: 46  NLHRITP-SLYRSALLSREDVPELQK-LGIRKVISFR-----AFHSDERILAG-TQITMQ 97

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           + P++ T  + DE +   +  L+ A +  P+LIHC+ GADRTGL SA+Y  +   + +E+
Sbjct: 98  SIPIN-TWYIRDEDMVAALRALRDADRDGPVLIHCQHGADRTGLVSALYRMVYQGWTREQ 156

Query: 161 AHRQLSM-LYGHFPVLKTIT 179
           A  +L    YG   + + I 
Sbjct: 157 ALDELQHGGYGFHAIWQNIA 176


>gi|239501722|ref|ZP_04661032.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB900]
          Length = 192

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 82/160 (51%), Gaps = 21/160 (13%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           ++ + T NF+ +  ++++RS QP+   I  LK  + I +I+NLR K           A++
Sbjct: 35  SLISQTHNFYQI-SNDVFRSEQPDAAMIPELK-HHQIGTIINLRAK-----------ASD 81

Query: 96  DL-----GIQLINFPLS--ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           DL        L++ P++  A    +  ++ Q I + K   + +L+HC  G+DRTG + A+
Sbjct: 82  DLVFKNEDFNLVHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAM 141

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKI 187
           Y  I  ++  ++A +++    YG+  + K I    T E +
Sbjct: 142 YRIIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENV 181


>gi|189423129|ref|YP_001950306.1| protein tyrosine/serine phosphatase [Geobacter lovleyi SZ]
 gi|189419388|gb|ACD93786.1| protein tyrosine/serine phosphatase [Geobacter lovleyi SZ]
          Length = 204

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 9/108 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N   V P  +YR  QP       LK+  GIK++++LR    E   K + +AA   G++ I
Sbjct: 56  NVGRVAPG-VYRGEQPGAAGYATLKR-LGIKTVIDLRTSESE---KTQVEAA---GMKAI 107

Query: 103 NFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVY 149
             P+  TR+   +++ Q+++++   A +P+ +HC+ G DRTG+  A Y
Sbjct: 108 AVPIEMTRKGLRQKVDQVVALMADPANQPVYVHCRHGQDRTGIVVAAY 155


>gi|225024155|ref|ZP_03713347.1| hypothetical protein EIKCOROL_01023 [Eikenella corrodens ATCC
           23834]
 gi|224943180|gb|EEG24389.1| hypothetical protein EIKCOROL_01023 [Eikenella corrodens ATCC
           23834]
          Length = 203

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 72/146 (49%), Gaps = 9/146 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V  ++YRS QP    +E L+    +KS++NLR          + K   D GI L N PL 
Sbjct: 52  VDDKLYRSEQPVEEDVELLQS-LNVKSVVNLRYFNRSG----DRKVLADRGIALFNQPLL 106

Query: 108 ATRELNDEQIKQLISIL--KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
             R +  +Q+ + + ++  + A   +LIHC  GADRTGL + +Y  I   +  E+A  ++
Sbjct: 107 TWR-ITPKQVAETLYLIEQQQAEGTVLIHCYHGADRTGLIAGMYRIIYQGWTVEQAKNEM 165

Query: 166 SML-YGHFPVLKTITMDITFEKITQL 190
               YG   + + I    T E + Q+
Sbjct: 166 RHGPYGFHSIWRNIEDLFTEENVRQV 191


>gi|70733565|ref|YP_257204.1| hypothetical protein PFL_0052 [Pseudomonas fluorescens Pf-5]
 gi|68347864|gb|AAY95470.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 223

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 69/126 (54%), Gaps = 12/126 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA P+   +  L+ +  + +++N    LPES    +    +  GI  +
Sbjct: 49  NLYQMSP-TLYRSALPDKGAVPLLQ-QLKVATVINF---LPES----DASWLSAPGINQV 99

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
             P   T  ++D  + + +  +++A    P+L+HCK G+DRTGL SA+Y  ++  + KEE
Sbjct: 100 QLPYR-TNHVDDADVLKALRAIQSAEAQGPVLMHCKHGSDRTGLMSAMYRVVIQGWSKEE 158

Query: 161 AHRQLS 166
           A  +++
Sbjct: 159 ALNEMT 164


>gi|193078301|gb|ABO13271.2| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           17978]
          Length = 192

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 78/151 (51%), Gaps = 21/151 (13%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
            + + T NF+ +  ++++RS QP+   I  LK  + I +++NLR K           A++
Sbjct: 35  ALVSQTHNFYQI-SNDVFRSEQPDAAMIPELK-HHQIGTVINLRAK-----------ASD 81

Query: 96  DL-----GIQLINFPLS--ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           DL        L++ P++  A    +  ++ Q I + K   + +L+HC  G+DRTG + A+
Sbjct: 82  DLVFKNENFNLVHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAM 141

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
           Y  I  ++  ++A +++    YG+  + K I
Sbjct: 142 YRIIFENWAIDDAVKEMKQGGYGYHIIWKNI 172


>gi|325578243|ref|ZP_08148378.1| protein tyrosine/serine phosphatase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159979|gb|EGC72108.1| protein tyrosine/serine phosphatase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 205

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 72/146 (49%), Gaps = 9/146 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           + ++ YRS Q      E L  +  I +I+NLR         ++++A     I LIN PL 
Sbjct: 54  IDNKFYRSEQLEAQ-SEALLNKLNIHTIVNLRFFD----RNDDKQAFGHTKINLINTPL- 107

Query: 108 ATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            T  ++ +++  ++  +K   K   +L+HC  GADRTGL  A Y  I  H+   EA R++
Sbjct: 108 LTWSISPDEVADILWQIKQHQKNGAVLVHCYHGADRTGLIVASYRVIYQHWDLNEAKREM 167

Query: 166 SML-YGHFPVLKTITMDITFEKITQL 190
               YG+  V K I    T E + ++
Sbjct: 168 QQGPYGYHSVWKNIDNFFTQENMAKI 193


>gi|126642889|ref|YP_001085873.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           17978]
          Length = 174

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 78/151 (51%), Gaps = 21/151 (13%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
            + + T NF+ +  ++++RS QP+   I  LK  + I +++NLR K           A++
Sbjct: 17  ALVSQTHNFYQI-SNDVFRSEQPDAAMIPELK-HHQIGTVINLRAK-----------ASD 63

Query: 96  DL-----GIQLINFPLS--ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           DL        L++ P++  A    +  ++ Q I + K   + +L+HC  G+DRTG + A+
Sbjct: 64  DLVFKNENFNLVHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAM 123

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
           Y  I  ++  ++A +++    YG+  + K I
Sbjct: 124 YRIIFENWAIDDAVKEMKQGGYGYHIIWKNI 154


>gi|288576374|ref|ZP_05978680.2| protein tyrosine/serine phosphatase [Neisseria mucosa ATCC 25996]
 gi|288565650|gb|EFC87210.1| protein tyrosine/serine phosphatase [Neisseria mucosa ATCC 25996]
          Length = 203

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 76/146 (52%), Gaps = 10/146 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  ++YRS QP     E + ++ GIKS++NLR      + + ++      GI +IN PL 
Sbjct: 47  IDDKLYRSEQPVPEDGETISQQ-GIKSVVNLR-----FFDRNDDDYLKQYGINIINRPL- 99

Query: 108 ATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            +  +  + I +++ +++   +   +LIHC  GADRTGL + +Y  +   +  EEA  ++
Sbjct: 100 LSWNVKPKDIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRILYQGWQIEEAKAEM 159

Query: 166 SML-YGHFPVLKTITMDITFEKITQL 190
               YG+  + K I    T  KI ++
Sbjct: 160 QHGPYGYHSIWKNIANLFTEAKIQEV 185


>gi|320103481|ref|YP_004179072.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319750763|gb|ADV62523.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 249

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 72/155 (46%), Gaps = 10/155 (6%)

Query: 18  ILLGVLVLCAVSLGLYFLTITTFTQN-----FHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
           +L GV V  A++    +    T   N     +  V P  +YRS Q +   +E   + YG+
Sbjct: 38  MLAGVTVALALAALAGWRIAATLPDNVDWDHWDVVKPGLLYRSGQLDPDQLEEAVRRYGL 97

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--P 130
           K+++NL  +LP      E + A  LG+     P+        +Q ++++ ++   PK  P
Sbjct: 98  KTVINL--QLPSPTLARERQVARRLGLNYAVLPMPGDGLGRPDQFRRVLDMIDD-PKSQP 154

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
           +L+HC  G  RTG A A+  Y    +  E+   +L
Sbjct: 155 VLVHCARGTCRTGSAVALMRYERDGWTLEDVEAEL 189


>gi|257459745|ref|ZP_05624854.1| protein tyrosine/serine phosphatase [Campylobacter gracilis RM3268]
 gi|257443170|gb|EEV18304.1| protein tyrosine/serine phosphatase [Campylobacter gracilis RM3268]
          Length = 228

 Score = 55.1 bits (131), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 10/132 (7%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+    +NF+ V    ++RSAQ +G++   L  E GIKSI+NLR      + +  +K A 
Sbjct: 73  TLIDEAKNFYRV-DELLFRSAQLDGSYAAKLH-ELGIKSIVNLR-----HFSRGGDKRAF 125

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIV 153
                L N PL  + E+   QI  ++  ++   K   +L+HC  GADRTGL  A+Y  I 
Sbjct: 126 GDQFWLANKPLQ-SWEIKPAQIADVLRTIRERQKEGAVLVHCYHGADRTGLVVAMYRVIY 184

Query: 154 AHYPKEEAHRQL 165
             +  + A  ++
Sbjct: 185 QGWSLDAARSEM 196


>gi|261381013|ref|ZP_05985586.1| protein tyrosine/serine phosphatase [Neisseria subflava NJ9703]
 gi|284796046|gb|EFC51393.1| protein tyrosine/serine phosphatase [Neisseria subflava NJ9703]
          Length = 196

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 77/146 (52%), Gaps = 10/146 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  ++YRS QP     E + K  GI+S++NLR      + + ++      G+ L+N PL 
Sbjct: 47  IDDKLYRSEQPVAEDGEAIVK-LGIQSVINLR-----FFDRNDDDHLKAHGLTLLNRPL- 99

Query: 108 ATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            +  +  ++I +++ +++   +   +LIHC  GADRTGL + +Y  I   +  ++A  ++
Sbjct: 100 LSWSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRIIYQGWSVDDAKAEM 159

Query: 166 SML-YGHFPVLKTITMDITFEKITQL 190
               YG+  + K I    T EK+ Q+
Sbjct: 160 QHGPYGYHSIWKNIAKLFTEEKVKQV 185


>gi|300176786|emb|CBK25355.2| unnamed protein product [Blastocystis hominis]
          Length = 264

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF AV+   +YRSA P      +LK   GI+SIL L   +PE + ++  K      I+L 
Sbjct: 27  NF-AVIEKGLYRSAFPVKRNFPFLK-HLGIRSILVL---VPEDYPEDSLKFMKRFDIKLF 81

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            FPL   +E    + +E + Q++ I L T   PLLIHC SG  RTG
Sbjct: 82  KFPLEGNKEPFTEIPEEMVIQIMHIVLDTRNLPLLIHCNSGKHRTG 127


>gi|146307496|ref|YP_001187961.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina ymp]
 gi|145575697|gb|ABP85229.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina ymp]
          Length = 226

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 64/120 (53%), Gaps = 10/120 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P ++YRSA P+   +  L+   GI +++N   +  E W K+         +  +
Sbjct: 56  NLYRMTP-DLYRSALPSAGDLPQLQA-LGIATVINFYQRGDEQWLKDPR-------VVQV 106

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKP-LLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + PL   R  + + I+ L SI +   +  +LIHCK G +RTGL +A+Y  I  ++ KE+A
Sbjct: 107 HLPLRTDRIDDADVIEVLRSIRQAQSRGRVLIHCKHGQNRTGLIAAMYRVIYQNWSKEQA 166


>gi|168701753|ref|ZP_02734030.1| protein tyrosine/serine phosphatase [Gemmata obscuriglobus UQM
           2246]
          Length = 191

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 64/137 (46%), Gaps = 14/137 (10%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP 83
            L A+++ L         +NF  V P  +YRS Q   +  E L  ++GIK++++LR    
Sbjct: 11  ALVAIAVLLSGSGCDRGPRNFGVVEPGVLYRSGQLTPSAFERLLTDHGIKTVVSLRPLRD 70

Query: 84  ESWHKE--EEKAANDLGIQLINFPLSATRELNDEQ--------IKQLISILKT-APKPLL 132
           E+   +  EE      GI+ +  P    RE   E          ++ ++++   A  P+ 
Sbjct: 71  EAEKSDAHEETICQSRGIKFVRIP---PRETGAEPGGSPLEPVAREFLAVMADPANHPVY 127

Query: 133 IHCKSGADRTGLASAVY 149
           +HC +G DRTG   AVY
Sbjct: 128 VHCTAGRDRTGTVCAVY 144


>gi|77456315|ref|YP_345820.1| protein tyrosine/serine phosphatase [Pseudomonas fluorescens Pf0-1]
 gi|77380318|gb|ABA71831.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 214

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 64/127 (50%), Gaps = 15/127 (11%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +YRSA P+   +  L     + +++N   +   +W K         GI  +  P   T  
Sbjct: 53  LYRSALPDDGAVPLLNN-LKVVTVINFLPEADSNWLKAP-------GIHQVQLPYR-TNH 103

Query: 112 LNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-- 167
           ++D  + + +  +++A    P+L+HCK G+DRTGL +A+Y  +V  + KE+A  +++   
Sbjct: 104 VDDSDVLKTLRAIQSAEAEGPVLMHCKHGSDRTGLMAAMYRIVVQGWSKEDALNEMTQGG 163

Query: 168 --LYGHF 172
               GHF
Sbjct: 164 FGESGHF 170


>gi|327188528|gb|EGE55739.1| protein tyrosine/serine phosphatase [Rhizobium etli CNPAF512]
          Length = 191

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 89/175 (50%), Gaps = 29/175 (16%)

Query: 24  VLCAVSLGLYF-LTITTFTQ----------------NFHAVVPHEIYRSAQPNGTFIEYL 66
           +  A++LGL F LT   F +                N + + P   +RSAQ     ++ +
Sbjct: 9   LFAALTLGLLFPLTTAGFAKETVRNGDWAMSVVPSVNLYRITP-TFFRSAQIRKDDVKAI 67

Query: 67  KKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           +   GIK+I++LR     ++H +      +  I+L+  P++ T  + DE I   +  +++
Sbjct: 68  RL-LGIKTIVSLR-----AFHSDRNLPGLER-IKLVGVPMN-TWHIEDEDIIAALRAIRS 119

Query: 127 APK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLKTI 178
           A K  P+L+HC+ G+DRTG+ +A+Y  +   + +++A  +L S  +G+  +   I
Sbjct: 120 AEKHGPVLLHCQHGSDRTGVVTAMYRVVFQKWSRKKALDELQSGGFGYHAIWTNI 174


>gi|328857605|gb|EGG06721.1| hypothetical protein MELLADRAFT_77769 [Melampsora larici-populina
           98AG31]
          Length = 329

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  IYRS+ PN    E+LK   G+KS+L L   + E +  E  K  N  GI+ +
Sbjct: 167 NFGLVAP-GIYRSSFPNHLHFEFLKT-LGLKSVLTL---VQEKYSPECLKFYNQEGIKFM 221

Query: 103 NFPLSATRE----LNDEQIK-QLISILKTAPKPLLIHCKSGADRTG 143
            F +   +E    + +E+++  LI +L     P+LIHC  G  RTG
Sbjct: 222 QFSIPGNKEPFVHIPEEKVRLALIHVLDVRNHPMLIHCNKGKHRTG 267


>gi|254521540|ref|ZP_05133595.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
 gi|219719131|gb|EED37656.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
          Length = 166

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 57/105 (54%), Gaps = 6/105 (5%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +Y   QP+GT +  L  + G++++++LR +  E    +E   A  LG++ +  P++    
Sbjct: 33  LYAGGQPSGTQLRALAAQ-GVRTVIDLR-QPDEDRGFDEAGVAESLGLRYVRIPVAGADG 90

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           L+   ++ +   L+ +  P+L+HC SG +R G   AV   + AHY
Sbjct: 91  LDAANLRAVHQALQQSAGPVLLHCASG-NRAG---AVLGLVTAHY 131


>gi|262371459|ref|ZP_06064775.1| protein tyrosine/serine phosphatase [Acinetobacter johnsonii SH046]
 gi|262313598|gb|EEY94649.1| protein tyrosine/serine phosphatase [Acinetobacter johnsonii SH046]
          Length = 191

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 74/140 (52%), Gaps = 13/140 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF+ +    ++RS QP+   ++ LK +  I  I+NLR +       ++ K  ++ G +L+
Sbjct: 41  NFYQI-SETVFRSEQPDQNLVQSLKAQ-KIDVIINLRSR------NQDLKKLSNQGFELV 92

Query: 103 NFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           + P+  T  ++ E   ++ Q I + +   + +L+HC  G+DRTG + A+Y  I  ++   
Sbjct: 93  HIPIH-TWAIDREDLLKVMQQIQLAEQNQQKVLLHCYHGSDRTGASVAMYRIIFQNWSTT 151

Query: 160 EAHRQLSM-LYGHFPVLKTI 178
           +A  ++    YG  P+ + I
Sbjct: 152 DALAEMKHGGYGFHPIWQNI 171


>gi|168704910|ref|ZP_02737187.1| hypothetical protein GobsU_35559 [Gemmata obscuriglobus UQM 2246]
          Length = 222

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 76/172 (44%), Gaps = 17/172 (9%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           +N L + +  ++  LVL A  + LY        + F  V P  +YRS Q           
Sbjct: 2   RNGLRWVLGCVVAALVLGA-PVALYRAQYIQ-AKRFREVEPGRLYRSGQMTAAGFREAVD 59

Query: 69  EYGIKSILNLRGK-----LPESWHKEEEKAANDLGIQL-INF--------PLSATRELND 114
            YGIK+++NL+ +     LP+ W  + +   ++L  QL + +        P     +   
Sbjct: 60  RYGIKTVVNLQHEEPDPLLPDHWLGKGQVRESELCAQLGVRYRLLTPDILPPGNQLDWEP 119

Query: 115 EQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
             +KQ   +L      P+L+HCK+G  RTG  +A+Y      +   EA R+L
Sbjct: 120 PAVKQWRDLLDDESNYPVLLHCKAGLHRTGRLTAIYRMEYRGWSPGEALREL 171


>gi|110833348|ref|YP_692207.1| hypothetical protein ABO_0487 [Alcanivorax borkumensis SK2]
 gi|110646459|emb|CAL15935.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 179

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 71/166 (42%), Gaps = 17/166 (10%)

Query: 12  LIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYG 71
           ++ YI I++ VL        L          +F  V   ++YRS       I  + +  G
Sbjct: 1   MLLYIAIVISVL-------ALVIYRYRKLMYHFRVVERRKLYRSGTLGPIGIRIMHRILG 53

Query: 72  IKSILNLRGKLPES---WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           + +I+NLR +   S   W+ ++       G++L+N P++      + QI   I  L  A 
Sbjct: 54  VNTIVNLRLESEYSKNGWYFKQLDYCRRHGVKLVNIPMAQDTPPTEAQIVAFIEELGRAD 113

Query: 129 KPLLIHCKSGADRTGL---ASAVYLYIVAHYPKEEAHRQLSMLYGH 171
              L+HC+ G  RTG+   A A   Y V     E A  Q   LYGH
Sbjct: 114 SRCLVHCEMGVIRTGMMVVAVATRCYGVT----EMAVWQHFPLYGH 155


>gi|330503207|ref|YP_004380076.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina NK-01]
 gi|328917493|gb|AEB58324.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina NK-01]
          Length = 232

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 10/120 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P ++YRSA P       L+   GI +++N        + + +E+   D  +  +
Sbjct: 62  NLYRMTP-DLYRSALPAARDWPQLQA-LGIATVINF-------YQRGDEQWLGDPRVHQV 112

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + PL   R  + + I+ L SI +   +  +LIHCK G +RTGL +A+Y  I  ++ KE+A
Sbjct: 113 HLPLRTDRIDDTDVIEVLRSIRQAQSRGTVLIHCKHGQNRTGLIAALYRVIYQNWSKEQA 172


>gi|189196232|ref|XP_001934454.1| tyrosine-protein phosphatase SIW14 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187980333|gb|EDU46959.1| tyrosine-protein phosphatase SIW14 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 279

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AV+P  +YRS  P      +LK E GIK+IL L   +PE      +    + GIQ  
Sbjct: 97  NYGAVIPGCVYRSGYPKEENFGFLK-ELGIKTILTL---VPEPISPAYQNFMKEAGIQHF 152

Query: 103 NFPLSAT----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP- 157
           +  + A     R  + E  + L  I+  A  P+L+HC  G  RTG   A +  ++   P 
Sbjct: 153 HAHIRANKGEVRVESCEMSRALRLIMDRANHPILVHCNKGKHRTGCTIACFRRVLGVDPE 212

Query: 158 --KEEAH 162
             +EE H
Sbjct: 213 TVREEYH 219


>gi|37181630|gb|AAQ88624.1| LKHP9428 [Homo sapiens]
          Length = 218

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 66/127 (51%), Gaps = 12/127 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P  +YRS  P+   +  L+K   + +++N    LPES    ++    D  I+ +
Sbjct: 46  NLHQMTP-TLYRSGLPDSRALPLLEK-LNVGTVINF---LPES----DDSWLADSDIKQV 96

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
                 T  ++D  +   +  ++ A     +L+HCK G+DRTGL +A+Y  ++  + KE+
Sbjct: 97  QLTYR-TNHVDDSDVLAALRAIRQAEANGSVLMHCKHGSDRTGLMAAMYRVVIQGWSKED 155

Query: 161 AHRQLSM 167
           A  ++++
Sbjct: 156 ALNEMTL 162


>gi|301156145|emb|CBW15616.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 205

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 79/161 (49%), Gaps = 10/161 (6%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
           ++ T+ +  +N + +   + YRS Q      E L  +  I +I+NLR         ++++
Sbjct: 40  HWATLISEQENLYQI-DDKFYRSEQLEAQ-SEALLNKLNIHTIVNLRFFD----RNDDKQ 93

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYL 150
           A     I LIN PL  T  ++ +++  ++  +K   K   +L+HC  GADRTGL  A Y 
Sbjct: 94  AFGHTKINLINTPL-LTWSISPDEVADILWQIKQHQKNGAVLVHCYHGADRTGLIVASYR 152

Query: 151 YIVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQL 190
            I  ++   EA R++    YG+  V K I    T E + ++
Sbjct: 153 VIYQNWDLNEAKREMQQGPYGYHSVWKNIDNFFTQENMAKI 193


>gi|66808551|ref|XP_637998.1| hypothetical protein DDB_G0285909 [Dictyostelium discoideum AX4]
 gi|60466434|gb|EAL64489.1| hypothetical protein DDB_G0285909 [Dictyostelium discoideum AX4]
          Length = 181

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
           ++V   +YRS  PN     +LKK  G+KSIL L    PE + +         GI+L+++ 
Sbjct: 26  SMVSRGVYRSGYPNKKNHPFLKK-LGLKSILYL---CPEEYSESNTNFIRKHGIKLLHYR 81

Query: 106 LSATRE----LNDEQIKQ-LISILKTAPKPLLIHCKSGADRTG--------LASAVYLYI 152
           +   +E    + DE I+  L+ +L     P+LIHC  G  RTG        L    Y YI
Sbjct: 82  IVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCLVGCLRKLQKWSYTYI 141

Query: 153 VAHY 156
              Y
Sbjct: 142 FDEY 145


>gi|152989083|ref|YP_001346608.1| hypothetical protein PSPA7_1223 [Pseudomonas aeruginosa PA7]
 gi|150964241|gb|ABR86266.1| hypothetical protein PSPA7_1223 [Pseudomonas aeruginosa PA7]
          Length = 218

 Score = 52.0 bits (123), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 68/115 (59%), Gaps = 17/115 (14%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG---IQLINFPLSA 108
           +YRSA PN   +  L++   +K+++        S+ K++++A   LG   I++++ P  A
Sbjct: 56  LYRSALPNAQSVALLER-LQVKTVV--------SFIKDDDRAW--LGQAPIRIVSLPTHA 104

Query: 109 TRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 105 DR-VDDTEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158


>gi|194364100|ref|YP_002026710.1| hypothetical protein Smal_0322 [Stenotrophomonas maltophilia
           R551-3]
 gi|194346904|gb|ACF50027.1| protein of unknown function DUF442 [Stenotrophomonas maltophilia
           R551-3]
          Length = 166

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +Y   QP+ T ++ L  + G++++++LR +  E    +E + A  LG++ +  P++    
Sbjct: 33  LYAGGQPSATQLQALAAQ-GVRTVIDLR-QPDEDRGFDETRVAESLGLRYVRIPVAGADG 90

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
           L+   I+ +   L+ +  P+L+HC SG +R G   AV   I A Y  E A  + ++  G 
Sbjct: 91  LDAANIRAVHQALQQSQGPVLLHCASG-NRAG---AVLGLINARY--EHASPEQALQLGQ 144

Query: 172 FPVLKTI 178
              LK++
Sbjct: 145 RAGLKSL 151


>gi|213962566|ref|ZP_03390828.1| protein tyrosine/serine phosphatase [Capnocytophaga sputigena
           Capno]
 gi|213954892|gb|EEB66212.1| protein tyrosine/serine phosphatase [Capnocytophaga sputigena
           Capno]
          Length = 182

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 8/130 (6%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +YRS Q   T  + + K   IKSI+NLR     S  K+   A+++  I+LIN PL   R 
Sbjct: 39  LYRSEQL-VTEDKAIIKNIPIKSIVNLR-YFTRSGDKKIFNASDN--IKLINHPLLTWR- 93

Query: 112 LNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ-LSML 168
           +   +I Q + I++   K   +LIHC  GADRTG+  A+Y  I  ++  E+A ++ L+  
Sbjct: 94  IKAPEIAQTLKIIREHQKQGAVLIHCYHGADRTGIMVAMYRIIYHNWTIEQAKKEMLNGP 153

Query: 169 YGHFPVLKTI 178
           YG+  V K +
Sbjct: 154 YGYHSVWKNL 163


>gi|281204785|gb|EFA78980.1| putative protein tyrosine phosphatase [Polysphondylium pallidum
           PN500]
          Length = 178

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 60/127 (47%), Gaps = 18/127 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   +YRS  PN     +LKK  G+KSIL L    PE + +         GI+L+
Sbjct: 23  NF-SMVSRGVYRSGYPNKKNHPFLKK-LGLKSILYL---CPEEYSESNTNFIRKHGIKLL 77

Query: 103 NFPLSATRE----LNDEQIKQ-LISILKTAPKPLLIHCKSGADRTG--------LASAVY 149
           ++ +   +E    + DE I+  L+ +L     P+LIHC  G  RTG        L    Y
Sbjct: 78  HYRIVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCLVGCLRKLQKWSY 137

Query: 150 LYIVAHY 156
            YI   Y
Sbjct: 138 TYIFDEY 144


>gi|45187669|ref|NP_983892.1| ADL204Wp [Ashbya gossypii ATCC 10895]
 gi|44982430|gb|AAS51716.1| ADL204Wp [Ashbya gossypii ATCC 10895]
          Length = 217

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 52/107 (48%), Gaps = 9/107 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV  EIYRS+ P      +L++   ++SIL L   +PE +  E ++     GIQL
Sbjct: 56  ENFSPVV-GEIYRSSFPRPENFAFLQERVRLRSILVL---IPEEYPPENQEFVERAGIQL 111

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
               +S  +E       D   + L   L  A  P+LIHC  G  RTG
Sbjct: 112 FQVGMSGNKEPFVNIPRDVLTRALAIALDPANHPILIHCNRGKHRTG 158


>gi|312212051|emb|CBX92135.1| similar to tyrosine-protein phosphatase SIW14 [Leptosphaeria
           maculans]
          Length = 273

 Score = 51.6 bits (122), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 55/111 (49%), Gaps = 8/111 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N+ AVVP  IYRS+ P     E+LK +  IKSI+ L   +PE    E +    + GIQ 
Sbjct: 91  SNYGAVVPGMIYRSSYPEEKNYEFLK-DLKIKSIITL---VPEPLSPEYKDFMEEAGIQH 146

Query: 102 INFPLSATR-ELNDEQI---KQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            +  + A + E+  E     + L  I+     P+LIHC  G  RTG   AV
Sbjct: 147 FHVHIRANKGEVRVESCDMSRALRLIMDRTNHPILIHCNKGKHRTGCTVAV 197


>gi|49078204|gb|AAT49761.1| PA3885 [synthetic construct]
          Length = 219

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 73/126 (57%), Gaps = 19/126 (15%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG---IQLINFPLSA 108
           +YRSA PN   +  L++   +K+++        S+ K++++A   LG   +++++ P  A
Sbjct: 56  LYRSALPNAQSVALLQR-LQVKTVV--------SFIKDDDRAW--LGQAPVRVLSLPTHA 104

Query: 109 TRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
            R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y  +V  + K+ A  +  
Sbjct: 105 DR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAALEE-- 161

Query: 167 MLYGHF 172
           M +G F
Sbjct: 162 MQHGGF 167


>gi|15599080|ref|NP_252574.1| protein tyrosine phosphatase TpbA [Pseudomonas aeruginosa PAO1]
 gi|107103400|ref|ZP_01367318.1| hypothetical protein PaerPA_01004470 [Pseudomonas aeruginosa PACS2]
 gi|254236783|ref|ZP_04930106.1| hypothetical protein PACG_02796 [Pseudomonas aeruginosa C3719]
 gi|9950065|gb|AAG07272.1|AE004805_10 protein tyrosine phosphatase TpbA [Pseudomonas aeruginosa PAO1]
 gi|126168714|gb|EAZ54225.1| hypothetical protein PACG_02796 [Pseudomonas aeruginosa C3719]
          Length = 218

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 73/126 (57%), Gaps = 19/126 (15%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG---IQLINFPLSA 108
           +YRSA PN   +  L++   +K+++        S+ K++++A   LG   +++++ P  A
Sbjct: 56  LYRSALPNAQSVALLQR-LQVKTVV--------SFIKDDDRAW--LGQAPVRVLSLPTHA 104

Query: 109 TRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
            R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y  +V  + K+ A  +  
Sbjct: 105 DR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAALEE-- 161

Query: 167 MLYGHF 172
           M +G F
Sbjct: 162 MQHGGF 167


>gi|328871698|gb|EGG20068.1| putative protein tyrosine phosphatase [Dictyostelium fasciculatum]
          Length = 313

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 61/129 (47%), Gaps = 18/129 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   +YRS  PN     +LKK  G+KSIL L    PE + +         GI+L+
Sbjct: 158 NF-SMVSSGVYRSGYPNKKNHPFLKK-LGLKSILYL---CPEEYSESNTNFIRKNGIKLL 212

Query: 103 NFPLSATRE----LNDEQIKQ-LISILKTAPKPLLIHCKSGADRTG--------LASAVY 149
           ++ +   +E    + DE I+  L+ +L     P+LIHC  G  RTG        L    Y
Sbjct: 213 HYRIVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCVVGCLRKLQKWSY 272

Query: 150 LYIVAHYPK 158
            YI   Y +
Sbjct: 273 TYIFDEYRR 281


>gi|313109305|ref|ZP_07795272.1| putative protein phosphatase [Pseudomonas aeruginosa 39016]
 gi|310881774|gb|EFQ40368.1| putative protein phosphatase [Pseudomonas aeruginosa 39016]
          Length = 218

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 68/115 (59%), Gaps = 17/115 (14%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG---IQLINFPLSA 108
           +YRSA PN   +  L++   +K+++        S+ K++++A   LG   +++++ P  A
Sbjct: 56  LYRSALPNAQSVALLQR-LQVKTVV--------SFIKDDDRAW--LGQAPVRVVSLPTHA 104

Query: 109 TRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 105 DR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158


>gi|169603942|ref|XP_001795392.1| hypothetical protein SNOG_04979 [Phaeosphaeria nodorum SN15]
 gi|111066250|gb|EAT87370.1| hypothetical protein SNOG_04979 [Phaeosphaeria nodorum SN15]
          Length = 278

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 55/116 (47%), Gaps = 8/116 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AV+P  IYRS+ P     E++K +  IKSIL L   +PE    E +   +  GIQ  
Sbjct: 97  NYGAVLPGLIYRSSYPEQKNYEFIK-DLKIKSILTL---VPEPISAEYQDFMDKSGIQHF 152

Query: 103 NFPLSAT----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
              + A     R  + E  + L  I+     P+LIHC  G  RTG   A +  I+ 
Sbjct: 153 QVHIKANKGEVRVESCEMSRALRLIMDRTNHPILIHCNKGKHRTGCTVACFRRIIG 208


>gi|116051921|ref|YP_789236.1| hypothetical protein PA14_13660 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296387597|ref|ZP_06877072.1| hypothetical protein PaerPAb_05562 [Pseudomonas aeruginosa PAb1]
 gi|115587142|gb|ABJ13157.1| putative protein phosphatase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 218

 Score = 51.2 bits (121), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 68/115 (59%), Gaps = 17/115 (14%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG---IQLINFPLSA 108
           +YRSA PN   +  L++   +K+++        S+ K++++A   LG   +++++ P  A
Sbjct: 56  LYRSALPNAQSVALLQR-LQVKTVV--------SFIKDDDRAW--LGQAPVRVVSLPTHA 104

Query: 109 TRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 105 DR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158


>gi|238023257|ref|ZP_04603683.1| hypothetical protein GCWU000324_03184 [Kingella oralis ATCC 51147]
 gi|237865640|gb|EEP66780.1| hypothetical protein GCWU000324_03184 [Kingella oralis ATCC 51147]
          Length = 164

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 74/151 (49%), Gaps = 18/151 (11%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINFP 105
           V  ++YRS Q N   +  ++ + GI+S++NLR  G+     HK ++  A    I LIN P
Sbjct: 13  VDSKLYRSEQLNRDDLATIR-QLGIRSVVNLRYFGR-----HKNQKIFAGHPDIALINRP 66

Query: 106 LSATRELNDEQIKQLISILKTAPK-----PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           L   R     Q + +  +L+T  +      +L+HC  GADRTG   A+Y  +    P  +
Sbjct: 67  LLTWRV----QPRDIARVLRTIEQQQQQGAVLVHCYHGADRTGTIVAMYRIVYHGLPIAD 122

Query: 161 AHRQLSM-LYGHFPVLKTITMDITFEKITQL 190
           A  ++    +G+  + + +    T E + Q+
Sbjct: 123 ALAEMKHERFGYHSIWRNLERLFTEENVAQV 153


>gi|218889835|ref|YP_002438699.1| putative protein phosphatase [Pseudomonas aeruginosa LESB58]
 gi|218770058|emb|CAW25820.1| putative protein phosphatase [Pseudomonas aeruginosa LESB58]
          Length = 218

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 73/126 (57%), Gaps = 19/126 (15%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG---IQLINFPLSA 108
           +YRSA PN   +  L++   +K+++        S+ K++++A   LG   +++++ P  A
Sbjct: 56  LYRSALPNAQNVALLQR-LQVKTVV--------SFIKDDDRAW--LGQAPVRVLSLPTHA 104

Query: 109 TRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
            R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y  +V  + K+ A  +  
Sbjct: 105 DR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAALEE-- 161

Query: 167 MLYGHF 172
           M +G F
Sbjct: 162 MQHGGF 167


>gi|50308667|ref|XP_454336.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49643471|emb|CAG99423.1| KLLA0E08581p [Kluyveromyces lactis]
          Length = 274

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 52/107 (48%), Gaps = 9/107 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  V   EIYRS+ P     E+L+    +KSIL L   +PE +  E  K   + GI+L
Sbjct: 113 ENFSHVC-GEIYRSSFPRPENFEFLRDRLKLKSILVL---IPEEYPAENMKFMEETGIKL 168

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
               +S  +E      +D   K L  +L     P+LIHC  G  RTG
Sbjct: 169 FQVGMSGNKEPFVNIPSDLLTKALEVVLNPENHPILIHCNRGKHRTG 215


>gi|225076125|ref|ZP_03719324.1| hypothetical protein NEIFLAOT_01157 [Neisseria flavescens
           NRL30031/H210]
 gi|224952544|gb|EEG33753.1| hypothetical protein NEIFLAOT_01157 [Neisseria flavescens
           NRL30031/H210]
          Length = 110

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 4/96 (4%)

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAH 155
           G+ L+N PL  +  +  ++I +++ +++   +   +LIHC  GADRTGL + +Y  I   
Sbjct: 5   GLTLLNRPL-LSWSIKPKEITEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRIIYQG 63

Query: 156 YPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQL 190
           +P EEA  ++    YG+  + K I    T EK+ Q+
Sbjct: 64  WPVEEAKAEMQHGPYGYHSIWKNIANLFTEEKVKQV 99


>gi|18412419|ref|NP_567261.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|17981661|gb|AAL51114.1|AF458342_1 AT4g03960/T24M8_4 [Arabidopsis thaliana]
 gi|15810022|gb|AAL06938.1| AT4g03960/T24M8_4 [Arabidopsis thaliana]
 gi|21555065|gb|AAM63767.1| contains similarity to C3HC4-type zinc fingers [Arabidopsis
           thaliana]
 gi|26452426|dbj|BAC43298.1| unknown protein [Arabidopsis thaliana]
 gi|332656961|gb|AEE82361.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
          Length = 198

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P      +L+    +KSI+ L    PE++ +   + A   GIQ+ 
Sbjct: 34  NF-AMVDNGIFRSGFPEPVSFSFLQS-LRLKSIIYL---CPEAYPEVNREFAKSNGIQVF 88

Query: 103 NFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGL 144
            F +   +E    + DE I++ + +L  T   P+LIHCKSG  RTG 
Sbjct: 89  QFGIERCKEPFVNIPDEVIREALQVLLDTENHPVLIHCKSGKHRTGC 135


>gi|254242576|ref|ZP_04935898.1| hypothetical protein PA2G_03330 [Pseudomonas aeruginosa 2192]
 gi|126195954|gb|EAZ60017.1| hypothetical protein PA2G_03330 [Pseudomonas aeruginosa 2192]
          Length = 218

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 73/126 (57%), Gaps = 19/126 (15%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG---IQLINFPLSA 108
           +YRSA PN   +  L++   +++++        S+ K++++A   LG   +++++ P  A
Sbjct: 56  LYRSALPNAQSVALLQR-LQVRTVV--------SFIKDDDRAW--LGQAPVRVLSLPTHA 104

Query: 109 TRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
            R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y  +V  + K+ A  +  
Sbjct: 105 DR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAALEE-- 161

Query: 167 MLYGHF 172
           M +G F
Sbjct: 162 MQHGGF 167


>gi|328771796|gb|EGF81835.1| hypothetical protein BATDEDRAFT_34606 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 263

 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF+ V P  IYRSA P      +LKK  G++SIL L   + E +  +  K  +D  I L
Sbjct: 98  ENFNLVAP-GIYRSAFPKKRNFSFLKK-LGLRSILTL---ILEDYPDQNRKFLDDNNIHL 152

Query: 102 INFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTG 143
             F ++  +E    + +E +   +S I+     PLLIHC  G  RTG
Sbjct: 153 FQFGVAGNKEPFVDIPEETVCAALSVIMDERNHPLLIHCNKGKHRTG 199


>gi|115478090|ref|NP_001062640.1| Os09g0135700 [Oryza sativa Japonica Group]
 gi|47848431|dbj|BAD22288.1| putative tyrosine specific protein phosphatase protein [Oryza
           sativa Japonica Group]
 gi|113630873|dbj|BAF24554.1| Os09g0135700 [Oryza sativa Japonica Group]
 gi|215768452|dbj|BAH00681.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218201709|gb|EEC84136.1| hypothetical protein OsI_30482 [Oryza sativa Indica Group]
 gi|222641097|gb|EEE69229.1| hypothetical protein OsJ_28466 [Oryza sativa Japonica Group]
          Length = 222

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 16/109 (14%)

Query: 43  NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           NF A+V H +YRS  P   N  F+E L+    ++S+L L    PE + +  ++     GI
Sbjct: 68  NF-AMVDHGVYRSGFPDISNLPFVESLR----LRSVLCL---CPEPYPEANQEFLRAHGI 119

Query: 100 QLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
           +L  F +  ++E    + +++I++ + + L  A  P+LIHCK G  RTG
Sbjct: 120 RLFQFGIDGSKEPFVNIPEDRIREALKVVLDVANHPVLIHCKRGKHRTG 168


>gi|255319421|ref|ZP_05360637.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SK82]
 gi|262380885|ref|ZP_06074036.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SH164]
 gi|255303557|gb|EET82758.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SK82]
 gi|262297520|gb|EEY85438.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SH164]
          Length = 134

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK 125
           L K+  IK+++NLR       H  +        IQ+I+ P+  T  +N E +  ++  LK
Sbjct: 3   LLKQKNIKTVINLRT------HDRDSSILEGENIQVIHLPIR-TWAMNREHLLGIMQYLK 55

Query: 126 TAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
            A    + +LIHC  G+DRTG + A+Y  +  ++  E+A  ++    YG+  + K I   
Sbjct: 56  QAQHSGQKVLIHCYHGSDRTGASIAMYRIVFENWSTEQALLEMKHGGYGYHVIWKNIERL 115

Query: 182 ITFEKI 187
            + E I
Sbjct: 116 FSTENI 121


>gi|332880031|ref|ZP_08447715.1| hypothetical protein HMPREF9074_03481 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332682027|gb|EGJ54940.1| hypothetical protein HMPREF9074_03481 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 183

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 72  IKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK-- 129
           IKSI+NLR         + +  A   G++LIN PL   R +   +I Q + +++   +  
Sbjct: 59  IKSIINLRYFTRSG---DRKLFAPSEGVKLINHPLLTWR-IKAPEIAQTLKLIRQHQQEG 114

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYP-KEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
            +L+HC  GADRTG+  A+Y  I  ++  K+  H  L+  YG+  V K +    T + + 
Sbjct: 115 AVLLHCYHGADRTGIMVAMYRIIYQNWSIKDAKHEMLNGPYGYHSVWKNLEALFTEQTVA 174

Query: 189 QL 190
           ++
Sbjct: 175 EV 176


>gi|255321883|ref|ZP_05363033.1| protein tyrosine/serine phosphatase [Campylobacter showae RM3277]
 gi|255300987|gb|EET80254.1| protein tyrosine/serine phosphatase [Campylobacter showae RM3277]
          Length = 228

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (50%), Gaps = 10/132 (7%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+    +NF+ V    ++RSAQ +G+    L  E GIKSI+NLR      + +  ++ A 
Sbjct: 73  TLIDEAKNFYRV-DELLFRSAQLDGSDAAKLH-ELGIKSIVNLR-----HFSRGGDRRAF 125

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIV 153
                L + PL +  E+   QI  ++  ++   K   +L+HC  GADRTGL  A+Y  I 
Sbjct: 126 GDQFWLASKPLQSW-EIKPAQIADVLRTIRERQKEGAVLVHCYHGADRTGLVVAMYRVIY 184

Query: 154 AHYPKEEAHRQL 165
             +  + A  ++
Sbjct: 185 QGWSLDAARSEM 196


>gi|75909256|ref|YP_323552.1| hypothetical protein Ava_3047 [Anabaena variabilis ATCC 29413]
 gi|75702981|gb|ABA22657.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 127

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           E G KS+LNLR          E++    LG++ INFP+    E+N+    Q++  +   P
Sbjct: 27  EDGYKSVLNLRSPDERGLLDNEQEKLEFLGLRYINFPMKF-EEINNRTTLQILQTINELP 85

Query: 129 KPLLIHCKSGADRTGLA 145
           KPLLIHC +    + LA
Sbjct: 86  KPLLIHCDNSIRSSVLA 102


>gi|168699665|ref|ZP_02731942.1| hypothetical protein GobsU_09089 [Gemmata obscuriglobus UQM 2246]
          Length = 194

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 81/174 (46%), Gaps = 12/174 (6%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           ++ L F + +    LV+ A  +  Y     T  +NF  V    +YRS Q     ++ + +
Sbjct: 2   RDRLRFVLSLTAAALVIAAPLV--YSANENTHRRNFRVVEEGVLYRSGQLTPAGLDSVVR 59

Query: 69  EYGIKSILNLRGKL-----PESWHKE--EEKAANDLGIQLINFPLSATRELNDEQ-IKQL 120
           ++ I+++++LR        P+SW +     K  N + I    +      E+  EQ +++ 
Sbjct: 60  DHSIRTVVSLRTSRTAAPPPDSWEEGVCAAKGLNHVRIVPRVWGADEKGEIPAEQAVQEF 119

Query: 121 ISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFP 173
           ++++ K    P+L+HC +G  RTG   A++      +  E A  ++  LYG  P
Sbjct: 120 LTVMEKKENHPVLVHCFAGIHRTGTMCAIFRMEHHRWTAERAMTEMQ-LYGFAP 172


>gi|297809583|ref|XP_002872675.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297318512|gb|EFH48934.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 198

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P      +L+    ++SI+ L    PE++ +   + A   GIQ+ 
Sbjct: 34  NF-AMVDNGIFRSGFPEPVSFSFLQS-LRLRSIIYL---CPEAYPEVNREFAKSNGIQVF 88

Query: 103 NFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGL 144
            F +   +E    + DE I++ + +L  T   P+LIHCKSG  RTG 
Sbjct: 89  QFGIERCKEPFVNIPDEVIREALQVLLDTKNHPVLIHCKSGKHRTGC 135


>gi|256378935|ref|YP_003102595.1| protein tyrosine/serine phosphatase [Actinosynnema mirum DSM 43827]
 gi|255923238|gb|ACU38749.1| protein tyrosine/serine phosphatase [Actinosynnema mirum DSM 43827]
          Length = 345

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
             ++DLG Q + +P        D   +  ++ + TAP P+++HC +G DRTG A+AV L 
Sbjct: 218 SGSSDLG-QSVGYPFMVNFVGADRAFRDFLTAVATAPGPVVVHCSAGKDRTGWATAVLLT 276

Query: 152 IVAHYPKE 159
           ++   P E
Sbjct: 277 LLG-VPSE 283


>gi|330945302|ref|XP_003306532.1| hypothetical protein PTT_19698 [Pyrenophora teres f. teres 0-1]
 gi|311315927|gb|EFQ85376.1| hypothetical protein PTT_19698 [Pyrenophora teres f. teres 0-1]
          Length = 279

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 59/127 (46%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AV+P  +YRS  P      +LK E GIK+IL L   +PE      +    + GIQ  
Sbjct: 97  NYGAVLPGCVYRSGYPKEENFGFLK-ELGIKTILTL---VPEPISPAYQTFMKEAGIQHF 152

Query: 103 NFPLSAT----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY---LYIVAH 155
           +  + A     R  + E  + L  I+     P+L+HC  G  RTG   A +   L + A 
Sbjct: 153 HAHIRANKGEVRIESCEMSRALRLIMDRTNHPILVHCNKGKHRTGCTIACFRRVLGVDAE 212

Query: 156 YPKEEAH 162
             +EE H
Sbjct: 213 TVREEYH 219


>gi|212274893|ref|NP_001130476.1| hypothetical protein LOC100191574 [Zea mays]
 gi|194689234|gb|ACF78701.1| unknown [Zea mays]
          Length = 235

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 16/115 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGT---FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           NF A+V H +YRS  P+ +   F+E L+    ++S+L L    PE + +   +     GI
Sbjct: 81  NF-AMVDHGVYRSGFPDASNLPFLETLR----LRSVLCL---CPEPYPEANLEFLRAHGI 132

Query: 100 QLINFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVY 149
           +L  F +  ++E    + +++I++ +  IL  +  P+LIHCK G  RTG     +
Sbjct: 133 KLFQFGIDGSKEPFVNIPEDRIREALEVILDASNHPVLIHCKRGKHRTGCVVGCF 187


>gi|195628302|gb|ACG35981.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 235

 Score = 49.3 bits (116), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 60/112 (53%), Gaps = 10/112 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V H +YRS  P+ + + +L+    ++S+L L    PE + +   +     GI+L 
Sbjct: 81  NF-AMVDHGVYRSGFPDASNLPFLET-LRLRSVLCL---CPEPYPEANLEFLRAHGIKLF 135

Query: 103 NFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVY 149
            F +  ++E    + +++I++ +  IL  +  P+LIHCK G  RTG     +
Sbjct: 136 QFGIDGSKEPFVNIPEDRIREALEVILDASNHPVLIHCKRGKHRTGCVVGCF 187


>gi|320165898|gb|EFW42797.1| protein tyrosine phosphatase [Capsaspora owczarzaki ATCC 30864]
          Length = 232

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 53/106 (50%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L K  G+KSIL L    PE +  +  +   D  + L+
Sbjct: 76  NFAIVAP-GVYRSGYPGKKNFPFLNK-LGLKSILYL---CPEPYVGDNAQFIGDQTLSLL 130

Query: 103 NFPLSATRE----LNDEQIKQ-LISILKTAPKPLLIHCKSGADRTG 143
           +FP+   +E    +    ++  L+++L +   PLLIHC  G  RTG
Sbjct: 131 HFPIHGNKEPFTHIPAATLRAALVALLDSRNHPLLIHCNKGKHRTG 176


>gi|17228604|ref|NP_485152.1| hypothetical protein alr1109 [Nostoc sp. PCC 7120]
 gi|17130455|dbj|BAB73066.1| alr1109 [Nostoc sp. PCC 7120]
          Length = 130

 Score = 48.9 bits (115), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           E G KS+LNLR    +     E+     LG++ INFP+    E+N+    Q++  +   P
Sbjct: 30  EDGYKSVLNLRSPDEKGLLDNEQDKLEFLGLRYINFPMKF-EEINNLTTLQILQTINELP 88

Query: 129 KPLLIHCKSGADRTGLA 145
           KPLLIHC +    + LA
Sbjct: 89  KPLLIHCDNSIRSSVLA 105


>gi|119472119|ref|ZP_01614350.1| hypothetical protein ATW7_11085 [Alteromonadales bacterium TW-7]
 gi|119445139|gb|EAW26432.1| hypothetical protein ATW7_11085 [Alteromonadales bacterium TW-7]
          Length = 175

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (55%), Gaps = 5/93 (5%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +Y +AQP+   ++ L K   +K ++NLRG   + W  +E +    LG+     P+S  ++
Sbjct: 48  VYSAAQPSKEQLKQLSK-ADVKHVINLRGANEQDW--DEGEFVQALGMDYHALPISGAQD 104

Query: 112 LNDEQIKQLISILKT-APKPLLIHCKSGADRTG 143
           +  E  + L S+LK    +P+L+HC S ++R G
Sbjct: 105 ITVENARNLASLLKKLNGEPVLVHCAS-SNRVG 136


>gi|300693572|ref|YP_003749545.1| tyrosine phosphatase protein [Ralstonia solanacearum PSI07]
 gi|299075609|emb|CBJ34902.1| putative tyrosine phosphatase protein [Ralstonia solanacearum
           PSI07]
          Length = 230

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 67/155 (43%), Gaps = 13/155 (8%)

Query: 43  NFHAV--VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA-ANDLGI 99
           NFH V     +++R  QP       L    GIK+I+ L      +   E EK  A   G+
Sbjct: 57  NFHEVEGTSGKLFRGGQPLDESEWNLLANNGIKTIIKLNRYSGSTDTDETEKMNAAKHGM 116

Query: 100 QLI-------NFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYL 150
            +I       +  L+  R  +D Q  + ++ +   T+     +HC  G DRTGL  A+Y 
Sbjct: 117 MIIPIYMPPEDNSLAFWRAPDDSQTDKALTAISESTSHGATYVHCSHGKDRTGLVIALYQ 176

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFE 185
             V H  K  A + L   YGH P L  IT  +  E
Sbjct: 177 MRVQHKCKAAAMKDL-WDYGHSPWLWGITNRVKHE 210


>gi|258544337|ref|ZP_05704571.1| protein tyrosine/serine phosphatase [Cardiobacterium hominis ATCC
           15826]
 gi|258520417|gb|EEV89276.1| protein tyrosine/serine phosphatase [Cardiobacterium hominis ATCC
           15826]
          Length = 177

 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 70/140 (50%), Gaps = 10/140 (7%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T + H V P  +YRS Q +      L+    I++I+NLR         ++ +     GI+
Sbjct: 6   TNHLHEVTP-SLYRSEQLDQDDTALLQA-LNIRTIINLRYFN----RGDDHRNFGHTGIR 59

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +IN PL  T  +  E++ Q++  ++ + K   +L+HC  G DRTGL   +Y  +  ++  
Sbjct: 60  IINIPL-LTWNIKAEEMAQVLYTIEQSEKYGNVLVHCYHGEDRTGLTIGLYRILYQNWNT 118

Query: 159 EEAHRQLSMLYGHFPVLKTI 178
            +A  ++   YG+  + + I
Sbjct: 119 ADAEAEMRR-YGYNRIWRNI 137


>gi|319638663|ref|ZP_07993423.1| hypothetical protein HMPREF0604_01047 [Neisseria mucosa C102]
 gi|317400047|gb|EFV80708.1| hypothetical protein HMPREF0604_01047 [Neisseria mucosa C102]
          Length = 103

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (55%), Gaps = 4/93 (4%)

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           ++N PL  +  +  ++I +++ +++   +   +LIHC  GADRTGL + +Y  I   +P 
Sbjct: 1   MLNRPL-LSWSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRIIYQGWPV 59

Query: 159 EEAHRQLSML-YGHFPVLKTITMDITFEKITQL 190
           EEA  ++    YG+  + K I    T EK+ Q+
Sbjct: 60  EEAKAEMQHGPYGYHSIWKNIAKLFTEEKVKQV 92


>gi|146076301|ref|XP_001462893.1| tyrosine phosphatase [Leishmania infantum JPCM5]
 gi|134066974|emb|CAM65079.1| putative tyrosine phosphatase [Leishmania infantum JPCM5]
          Length = 309

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 54/120 (45%), Gaps = 16/120 (13%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDL 97
           T NF  V P  +YRS  P        KK Y     L LR  L   PE + +   K   + 
Sbjct: 14  TINFSMVCPG-VYRSGYPT-------KKNYSFLCALRLRSILYLCPEDYAESNLKFCEEK 65

Query: 98  GIQLINFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           GI ++ FP    +E    +++  + +++S I  T   PLLIHC  G  RTG   A   ++
Sbjct: 66  GIHVLRFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL 125


>gi|322496322|emb|CBZ31393.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 309

 Score = 47.8 bits (112), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 54/120 (45%), Gaps = 16/120 (13%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDL 97
           T NF  V P  +YRS  P        KK Y     L LR  L   PE + +   K   + 
Sbjct: 14  TINFSMVCPG-VYRSGYPT-------KKNYSFLCALRLRSILYLCPEDYAESNLKFCEEK 65

Query: 98  GIQLINFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           GI ++ FP    +E    +++  + +++S I  T   PLLIHC  G  RTG   A   ++
Sbjct: 66  GIHVLRFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL 125


>gi|50294460|ref|XP_449641.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528955|emb|CAG62617.1| unnamed protein product [Candida glabrata]
          Length = 280

 Score = 47.8 bits (112), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 57/122 (46%), Gaps = 11/122 (9%)

Query: 29  SLGLYFLTITTFT--QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW 86
           S GL     +  T  +NF  VV  EIYRS+ P      +L+K   +KSIL L   +PE +
Sbjct: 104 STGLLLSCDSEVTPPENFSHVV-GEIYRSSFPRTENFAFLQKRLKLKSILVL---IPEEY 159

Query: 87  HKEEEKAANDLGIQLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADR 141
            +E         I+L    +S  +E      +D   K L  +L    +P+LIHC  G  R
Sbjct: 160 PQENLDFMEKANIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCNRGKHR 219

Query: 142 TG 143
           TG
Sbjct: 220 TG 221


>gi|76363712|ref|XP_888539.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|15027525|emb|CAC44917.1| putative tyrosine phosphatase [Leishmania major strain Friedlin]
          Length = 300

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (44%), Gaps = 16/118 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDLGI 99
           NF  V P  +YRS  P        KK Y     L LR  L   PE + +   K   + GI
Sbjct: 16  NFSMVCPG-VYRSGYPT-------KKNYSFLCALRLRSILYLCPEDYAESNLKFCEENGI 67

Query: 100 QLINFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
            ++ FP    +E    +++  + +++S I  T   PLLIHC  G  RTG   A   ++
Sbjct: 68  HVLRFPTEGNKEPFCDVSEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL 125


>gi|77361300|ref|YP_340875.1| hypothetical protein PSHAa2384 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876211|emb|CAI87433.1| conserved protein of unknown function; putative membrane protein
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 177

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 74/147 (50%), Gaps = 14/147 (9%)

Query: 15  YIKILLGVLVLCAV-SLGLYF-----LTITTF-TQNFHAVVPHE--IYRSAQPNGTFIEY 65
           +IK+    L + A+ + G  F     + IT   T +   +V HE     +AQP    ++ 
Sbjct: 3   HIKLFANALFITALLTTGAAFAKEQSINITAVKTSDVRNLVIHENQTLSAAQPTSEQLKQ 62

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL- 124
           L    G+K ++NLRG+  + W  +E +    LG+Q    P++  ++++ E  + L  I+ 
Sbjct: 63  LAN-AGVKHVINLRGENEQDW--DEAQLVASLGMQYHALPIAGAQDVSVENAQNLAKIMA 119

Query: 125 KTAPKPLLIHCKSGADRTGLASAVYLY 151
           +   +P+L+HC S ++R G   A+  +
Sbjct: 120 ELNGEPVLLHCAS-SNRVGALMAISAH 145


>gi|326496196|dbj|BAJ90719.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 214

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 55/106 (51%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   IYRS  P      +LK    ++SI+ L    PE + +   +  +  GI+L 
Sbjct: 61  NF-AMVDDGIYRSGFPAAANFRFLKS-LNLRSIVYL---CPEPYPETNTEFLDKNGIKLH 115

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +   +E    + DE+I++ + + L    +PLLIHCK G  RTG
Sbjct: 116 QFGIEGRKEPFVEIPDEKIREALKVVLDVRNQPLLIHCKRGKHRTG 161


>gi|224118160|ref|XP_002331572.1| predicted protein [Populus trichocarpa]
 gi|222873796|gb|EEF10927.1| predicted protein [Populus trichocarpa]
          Length = 207

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     +L+   G++SIL L    PE + +   +   D GI++ 
Sbjct: 46  NF-AMVDNGIFRSGFPDSANFSFLQS-LGLRSILYL---CPEPYPEANYEFLKDNGIRIF 100

Query: 103 NFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTG 143
            F +   +E    + +E I++ +  IL     P+L+HCK G  RTG
Sbjct: 101 QFGIEMCKESFANIPEETIREALKVILDVKNHPVLVHCKRGKHRTG 146


>gi|269122994|ref|YP_003305571.1| protein tyrosine/serine phosphatase [Streptobacillus moniliformis
           DSM 12112]
 gi|268314320|gb|ACZ00694.1| protein tyrosine/serine phosphatase [Streptobacillus moniliformis
           DSM 12112]
          Length = 189

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 64/117 (54%), Gaps = 10/117 (8%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA-NDLGIQLINFPLSATR 110
           +YRS Q     +  +  E GIK+I+NLR      ++++++K    +  + LIN PL  T 
Sbjct: 38  VYRSQQLESEDLSIIN-ELGIKTIINLR-----FFNRDKDKKIFKETDLILINNPL-KTW 90

Query: 111 ELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            +  +++ Q++  ++ + +   +L HC  G+DRTGL S +Y  I   Y  +EA  +L
Sbjct: 91  NITPKEVAQILYDIEKSKENGAVLFHCYHGSDRTGLISGMYRIIYQDYEIDEALLEL 147


>gi|224116022|ref|XP_002317187.1| predicted protein [Populus trichocarpa]
 gi|222860252|gb|EEE97799.1| predicted protein [Populus trichocarpa]
          Length = 211

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 56/109 (51%), Gaps = 16/109 (14%)

Query: 43  NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           NF A+V + I+RS  P   N TF++ L     ++SIL L    PE + +       D G+
Sbjct: 54  NF-AMVDNGIFRSGFPDIANFTFLQSLS----LRSILYL---CPEPYPEANSDFLKDNGV 105

Query: 100 QLINFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTG 143
           QL  F +   +E    + +E I++ + +L      P+LIHCK G  RTG
Sbjct: 106 QLFQFGMEMCKEPFVNIPEETIREALKVLLDVRNHPILIHCKRGKHRTG 154


>gi|50408578|ref|XP_456793.1| DEHA2A10582p [Debaryomyces hansenii CBS767]
 gi|49652457|emb|CAG84762.1| DEHA2A10582p [Debaryomyces hansenii]
          Length = 270

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 60/115 (52%), Gaps = 10/115 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P  +   ++KK   +KSIL L   +PE + +E E+      
Sbjct: 106 TPPENFAPVI-NKIYRSSFPQPSNFPFVKK-LKLKSILCL---IPEDYPEEHEQFLEKEN 160

Query: 99  IQLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAV 148
           I+L    +S  +E    ++   I + I I L  A +P+LIHC  G  RTG    V
Sbjct: 161 IKLFQLGMSGNKEPFVKISHNLITEAIKIVLNPANQPILIHCNRGKHRTGCLVGV 215


>gi|87118863|ref|ZP_01074762.1| tyrosine-specific protein phosphatase, putative [Marinomonas sp.
           MED121]
 gi|86166497|gb|EAQ67763.1| tyrosine-specific protein phosphatase, putative [Marinomonas sp.
           MED121]
          Length = 165

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 50/92 (54%), Gaps = 14/92 (15%)

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS--ATRELNDEQ-----IKQL 120
           KE GI +IL++     ES    E + A   GI   N P+S  A  +L D++     + + 
Sbjct: 29  KEQGIAAILSV--NFSESVDSREMEGA---GIAHANIPMSPNAPVQLGDKETCLANLPKA 83

Query: 121 ISILKT--APKPLLIHCKSGADRTGLASAVYL 150
           ++ +K   A  P++IHC+SG DRTGL  A YL
Sbjct: 84  MAFIKAQKAAGPVMIHCRSGKDRTGLVMAAYL 115


>gi|224064882|ref|XP_002301598.1| predicted protein [Populus trichocarpa]
 gi|222843324|gb|EEE80871.1| predicted protein [Populus trichocarpa]
          Length = 208

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     +L+   G++SI+ L    PE + +   +   D GI+L 
Sbjct: 51  NF-AMVDNGIFRSGFPDSVNFSFLQT-LGLRSIICL---CPEPYTEATTEFLKDGGIRLY 105

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F + + +E    +  + I++ + + L     P+LIHCK G  RTG
Sbjct: 106 QFGIESYKEPFVNIPQDTIREALQVVLDVKNHPILIHCKRGKHRTG 151


>gi|154331856|ref|XP_001561745.1| tyrosine phosphatase [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134059065|emb|CAM41538.1| putative tyrosine phosphatase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 287

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 55/120 (45%), Gaps = 16/120 (13%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDL 97
           T NF  V P  +YRS  P        KK +   S L LR  L   PE + +   K   + 
Sbjct: 14  TINFSMVCPG-VYRSGYPT-------KKNFSFLSALRLRSILYLCPEDYAESNLKFCEEN 65

Query: 98  GIQLINFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           G+ ++ FP    +E    +++  + +++S I  T   PLLIHC  G  RTG   A   ++
Sbjct: 66  GVHVLRFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL 125


>gi|256372485|ref|YP_003110309.1| protein tyrosine/serine phosphatase [Acidimicrobium ferrooxidans
           DSM 10331]
 gi|256009069|gb|ACU54636.1| protein tyrosine/serine phosphatase [Acidimicrobium ferrooxidans
           DSM 10331]
          Length = 239

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 66/167 (39%), Gaps = 36/167 (21%)

Query: 31  GLY-FLTITTFTQNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESW 86
           GL+ F  +     N H + P  + RS QP   + T    L + Y I  IL+LR       
Sbjct: 15  GLWNFRPVEAILANGHRLRPGRLLRSEQPYRLDATQRRQLLERYAIGKILDLR------- 67

Query: 87  HKEEEKAANDLGIQLINFPL-----------------SATRELNDEQIKQLISILKT--A 127
             EE      +     + PL                  A R + D+    L+  +     
Sbjct: 68  TAEECAPTESIDAPRTHLPLPDVSRDPRIADGSRNLAGAYRAMLDDHAPTLVRAIDAIGV 127

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKE------EAHRQLSML 168
           P P+L+HC +G DRTG+  A+ L +V     +      E+ R+L+ L
Sbjct: 128 PTPVLVHCTAGKDRTGIVVALTLELVGARRDDIVRDYVESGRRLAAL 174


>gi|156059848|ref|XP_001595847.1| hypothetical protein SS1G_03937 [Sclerotinia sclerotiorum 1980]
 gi|154701723|gb|EDO01462.1| hypothetical protein SS1G_03937 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 303

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 59/114 (51%), Gaps = 9/114 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEEKAANDLGIQL 101
           NF  + P+ IYRS+ P     EYL+   G+KSI+ L + + P  +    E      GI+ 
Sbjct: 117 NFGVIAPNAIYRSSFPQQEDFEYLRS-LGLKSIVTLVKKEYPPGFLAFIEAQ----GIRH 171

Query: 102 INFPLSATRELN--DEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYI 152
               +  T++++  +  + Q++ I L     PLLIHC  G  RTG A+A+  ++
Sbjct: 172 YVIEMQGTKKVDIPEHIMNQIMRISLDKENHPLLIHCNHGKHRTGCAAAIIRHV 225


>gi|224131688|ref|XP_002321153.1| predicted protein [Populus trichocarpa]
 gi|222861926|gb|EEE99468.1| predicted protein [Populus trichocarpa]
          Length = 214

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     +L+   G++SI+ L    PE + +   +   D GI+L 
Sbjct: 57  NF-AMVDNGIFRSGFPDSANFAFLQT-LGLRSIICL---CPEPYPEATTEFLKDGGIRLY 111

Query: 103 NFPLSATRE----LNDEQIKQLISILKTAPK-PLLIHCKSGADRTGL 144
            F +   +E    + ++ I++ + ++  A   P+LIHCK G  RTG 
Sbjct: 112 QFGIEGYKEPFVNIPEDTIREALKVVLDAKNHPVLIHCKRGKHRTGC 158


>gi|290973482|ref|XP_002669477.1| predicted protein [Naegleria gruberi]
 gi|284083025|gb|EFC36733.1| predicted protein [Naegleria gruberi]
          Length = 142

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 9/98 (9%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           ++RS  PN     +LKK  G+KSI  L    PE +     +    +GI++  F +   +E
Sbjct: 4   VFRSGYPNKKNFPFLKK-IGLKSICYL---CPEQYAHNNMEFCRKVGIRIFQFGIEGNKE 59

Query: 112 ----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGL 144
               + ++ I++ I+ +L     P+LIHC  G  RTG+
Sbjct: 60  PFVHIPEDAIRKAITELLNPKNHPILIHCNKGKHRTGV 97


>gi|75909258|ref|YP_323554.1| hypothetical protein Ava_3049 [Anabaena variabilis ATCC 29413]
 gi|75702983|gb|ABA22659.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 141

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V  E     QP    ++ L  E G KS++NLR         +EE+ A   G++ +N P+ 
Sbjct: 7   VSDEFSAGGQPTTETLKQLADE-GYKSVVNLRSLDEAGALADEEQQAQAAGLEYVNVPIK 65

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGA 139
           +T E N     +++S L+  P P+  HC +G 
Sbjct: 66  ST-EANHNSTAKVLSELEKLPTPVYFHCGAGG 96


>gi|322488043|emb|CBZ23288.1| putative tyrosine phosphatase [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 292

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 54/120 (45%), Gaps = 16/120 (13%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDL 97
           T NF  V P  +YRS  P        KK Y     L LR  L   PE + +   K   + 
Sbjct: 14  TINFSMVCPG-VYRSGYPT-------KKNYAFLCALRLRSILYLCPEDYAESNLKFCEEN 65

Query: 98  GIQLINFPLSATRE----LNDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           GI ++ FP    +E    +++  + +++ +I  T   PLLIHC  G  RTG   A   ++
Sbjct: 66  GIHVLRFPTEGNKEPFCDISEPLMHRILGAICDTRNLPLLIHCNKGKHRTGTVVACLRHL 125


>gi|332878283|ref|ZP_08446009.1| hypothetical protein HMPREF9074_01748 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332683734|gb|EGJ56605.1| hypothetical protein HMPREF9074_01748 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 181

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 70/141 (49%), Gaps = 8/141 (5%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
           YRS Q      E +K+   IK+I+NLR     S  K+ ++     GI LIN PL   R +
Sbjct: 41  YRSEQLVKANKEVIKRT-PIKTIINLR-YFTRS--KDRKEFYFTDGITLINHPLLTWR-I 95

Query: 113 NDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ-LSMLY 169
             + I Q++  ++ A +   +LIHC  GADRTG+  A+Y  I   +    A ++ L   Y
Sbjct: 96  TLKDIAQVLQRIRKAQQQGAVLIHCYHGADRTGIMVAMYRIIYHGWSIAAAKKEMLQGTY 155

Query: 170 GHFPVLKTITMDITFEKITQL 190
            +  + K +    T E + ++
Sbjct: 156 AYHSIWKNLEALFTEETVKEV 176


>gi|325983146|ref|YP_004295548.1| beta-lactamase hydrolase-family protein [Nitrosomonas sp. AL212]
 gi|325532665|gb|ADZ27386.1| Beta-lactamase hydrolase-family protein [Nitrosomonas sp. AL212]
          Length = 170

 Score = 46.6 bits (109), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           G K++++LR K       EE+   +  G+   N P +    +  EQ+ +   I+++APKP
Sbjct: 62  GFKTVIDLRTK--NEGTAEEKALVDRAGMMYFNIPTTVA-GITREQVAEFTKIIESAPKP 118

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPK---EEAHR 163
           +LIHC SG +R     A Y       P+   EEA +
Sbjct: 119 VLIHCGSG-NRASAMWASYRITQGVEPEAAIEEARK 153


>gi|91203414|emb|CAJ71067.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 151

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 64/135 (47%), Gaps = 7/135 (5%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSA 108
           +  ++QP+   I+ L ++ G KS++NLR    E      KEE       G++ ++ P+S 
Sbjct: 11  VTSASQPSEEEIKKLPQQ-GFKSVVNLRASGEEDQPLSPKEEGDLVKKTGMKYLHIPVST 69

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSM 167
             E+  E + +    ++  P P+ +HC +G  R G  + +Y  +      EEA  +  SM
Sbjct: 70  KEEIKPELVDRFRKEIELLPAPVFVHCHTGK-RAGAFTMMYQALKEGVTGEEAIQKAESM 128

Query: 168 LYG-HFPVLKTITMD 181
            +    P LK   +D
Sbjct: 129 GFACDVPQLKAFFID 143


>gi|257454910|ref|ZP_05620158.1| protein tyrosine/serine phosphatase [Enhydrobacter aerosaccus SK60]
 gi|257447620|gb|EEV22615.1| protein tyrosine/serine phosphatase [Enhydrobacter aerosaccus SK60]
          Length = 182

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 63/117 (53%), Gaps = 9/117 (7%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  +++RS Q     I  ++ +YGI +++NLR    +     EE  AN L +  IN PL 
Sbjct: 25  IDEQLFRSEQLTPDDIGIIQ-QYGINTLINLRFFDRDD---NEENLAN-LPLTFINHPL- 78

Query: 108 ATRELNDEQIKQLI-SIL--KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            T  +  +Q+ +++  IL  +     +L+HC  G+DRTG+  A+Y  +V ++  E A
Sbjct: 79  MTWAIKPQQLAEILYDILWHQARGDKVLVHCYHGSDRTGITVAMYRILVQNWTIEHA 135


>gi|156843057|ref|XP_001644598.1| hypothetical protein Kpol_1003p45 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115244|gb|EDO16740.1| hypothetical protein Kpol_1003p45 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 280

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 52/107 (48%), Gaps = 9/107 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV  EIYRS+ P      YL+ +  +KSIL L   +PE +  E  +     GI+L
Sbjct: 119 ENFSHVV-GEIYRSSFPRIENFPYLQNQLKLKSILVL---IPEEYPPENLEFLEKSGIRL 174

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
               +S  +E      +D   K L  ++     P+LIHC  G  RTG
Sbjct: 175 YQVGMSGNKEPFVNIPSDLLTKALEIVINPENHPILIHCNRGKHRTG 221


>gi|226361844|ref|YP_002779622.1| protein-tyrosine-phosphatase [Rhodococcus opacus B4]
 gi|226240329|dbj|BAH50677.1| putative protein-tyrosine-phosphatase [Rhodococcus opacus B4]
          Length = 236

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (66%)

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +++  L+ I  TAP P+L+HC +G DRTG+A A+ L I    P++
Sbjct: 111 DKLVALLQIAATAPGPILLHCAAGKDRTGIAVALLLRISGVDPRD 155


>gi|300114244|ref|YP_003760819.1| hypothetical protein Nwat_1611 [Nitrosococcus watsonii C-113]
 gi|299540181|gb|ADJ28498.1| protein of unknown function DUF442 [Nitrosococcus watsonii C-113]
          Length = 147

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 56/101 (55%), Gaps = 10/101 (9%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKA-ANDLGIQLINFPLSATRE 111
             QP    ++ LK+E G ++++NLR  G+  +     +E A  ++LG++  + P+S    
Sbjct: 14  GGQPFKEDLQQLKQE-GFQTVINLRATGEKDQPLSPSDEGAIVSELGMEYAHLPVSMDA- 71

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTG----LASAV 148
           LN+  + Q    L+ APKP+ +HC SG  R G    +A+AV
Sbjct: 72  LNETLVDQFRERLEAAPKPVFVHCASG-KRAGAFAMMATAV 111


>gi|2702271|gb|AAB91974.1| unknown protein [Arabidopsis thaliana]
          Length = 218

 Score = 45.8 bits (107), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 12/108 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V + I+RS  P+     ++K   G++SI++L    PE + +   +     GI L 
Sbjct: 59  NF-SMVDNGIFRSGFPDSANFSFIKT-LGLRSIISL---CPEPYPENNMQFLKSNGISLF 113

Query: 103 NFPLSATR------ELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTG 143
            F +  ++      ++ D++I++ + +L      PLLIHCK G  RTG
Sbjct: 114 QFGIEGSKSKEPFVDILDQKIREALKVLLDEKNHPLLIHCKRGKHRTG 161


>gi|158333648|ref|YP_001514820.1| Rieske iron-sulfur (cyt b6f) fusion protein [Acaryochloris marina
           MBIC11017]
 gi|158303889|gb|ABW25506.1| rieske iron-sulfur (cyt b6f) fusion protein [Acaryochloris marina
           MBIC11017]
          Length = 343

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 2/81 (2%)

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           + G KS+LNLR    + +   E +  +  G+   N P++   +L++   +Q+++I+    
Sbjct: 219 QLGFKSVLNLRSPQEDGFLINESQLVHSAGMNYANLPINPA-DLSEATAEQVLTIIDQLS 277

Query: 129 KPLLIHCKSGADRTGLASAVY 149
           KP+L+HCK G  R+G  + +Y
Sbjct: 278 KPILLHCKGGL-RSGAMALLY 297


>gi|154315986|ref|XP_001557315.1| hypothetical protein BC1G_04565 [Botryotinia fuckeliana B05.10]
 gi|150846961|gb|EDN22154.1| hypothetical protein BC1G_04565 [Botryotinia fuckeliana B05.10]
          Length = 314

 Score = 45.8 bits (107), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEEKAANDLGIQL 101
           NF  + P+ IYRS+ P     EYL    G+KSI+ L +   P  +    E      GI+ 
Sbjct: 128 NFGVIAPNAIYRSSFPQQEDFEYLGT-LGLKSIVTLVKKDFPPEFLAFMEAH----GIRH 182

Query: 102 INFPLSATRELN--DEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYI 152
               +  T++++  +  + Q++ I L     PLLIHC  G  RTG A+A+  ++
Sbjct: 183 YVIEMQGTKKVDIPEHIMNQIMRISLDKENHPLLIHCNHGKHRTGCAAAIIRHV 236


>gi|225447153|ref|XP_002275443.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
          Length = 210

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     +L+   G++SI+ L    PE++ +   +     GI+L 
Sbjct: 53  NF-AMVDNGIFRSGFPDTANFAFLQT-LGLRSIIYL---CPETYPEANNEFLKSNGIKLF 107

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +   +E    + ++ I++ + + L     PLLIHCK G  RTG
Sbjct: 108 QFGIEGYKEPFVNIPEDTIREALKVVLDVRNHPLLIHCKRGKHRTG 153


>gi|288960214|ref|YP_003450554.1| hypothetical protein AZL_a04790 [Azospirillum sp. B510]
 gi|288912522|dbj|BAI74010.1| hypothetical protein AZL_a04790 [Azospirillum sp. B510]
          Length = 147

 Score = 45.4 bits (106), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLR--GKLPE-SWHKEEEKAANDLGIQLINFPLSATRELN 113
           QP+G  ++ LK + G++S++NLR  G+    S   EE + A  LG+  ++ P++   EL+
Sbjct: 17  QPSGDDLDVLKAQ-GVRSVVNLREDGERDRPSIPAEEGRQAEALGLSFVHLPVTVP-ELS 74

Query: 114 DEQIKQLISILKTAPKPLLIHCKSG 138
            E ++Q    +   P P+ +HC  G
Sbjct: 75  PELVEQFRRTVDALPGPVYVHCGLG 99


>gi|186685041|ref|YP_001868237.1| hypothetical protein Npun_F4949 [Nostoc punctiforme PCC 73102]
 gi|186467493|gb|ACC83294.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
          Length = 127

 Score = 45.1 bits (105), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           + G KS+LNLR         +E++    LG+  +NFP + T ++N + + Q+   +   P
Sbjct: 27  DEGYKSVLNLRLPDETGLLADEQEKTEFLGLYYVNFP-TKTEDINHQSMLQIYQTIVELP 85

Query: 129 KPLLIHCKSGADRTGLASAVYLYI 152
           KP LIHC +       A+ V LYI
Sbjct: 86  KPTLIHCDNSIRS---AAIVLLYI 106


>gi|89891746|ref|ZP_01203249.1| hypothetical protein BBFL7_01008 [Flavobacteria bacterium BBFL7]
 gi|89516081|gb|EAS18745.1| hypothetical protein BBFL7_01008 [Flavobacteria bacterium BBFL7]
          Length = 99

 Score = 45.1 bits (105), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           +I+ P+  +R    E I  L+ I + A KP+LIHC  G+DRTG+  A Y  +  ++  E 
Sbjct: 1   MIHLPMRTSRLTEAEIIVALMEI-QRAQKPVLIHCWHGSDRTGVVVAAYRIVFENWTIEN 59

Query: 161 A 161
           A
Sbjct: 60  A 60


>gi|303284104|ref|XP_003061343.1| NAD k-like protein [Micromonas pusilla CCMP1545]
 gi|226457694|gb|EEH54993.1| NAD k-like protein [Micromonas pusilla CCMP1545]
          Length = 836

 Score = 45.1 bits (105), Expect = 0.006,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 13/103 (12%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHK----------EEEKAANDLGIQL 101
           YR  QP      +L  E G K++++LR +  ++ W K             + A+D G ++
Sbjct: 154 YRGGQPTAEGRAWLA-ERGFKTVIDLRFEDRDNQWTKPFGGGVGVGKRAPRLADDAGFEV 212

Query: 102 INFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTG 143
           ++ P++       E +++ I +    A +P+L+HCK+G  RTG
Sbjct: 213 VHMPVTDMEPPTFELVERFIEVANDRARRPMLVHCKAGIGRTG 255


>gi|296120715|ref|YP_003628493.1| hypothetical protein Plim_0444 [Planctomyces limnophilus DSM 3776]
 gi|296013055|gb|ADG66294.1| hypothetical protein Plim_0444 [Planctomyces limnophilus DSM 3776]
          Length = 242

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 3/126 (2%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNL--RGKLPESWHKEEEKAANDLGIQLINFPL 106
           P ++ R A      +  L +++ +K++LNL   G++     ++E  A    G +LI   L
Sbjct: 54  PGKVIRCAWVEADVMAELVQKHQVKTVLNLCRPGEMGPDRARQERMAVEAAGAKLIELSL 113

Query: 107 SATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
               + +   I   I++LK  A  PL++HC+ G +RTG    +Y  +      EEA  ++
Sbjct: 114 PDIDDPSSPLIAPHIAVLKDPANYPLIVHCQHGFNRTGRVLTMYDVMFRGKTGEEALSKM 173

Query: 166 SMLYGH 171
            +   H
Sbjct: 174 PLFGRH 179


>gi|254569786|ref|XP_002492003.1| Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis [Pichia pastoris GS115]
 gi|238031800|emb|CAY69723.1| Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis [Pichia pastoris GS115]
 gi|328351503|emb|CCA37902.1| hypothetical protein PP7435_Chr2-0205 [Pichia pastoris CBS 7435]
          Length = 201

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 56/115 (48%), Gaps = 10/115 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V  + IYRS+ P     E+LK+   +KS++ L   +PE + +E  +   +  
Sbjct: 38  TPPKNFSPVCGN-IYRSSFPTIENFEFLKR-INLKSVICL---IPEDYPEENREFLEEQH 92

Query: 99  IQLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAV 148
           IQ     LS  +E    +  + I+Q + I L     P+LIHC  G  RTG  S  
Sbjct: 93  IQFFQVGLSGNKEPFVKIKPQLIEQALKIVLNPENHPILIHCNRGKHRTGCLSGC 147


>gi|255718429|ref|XP_002555495.1| KLTH0G10626p [Lachancea thermotolerans]
 gi|238936879|emb|CAR25058.1| KLTH0G10626p [Lachancea thermotolerans]
          Length = 303

 Score = 44.7 bits (104), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 9/107 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV  EIYRS+ P      +L++   +KSI+ L   +PE + +E  +     GI+L
Sbjct: 142 ENFSHVV-GEIYRSSFPRPENFSFLQQRIKLKSIMVL---IPEEYPQENLEFMARAGIKL 197

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
             F +S  +E      +D     L   +     P+LIHC  G  RTG
Sbjct: 198 FQFGMSGNKEPFVNIPSDLLTSALEVAINPENHPVLIHCNRGKHRTG 244


>gi|150024972|ref|YP_001295798.1| hypothetical protein FP0882 [Flavobacterium psychrophilum JIP02/86]
 gi|149771513|emb|CAL42982.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86]
          Length = 193

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 13/139 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR----------GKLPESWHKEE 90
             NF  +   ++Y+S       IE   K+Y IKSI++LR           ++P     E+
Sbjct: 30  NHNFETITEGKVYKSGVIPPDEIESYVKKYNIKSIVDLRFPGTTDLVNNPEIPTELTAEK 89

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVY 149
           E  A   G+   N    + +    E +K  + I+      P+LIHC  G  R  L SA+Y
Sbjct: 90  EAIAKIKGVNYFN--NGSDQVPTPENVKTFLKIMDNKSNYPVLIHCYHGIGRAELYSAIY 147

Query: 150 LYIVAHYPKEEAHRQLSML 168
                ++  ++A   +  L
Sbjct: 148 RIEYENFTNKDARNGVRTL 166


>gi|50550115|ref|XP_502530.1| YALI0D07414p [Yarrowia lipolytica]
 gi|49648398|emb|CAG80718.1| YALI0D07414p [Yarrowia lipolytica]
          Length = 290

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 53/112 (47%), Gaps = 10/112 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV  +IYRS+ P     EYLK+   +KSIL L   +PE +  E  +   +  IQ 
Sbjct: 130 ENFSIVV-GQIYRSSFPRPENFEYLKR-LKLKSILVL---IPEIYPDENLQFMKENNIQF 184

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
               +S  +E      +D   + L   +  A  PLLIHC  G  RTG  S  
Sbjct: 185 FQVGMSGNKEPFVHVPHDVITRALEIAINPANHPLLIHCNRGKHRTGCLSGC 236


>gi|320101897|ref|YP_004177488.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319749179|gb|ADV60939.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 506

 Score = 44.3 bits (103), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 10/115 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-----RGKLPESWHKEEEKAANDL 97
            F  V    +Y SA P    +E     +G K+I+NL      G+ P+S  + E++ A   
Sbjct: 287 RFKEVEAGRLYMSAMPTAEGLELAHARHGFKTIINLFPEATLGRHPDS--EAEQRFARTH 344

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLY 151
           GI+ +  P     ELN   +++ + + +  A  P+L+HC +  DRT      + Y
Sbjct: 345 GIRYLESP--GRVELNGAFLRETLDLTRDPAAWPILVHCHACMDRTPAWVGFFRY 397


>gi|151944512|gb|EDN62790.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gi|190409013|gb|EDV12278.1| tyrosine-protein phosphatase SIW14 [Saccharomyces cerevisiae
           RM11-1a]
 gi|256269491|gb|EEU04779.1| Siw14p [Saccharomyces cerevisiae JAY291]
 gi|290771004|emb|CAY82175.2| Siw14p [Saccharomyces cerevisiae EC1118]
 gi|323303183|gb|EGA56982.1| Siw14p [Saccharomyces cerevisiae FostersB]
 gi|323306527|gb|EGA59920.1| Siw14p [Saccharomyces cerevisiae FostersO]
 gi|323331999|gb|EGA73411.1| Siw14p [Saccharomyces cerevisiae AWRI796]
          Length = 281

 Score = 44.3 bits (103), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        GI+L
Sbjct: 120 ENFSHVVG-EIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLTGIKL 175

Query: 102 INFPLSATRE--LNDEQ---IKQLISILKTAPKPLLIHCKSGADRTG 143
               +S  +E  +N       K L  +L  A +P+LIHC  G  RTG
Sbjct: 176 YQVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTG 222


>gi|6324296|ref|NP_014366.1| Siw14p [Saccharomyces cerevisiae S288c]
 gi|1730719|sp|P53965|SIW14_YEAST RecName: Full=Tyrosine-protein phosphatase SIW14
 gi|1301872|emb|CAA95895.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285814619|tpg|DAA10513.1| TPA: Siw14p [Saccharomyces cerevisiae S288c]
          Length = 281

 Score = 44.3 bits (103), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        GI+L
Sbjct: 120 ENFSHVVG-EIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLTGIKL 175

Query: 102 INFPLSATRE--LNDEQ---IKQLISILKTAPKPLLIHCKSGADRTG 143
               +S  +E  +N       K L  +L  A +P+LIHC  G  RTG
Sbjct: 176 YQVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTG 222


>gi|297739217|emb|CBI28868.3| unnamed protein product [Vitis vinifera]
          Length = 155

 Score = 44.3 bits (103), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V + I+RS  P+     +L+   G++SI+ L    PE++ +   +     GI+L  F +
Sbjct: 1   MVDNGIFRSGFPDTANFAFLQT-LGLRSIIYL---CPETYPEANNEFLKSNGIKLFQFGI 56

Query: 107 SATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGL 144
              +E    + ++ I++ + + L     PLLIHCK G  RTG 
Sbjct: 57  EGYKEPFVNIPEDTIREALKVVLDVRNHPLLIHCKRGKHRTGC 99


>gi|125536422|gb|EAY82910.1| hypothetical protein OsI_38124 [Oryza sativa Indica Group]
          Length = 196

 Score = 44.3 bits (103), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 10/113 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  +V   +YRS  P+     +L+   G++S++ L    PE + +   +     GI+L
Sbjct: 24  SNF-GMVDTGVYRSGFPDPASFGFLRG-LGLRSVVYL---CPEPYMETNAEFLKAEGIRL 78

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
             F +   ++ N     D  +  L  IL     P+LIHCK G  RTG     +
Sbjct: 79  FQFGIEGNKDPNVSIPVDAIMGALRVILDVRNHPVLIHCKRGKHRTGCLVGCF 131


>gi|297843300|ref|XP_002889531.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297335373|gb|EFH65790.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 215

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V + I+RS  P+     +L+   G++SI+ L    PE + +   +     GI+L 
Sbjct: 58  NF-SMVDNGIFRSGFPDSANFSFLQT-LGLRSIIYL---CPEPYTESNLQFLKSNGIRLF 112

Query: 103 NFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGL 144
            F +   +E    + D +I+  + +L      P+LIHCK G  RTG 
Sbjct: 113 QFGIEGNKEPFVNIPDRKIRMALKVLLDEKNHPVLIHCKRGKHRTGC 159


>gi|148656395|ref|YP_001276600.1| protein tyrosine/serine phosphatase [Roseiflexus sp. RS-1]
 gi|148568505|gb|ABQ90650.1| protein tyrosine/serine phosphatase [Roseiflexus sp. RS-1]
          Length = 243

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 22/103 (21%)

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL-------------SATREL-- 112
           + YG+++I++LR  LP          AN   ++  N PL             S+  EL  
Sbjct: 53  RAYGVRTIIDLR--LPFEVAHNPNVFANAHDVRYTNLPLITERSETSIESRASSVSELYR 110

Query: 113 -----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
                  E I+Q+++ +  A  P+L+HC  G DRTGL +A+ L
Sbjct: 111 LMLDECQEPIRQILATIAEADAPVLVHCFVGKDRTGLITALAL 153


>gi|186682265|ref|YP_001865461.1| hypothetical protein Npun_F1861 [Nostoc punctiforme PCC 73102]
 gi|186464717|gb|ACC80518.1| protein of unknown function DUF442 [Nostoc punctiforme PCC 73102]
          Length = 149

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V  ++  + QP    ++   +E G KS+LNLR      +  +E++ A   G+Q  N PL 
Sbjct: 7   VSEDLSAAGQPTPEELKQAAQE-GFKSVLNLRSPDEPGFLSDEQQQAQAAGLQYANIPLK 65

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHC 135
            + E N E  +  I  ++  PKP+LIHC
Sbjct: 66  PS-EANQELTEAAIQEIENLPKPILIHC 92


>gi|125596441|gb|EAZ36221.1| hypothetical protein OsJ_20540 [Oryza sativa Japonica Group]
          Length = 226

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +LK    ++SI+ L    PE + +   +     GI+L 
Sbjct: 73  NF-AMVDDGIFRSGFPAAANFRFLKS-LNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 127

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +   +E    + D++I++ + + L    +PLLIHCK G  RTG
Sbjct: 128 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTG 173


>gi|115467010|ref|NP_001057104.1| Os06g0208700 [Oryza sativa Japonica Group]
 gi|113595144|dbj|BAF19018.1| Os06g0208700 [Oryza sativa Japonica Group]
 gi|125554494|gb|EAZ00100.1| hypothetical protein OsI_22103 [Oryza sativa Indica Group]
          Length = 226

 Score = 43.9 bits (102), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +LK    ++SI+ L    PE + +   +     GI+L 
Sbjct: 73  NF-AMVDDGIFRSGFPAAANFRFLKS-LNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 127

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +   +E    + D++I++ + + L    +PLLIHCK G  RTG
Sbjct: 128 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTG 173


>gi|50313187|gb|AAT74541.1| dual-specificity phosphatase protein [Oryza sativa]
          Length = 225

 Score = 43.9 bits (102), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +LK    ++SI+ L    PE + +   +     GI+L 
Sbjct: 72  NF-AMVDDGIFRSGFPAAANFRFLKS-LNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 126

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +   +E    + D++I++ + + L    +PLLIHCK G  RTG
Sbjct: 127 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTG 172


>gi|226506872|ref|NP_001149521.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|194689160|gb|ACF78664.1| unknown [Zea mays]
 gi|194695948|gb|ACF82058.1| unknown [Zea mays]
 gi|195627748|gb|ACG35704.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|224030357|gb|ACN34254.1| unknown [Zea mays]
          Length = 216

 Score = 43.9 bits (102), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 53/106 (50%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF AVV   I+RS  P      +LK    ++SI+ L    PE +     +     GI+L 
Sbjct: 63  NF-AVVDDGIFRSGFPGTANFRFLKS-LNLRSIVYL---CPEPYPGTNTEFLEKNGIRLH 117

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +   +E    + D++I++ + + L    +PLLIHCK G  RTG
Sbjct: 118 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTG 163


>gi|15220383|ref|NP_171993.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|73921030|sp|Q9ZVN4|Y1500_ARATH RecName: Full=Probable tyrosine-protein phosphatase At1g05000
 gi|4056425|gb|AAC97999.1| ESTs gb|H36249, gb|AA59732 and gb|AA651219 come from this gene
           [Arabidopsis thaliana]
 gi|28950701|gb|AAO63274.1| At1g05000 [Arabidopsis thaliana]
 gi|110736114|dbj|BAF00029.1| hypothetical protein [Arabidopsis thaliana]
 gi|332189656|gb|AEE27777.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana]
          Length = 215

 Score = 43.9 bits (102), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V + I+RS  P+     +L+   G++SI+ L    PE + +   +     GI+L 
Sbjct: 58  NF-SMVDNGIFRSGFPDSANFSFLQT-LGLRSIIYL---CPEPYPESNLQFLKSNGIRLF 112

Query: 103 NFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGL 144
            F +   +E    + D +I+  + +L      P+LIHCK G  RTG 
Sbjct: 113 QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGC 159


>gi|23100195|ref|NP_693662.1| hypothetical protein OB2740 [Oceanobacillus iheyensis HTE831]
 gi|22778427|dbj|BAC14696.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831]
          Length = 244

 Score = 43.9 bits (102), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 24/106 (22%)

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL--SAT------RELND- 114
           +YL KE G++SIL+LR      +     K  + L  + IN PL   AT      + L D 
Sbjct: 55  KYLAKEKGVQSILDLRLSFEGKY-----KHIDQLSYEYINIPLLDPATFKTKIPKSLVDM 109

Query: 115 ---------EQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYL 150
                    +Q KQ+    + T   P+L HC+ G DRTG+ +A+ L
Sbjct: 110 YCMLLDSSQKQFKQVFQHFIHTGDNPVLFHCRVGKDRTGVLAAMLL 155


>gi|229115370|ref|ZP_04244778.1| hypothetical protein bcere0017_16650 [Bacillus cereus Rock1-3]
 gi|228668090|gb|EEL23524.1| hypothetical protein bcere0017_16650 [Bacillus cereus Rock1-3]
          Length = 141

 Score = 43.5 bits (101), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 18/132 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+   K++GI  + +LR  G+ PE +           G +
Sbjct: 3   NYHELVKGKVYIGGVD---AIQDAVKKHGITEVFDLRAGGEEPEGF---------PTGTK 50

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+    E  DE +++ I+ +K A    K +  HC  G +RTG  +   L  + H  
Sbjct: 51  RHAYPIVEGVEGQDESVRKAIAAVKEAVEQDKKVFFHCSGGRNRTGTVATGLLVELGHAS 110

Query: 158 K-EEAHRQLSML 168
             E+A +Q+  +
Sbjct: 111 NVEDAEQQVKAV 122


>gi|288923103|ref|ZP_06417252.1| protein tyrosine/serine phosphatase [Frankia sp. EUN1f]
 gi|288345543|gb|EFC79923.1| protein tyrosine/serine phosphatase [Frankia sp. EUN1f]
          Length = 245

 Score = 43.5 bits (101), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 18/127 (14%)

Query: 39  TFTQNFHAVVP--HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           TFT     VV     + R + P+   +  L  E  IK +L           +E  +A + 
Sbjct: 49  TFTWPPPTVVDLRSAVERGSSPH--PLSLLGSEVHIKPLLG----------EETGRAGDS 96

Query: 97  LGIQLINFPL----SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           LG  ++   L    +   ++   ++ +++ +   AP PLL+HC +G DRTG+ +A+ L +
Sbjct: 97  LGPDVLAGGLRVLYNTILDIAAPRLVEIVDLAAEAPGPLLVHCAAGKDRTGIVTALLLRL 156

Query: 153 VAHYPKE 159
               P++
Sbjct: 157 AGVGPEQ 163


>gi|226499936|ref|NP_001151744.1| LOC100285379 [Zea mays]
 gi|195649459|gb|ACG44197.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 213

 Score = 43.1 bits (100), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +LK    ++SI+ L    PE + +   +     GI+L 
Sbjct: 60  NF-AMVDDGIFRSGFPETANFRFLKS-LNLRSIVYL---CPEPYPETNTEFLEKNGIRLH 114

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +   +E    + D++I++ + + L    +PLLIHCK G  RTG
Sbjct: 115 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTG 160


>gi|238014192|gb|ACR38131.1| unknown [Zea mays]
          Length = 213

 Score = 43.1 bits (100), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +LK    ++SI+ L    PE + +   +     GI+L 
Sbjct: 60  NF-AMVDDGIFRSGFPETANFRFLKS-LNLRSIVYL---CPEPYPETNTEFLEKNGIRLH 114

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +   +E    + D++I++ + + L    +PLLIHCK G  RTG
Sbjct: 115 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTG 160


>gi|156743488|ref|YP_001433617.1| protein tyrosine/serine phosphatase [Roseiflexus castenholzii DSM
           13941]
 gi|156234816|gb|ABU59599.1| protein tyrosine/serine phosphatase [Roseiflexus castenholzii DSM
           13941]
          Length = 243

 Score = 43.1 bits (100), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 22/103 (21%)

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL----------SATRELND--- 114
           + YG+++I++LR     +++      A+D  +Q +N PL          S  R + +   
Sbjct: 53  RAYGVRTIIDLRLPFEVTYNPNVFATASD--VQYLNLPLITERSETSIESRARSVGELYR 110

Query: 115 -------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
                  E I+Q ++ +     P+L+HC  G DRTGL +A+ L
Sbjct: 111 LMLDECQEPIRQTLATMAETEAPVLVHCFIGKDRTGLITALAL 153


>gi|229089005|ref|ZP_04220364.1| hypothetical protein bcere0022_49250 [Bacillus cereus Rock3-44]
 gi|228694301|gb|EEL47918.1| hypothetical protein bcere0022_49250 [Bacillus cereus Rock3-44]
          Length = 141

 Score = 43.1 bits (100), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 18/132 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+   K++GI  + +LR  G+ PE +  E  + A      
Sbjct: 3   NYHELVKGKVYIGGV---DAIQEAVKKHGITEVFDLRAGGEEPEGFPVEINRHA------ 53

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+  + E  DE ++  I  +K A    K +  HC  G +RTG  +   L  + H  
Sbjct: 54  ---YPIVESIEGQDESVRSAIGAVKEAVEQGKKVFFHCSGGRNRTGTVATGLLLELGHAS 110

Query: 158 K-EEAHRQLSML 168
             E+A +Q+  +
Sbjct: 111 NVEDAEQQVKAV 122


>gi|190572508|ref|YP_001970353.1| hypothetical protein Smlt0440 [Stenotrophomonas maltophilia K279a]
 gi|190010430|emb|CAQ44038.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 166

 Score = 43.1 bits (100), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 62/127 (48%), Gaps = 8/127 (6%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +Y   QP+           G++++++LR +  E    +E + A  LG++ +  P++    
Sbjct: 33  LYAGGQPS-AAQLQALAAQGVRTVIDLR-QPGEDRGFDETRVAESLGLRYVRIPVAGADG 90

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
           L+   ++ +   L+ +  P+L+HC SG +R G   AV   + A Y  E A  + ++  G 
Sbjct: 91  LDTANVRAVHLALQQSQGPVLLHCASG-NRAG---AVLGLVNARY--EHASPEQALQLGQ 144

Query: 172 FPVLKTI 178
              LK++
Sbjct: 145 RAGLKSL 151


>gi|167045124|gb|ABZ09787.1| hypothetical protein ALOHA_HF4000APKG8I13ctg1g57 [uncultured marine
           crenarchaeote HF4000_APKG8I13]
          Length = 138

 Score = 43.1 bits (100), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 55/117 (47%), Gaps = 15/117 (12%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK-LPESWHKEEEKA- 93
           TIT    NF  ++  ++  SA P          E GIKSI+ +R + L ESW K+ +   
Sbjct: 32  TITGKPDNFSWLLEEKLAGSAIPTSFDEIQWVMEQGIKSIVTVREEPLDESWTKDVKYIH 91

Query: 94  --ANDLGIQLINFPLSATRELND-EQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
             +ND+GI           E ND  Q    I    T  +P+L+HC +G  RTG+  A
Sbjct: 92  ILSNDMGIP----------EFNDLVQAIDFIHKRITNNEPVLVHCLAGLGRTGVILA 138


>gi|223940783|ref|ZP_03632617.1| hypothetical protein Cflav_PD0102 [bacterium Ellin514]
 gi|223890540|gb|EEF57067.1| hypothetical protein Cflav_PD0102 [bacterium Ellin514]
          Length = 334

 Score = 43.1 bits (100), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 7/116 (6%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
            Y  + P G       K  GIK+I+ + G  P+       + A+  GI+ ++ P+     
Sbjct: 65  FYSGSAPEGESAFAELKNRGIKTIITVDGAKPDV------ETAHRFGIRYVHLPIGYDGV 118

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM 167
             ++ I+ L+   +T P P+ IHC  G  R    +AV       +  E+A   L +
Sbjct: 119 PTNQAIR-LVKAAETLPGPIYIHCHHGMHRGPAGAAVICMATEGWSAEQADSWLRL 173


>gi|315223492|ref|ZP_07865348.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea F0287]
 gi|314946527|gb|EFS98519.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea F0287]
          Length = 182

 Score = 43.1 bits (100), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (51%), Gaps = 14/89 (15%)

Query: 98  GIQLINFPLSATRELNDEQIK--QLISILKTAPK-----PLLIHCKSGADRTGLASAVYL 150
           GI+LIN PL   R      IK  ++ S+LK   K      +LIHC  GADRTG+  A+Y 
Sbjct: 81  GIKLINHPLLTWR------IKAPEIASVLKLIRKHQNEGAVLIHCYHGADRTGIMVAMYR 134

Query: 151 YIVAHYPKEEAHRQ-LSMLYGHFPVLKTI 178
            I   +   +A  + L+  YG+  V K +
Sbjct: 135 IIYEDWSIADAKNEMLNGPYGYHSVWKNL 163


>gi|56554689|pdb|1XRI|A Chain A, X-Ray Structure Of A Putative Phosphoprotein Phosphatase
           From Arabidopsis Thaliana Gene At1g05000
 gi|56554690|pdb|1XRI|B Chain B, X-Ray Structure Of A Putative Phosphoprotein Phosphatase
           From Arabidopsis Thaliana Gene At1g05000
 gi|150261477|pdb|2Q47|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of A
           Putative Phosphoprotein Phosphatase From Arabidopsis
           Thaliana Gene At1g05000
 gi|150261478|pdb|2Q47|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of A
           Putative Phosphoprotein Phosphatase From Arabidopsis
           Thaliana Gene At1g05000
          Length = 151

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 51/103 (49%), Gaps = 9/103 (8%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
           + V + I+RS  P+     +L+   G++SI+ L    PE + +   +     GI+L  F 
Sbjct: 9   SXVDNGIFRSGFPDSANFSFLQT-LGLRSIIYL---CPEPYPESNLQFLKSNGIRLFQFG 64

Query: 106 LSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTG 143
           +   +E    + D +I+  + +L      P+LIHCK G  RTG
Sbjct: 65  IEGNKEPFVNIPDHKIRXALKVLLDEKNHPVLIHCKRGKHRTG 107


>gi|229100402|ref|ZP_04231273.1| hypothetical protein bcere0020_55890 [Bacillus cereus Rock3-29]
 gi|228683022|gb|EEL37029.1| hypothetical protein bcere0020_55890 [Bacillus cereus Rock3-29]
          Length = 146

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 18/132 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+   K++GI  + +LR  G+ PE +           G +
Sbjct: 3   NYHELVKGKVYIGGV---DAIQDAVKKHGITEVFDLRAGGEEPEGF---------PAGTK 50

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+    E  D+ ++  I+ +K A    K +  HC  G +RTG  +   L  + H  
Sbjct: 51  RHAYPIVEGVEGQDDSVRNAIAAIKEAVEEEKKVFFHCSGGRNRTGTVATGLLLELGHAS 110

Query: 158 K-EEAHRQLSML 168
             E+A  Q  M+
Sbjct: 111 NVEDAEEQAKMV 122


>gi|330819986|ref|YP_004348848.1| hypothetical protein bgla_2g08740 [Burkholderia gladioli BSR3]
 gi|327371981|gb|AEA63336.1| hypothetical protein bgla_2g08740 [Burkholderia gladioli BSR3]
          Length = 493

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%)

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           E EKAA + GI+    P++A   + DEQ +   ++L   PKP+L +C+SG
Sbjct: 428 EIEKAARESGIEARYLPVAAGLPIGDEQAEAFGALLDELPKPVLAYCRSG 477


>gi|256820351|ref|YP_003141630.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea DSM
           7271]
 gi|256581934|gb|ACU93069.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea DSM
           7271]
          Length = 182

 Score = 43.1 bits (100), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (51%), Gaps = 14/89 (15%)

Query: 98  GIQLINFPLSATRELNDEQIK--QLISILKTAPK-----PLLIHCKSGADRTGLASAVYL 150
           GI+LIN PL   R      IK  ++ S+LK   K      +LIHC  GADRTG+  A+Y 
Sbjct: 81  GIKLINHPLLTWR------IKAPEIASVLKLIRKHQNEGAVLIHCYHGADRTGIMVAMYR 134

Query: 151 YIVAHYPKEEAHRQ-LSMLYGHFPVLKTI 178
            I   +   +A  + L+  YG+  V K +
Sbjct: 135 IIYEDWSIADAKNEMLNGPYGYHSVWKNL 163


>gi|89069500|ref|ZP_01156850.1| hypothetical protein OG2516_04199 [Oceanicola granulosus HTCC2516]
 gi|89044981|gb|EAR51068.1| hypothetical protein OG2516_04199 [Oceanicola granulosus HTCC2516]
          Length = 149

 Score = 43.1 bits (100), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 58  PNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
           P+   +   +K+ G ++++NLR   + PE    EEE+ A + G+  ++ P +A   L+  
Sbjct: 18  PDQAALAQAQKD-GFRAVVNLRTASEKPEIAPDEEERIAREAGLAYLHHP-TAADGLDAA 75

Query: 116 QIKQLISILKTAPKPLLIHCKSG 138
            + +    L + P P+L+HC SG
Sbjct: 76  HVDEFRRHLASLPDPVLVHCASG 98


>gi|254576957|ref|XP_002494465.1| ZYRO0A02134p [Zygosaccharomyces rouxii]
 gi|238937354|emb|CAR25532.1| ZYRO0A02134p [Zygosaccharomyces rouxii]
          Length = 170

 Score = 43.1 bits (100), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV  EIYRS+ P      +LK    +KS+L L   +PE    E E+   + GIQL
Sbjct: 9   ENFSHVV-GEIYRSSFPRVENFYFLKHRLKLKSVLVL---IPEELPPENEEFLQEAGIQL 64

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
               +S  +E       DE  + +  +L    +P+LIHC  G  RTG
Sbjct: 65  FQVGMSGNKEPFVNIPGDELTRAMEIVLNPQHQPILIHCNRGKHRTG 111


>gi|254425829|ref|ZP_05039546.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
 gi|196188252|gb|EDX83217.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
          Length = 121

 Score = 42.7 bits (99), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           + QP+    E L  + G +S++NLR         E++     LG+  ++ P++ + E+  
Sbjct: 15  AGQPDPNQFESLASQ-GFRSVINLRPYAEPGATAEDQHRIESLGLPYVHLPITYS-EITP 72

Query: 115 EQIKQLISILKTAPKPLLIHCKSG 138
             I   +  + + PKPLLI+CKS 
Sbjct: 73  SVIDSAVQQVHSLPKPLLIYCKSS 96


>gi|300768916|ref|ZP_07078808.1| protein-tyrosine phosphatase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|300493511|gb|EFK28687.1| protein-tyrosine phosphatase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
          Length = 248

 Score = 42.7 bits (99), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 63/138 (45%), Gaps = 40/138 (28%)

Query: 52  IYRSAQ-----PNGTFIEYLKKEYGIKSILNLRG-----KLPES-W-HKE-------EEK 92
           IYRS Q     P  T  +YL    GI  I+++R      + P++ W H +        + 
Sbjct: 26  IYRSGQLDQLTPAQT--QYLATTLGITRIVDMRSADERHQFPDATWPHVQYHVLDVLAQV 83

Query: 93  AANDLGIQLINFPLSATRELNDEQIK----------------QLISILKTAPKPLLIHCK 136
             ND  +Q +   +S+T  ++D  ++                Q I +L    +PLL HC 
Sbjct: 84  MTNDASLQSM---ISSTGAVHDRMVQLYEQLVLDPTARQSYCQFIQLLLVPDQPLLFHCF 140

Query: 137 SGADRTGLASAVYLYIVA 154
           +G DRTG+ +A++L I+ 
Sbjct: 141 AGKDRTGVGAALFLKILG 158


>gi|304311460|ref|YP_003811058.1| hypothetical protein HDN1F_18280 [gamma proteobacterium HdN1]
 gi|301797193|emb|CBL45411.1| Hypothetical protein HDN1F_18280 [gamma proteobacterium HdN1]
          Length = 145

 Score = 42.7 bits (99), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 10/113 (8%)

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL-KTAPK 129
           GIK+I+++ G L     KE   A   LG+Q  NFP+ +  +L +   +    +L  TA  
Sbjct: 35  GIKTIVSMCGPLELRGEKELVSA---LGMQFHNFPIVSLADLTETMARAFGELLNDTAAH 91

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDI 182
           P+ +HC SG +R G   AV  + +     E+A     +  G    L  + MD+
Sbjct: 92  PMFMHCISG-NRVGALLAVKAFYLDSADIEQA-----IAVGRTAGLTAMEMDV 138


>gi|297599968|ref|NP_001048257.2| Os02g0771400 [Oryza sativa Japonica Group]
 gi|218191654|gb|EEC74081.1| hypothetical protein OsI_09102 [Oryza sativa Indica Group]
 gi|255671274|dbj|BAF10171.2| Os02g0771400 [Oryza sativa Japonica Group]
          Length = 204

 Score = 42.7 bits (99), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 57/109 (52%), Gaps = 16/109 (14%)

Query: 43  NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           NF A V   I+RS  P   N  F+  LK    ++SI+ L    PE + +E  +     GI
Sbjct: 51  NF-AEVNDGIFRSGFPAADNFAFLLSLK----LRSIVYL---CPEPYPEENTRFLEQNGI 102

Query: 100 QLINFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTG 143
           +L  F +  ++EL     +E+I++ +  IL    +P+LIHCK G  RTG
Sbjct: 103 KLHQFGIDGSKELLVNIPEEKIREALKVILDVRNQPVLIHCKRGKHRTG 151


>gi|228933726|ref|ZP_04096573.1| hypothetical protein bthur0009_21880 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228825959|gb|EEM71745.1| hypothetical protein bthur0009_21880 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
          Length = 141

 Score = 42.7 bits (99), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 18/132 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+ + K++GI  + +LR  G+ PE +           G +
Sbjct: 3   NYHELVKGKVYIGGV---DAIQDVVKKHGITEVFDLRAGGEEPEGF---------PAGTK 50

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+    E  DE ++  I+ +K A    K +  HC  G +RTG  +   L  + H  
Sbjct: 51  RHAYPIVEGVEGQDESVRNAIAAVKEAVEQDKKVFFHCSGGRNRTGTVATGLLLELGHAS 110

Query: 158 K-EEAHRQLSML 168
             E A +Q+  +
Sbjct: 111 SVENAEQQVKAV 122


>gi|308179248|ref|YP_003923376.1| protein-tyrosine phosphatase [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|308044739|gb|ADN97282.1| protein-tyrosine phosphatase [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 248

 Score = 42.4 bits (98), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 63/138 (45%), Gaps = 40/138 (28%)

Query: 52  IYRSAQ-----PNGTFIEYLKKEYGIKSILNLRG-----KLPES-W-HKE-------EEK 92
           IYRS Q     P  T  +YL    GI  I+++R      + P++ W H +        + 
Sbjct: 26  IYRSGQLDQLTPAQT--QYLATTLGITRIVDMRSADERHQFPDATWPHVQYHVLDVLAQV 83

Query: 93  AANDLGIQLINFPLSATRELNDEQIK----------------QLISILKTAPKPLLIHCK 136
             ND  +Q +   +S+T  ++D  ++                Q I +L    +PLL HC 
Sbjct: 84  MTNDASLQSM---ISSTGAVHDRMVQLYEQLALDPTARQSYCQFIQLLLVPDQPLLFHCF 140

Query: 137 SGADRTGLASAVYLYIVA 154
           +G DRTG+ +A++L I+ 
Sbjct: 141 AGKDRTGVGAALFLKILG 158


>gi|260943213|ref|XP_002615905.1| hypothetical protein CLUG_04787 [Clavispora lusitaniae ATCC 42720]
 gi|238851195|gb|EEQ40659.1| hypothetical protein CLUG_04787 [Clavispora lusitaniae ATCC 42720]
          Length = 278

 Score = 42.4 bits (98), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  V+ + IYRS+ P      +LK    +KS+L L   +PE + +         GIQL
Sbjct: 117 ENFAPVI-NNIYRSSFPQPPSFAFLKT-LNLKSVLCL---IPEEYPQTHTDFFAREGIQL 171

Query: 102 INFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
               +S  +E    ++ + I +   I L  A +P+LIHC  G  RTG
Sbjct: 172 FQLGMSGNKEPFVIISSDLITEAAKIVLNPANQPILIHCNRGKHRTG 218


>gi|28377031|ref|NP_783923.1| protein-tyrosine phosphatase [Lactobacillus plantarum WCFS1]
 gi|28269862|emb|CAD62759.1| protein-tyrosine phosphatase [Lactobacillus plantarum WCFS1]
          Length = 248

 Score = 42.4 bits (98), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 63/138 (45%), Gaps = 40/138 (28%)

Query: 52  IYRSAQ-----PNGTFIEYLKKEYGIKSILNLRG-----KLPES-W-HKE-------EEK 92
           IYRS Q     P  T  +YL    GI  I+++R      + P++ W H +        + 
Sbjct: 26  IYRSGQLDQLTPAQT--QYLATTLGITRIVDMRSADERHQFPDATWPHVQYHVLDVLAQV 83

Query: 93  AANDLGIQLINFPLSATRELNDEQIK----------------QLISILKTAPKPLLIHCK 136
             ND  +Q +   +S+T  ++D  ++                Q I +L    +PLL HC 
Sbjct: 84  MTNDASLQSM---ISSTGAVHDRMVQLYEQLALDPTARQSYCQFIRLLLVPDQPLLFHCF 140

Query: 137 SGADRTGLASAVYLYIVA 154
           +G DRTG+ +A++L I+ 
Sbjct: 141 AGKDRTGVGAALFLKILG 158


>gi|56068213|gb|AAV70508.1| hypothetical protein [Bacillus sp. MB24]
          Length = 141

 Score = 42.4 bits (98), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 18/128 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+   K++G+  + +LR  G+ PE +  E  + A      
Sbjct: 3   NYHELVKGKVYIGGVD---AIQEAVKKHGVTEVFDLRAGGEEPEGFPVETTRHA------ 53

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+    E  DE +K  I+ +K A    K +  HC  G +RTG  +   L  + H  
Sbjct: 54  ---YPIVEGVEGQDESVKTAIAAVKEAVEQDKKVFFHCSGGRNRTGTVATGLLVELGHAS 110

Query: 158 K-EEAHRQ 164
             EEA ++
Sbjct: 111 NVEEAEQK 118


>gi|325674871|ref|ZP_08154558.1| putative tyrosine-protein phosphatase [Rhodococcus equi ATCC 33707]
 gi|325554457|gb|EGD24132.1| putative tyrosine-protein phosphatase [Rhodococcus equi ATCC 33707]
          Length = 275

 Score = 42.4 bits (98), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 49/103 (47%), Gaps = 6/103 (5%)

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLY 151
            ++D+G Q I +P   T    D   + L+ +I   A    + HC +G DRTG  +AV L 
Sbjct: 148 GSSDIG-QSIGYPFMVTYRGADVAFRDLLTAIAGNADGATVFHCSAGKDRTGWGTAVLLS 206

Query: 152 IVAHYPKEEAHRQL--SMLY-GHFPVLKTITMDITFEKITQLY 191
           ++   PK   ++    S  Y G    ++   +D  F ++ +LY
Sbjct: 207 LLG-VPKATVYQDFLASNTYLGRDDAVEKSWLDAAFAQVDRLY 248


>gi|114331088|ref|YP_747310.1| hypothetical protein Neut_1090 [Nitrosomonas eutropha C91]
 gi|114308102|gb|ABI59345.1| protein of unknown function DUF442 [Nitrosomonas eutropha C91]
          Length = 176

 Score = 42.0 bits (97), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 64/142 (45%), Gaps = 11/142 (7%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQ-----NFHAVVPHEIYRSAQPNGTFIEYLK 67
           +F+ + ++ +LVL + SL      +   TQ      ++ V P      A  + +  E +K
Sbjct: 1   MFFARTIITLLVLSSTSLVFAKDQVPYATQVNDLMRYYRVTPQIATSGALTHDSIQELVK 60

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
             +   ++++LR  +       E KA    G+  IN P++    +N+ Q+     +L+ A
Sbjct: 61  HSF--NTVIDLR--IESEGTPNERKAVEAAGMTYINIPVT-NDGVNESQLIAFKRVLEQA 115

Query: 128 PKPLLIHCKSGADRTGLASAVY 149
             P L+HC +G +R G     Y
Sbjct: 116 SPPFLVHCATG-NRAGAMWTAY 136


>gi|85373734|ref|YP_457796.1| hypothetical protein ELI_04535 [Erythrobacter litoralis HTCC2594]
 gi|84786817|gb|ABC62999.1| hypothetical protein ELI_04535 [Erythrobacter litoralis HTCC2594]
          Length = 150

 Score = 42.0 bits (97), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 6/74 (8%)

Query: 69  EYGIKSILNLR----GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
           E G K+++NLR       P +  +E E  A+ LG++  + P+ A   ++DE + +  + +
Sbjct: 28  EDGYKAVVNLRCQDEADQPLAPDREGEVVAS-LGLEYCHLPV-AGGTISDELVDEFRASV 85

Query: 125 KTAPKPLLIHCKSG 138
           +  PKP+L+HC SG
Sbjct: 86  EALPKPVLVHCASG 99


>gi|312138223|ref|YP_004005559.1| tyrosine/serine phosphatase [Rhodococcus equi 103S]
 gi|311887562|emb|CBH46874.1| putative secreted tyrosine/serine phosphatase [Rhodococcus equi
           103S]
          Length = 275

 Score = 42.0 bits (97), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 6/103 (5%)

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLY 151
            ++D+G Q I +P   T    D   + L+ +I   A    + HC +G DRTG  +AV L 
Sbjct: 148 GSSDIG-QSIGYPFMVTYRGADVAFRDLLTAIAGNADGATVFHCSAGKDRTGWGTAVLLS 206

Query: 152 IVAHYPKEEAHRQL--SMLY-GHFPVLKTITMDITFEKITQLY 191
           ++   PK   +     S  Y G    ++   +D  F ++ +LY
Sbjct: 207 LLG-VPKATVYHDFLASNTYLGRADAVEKSWLDAAFAQVDRLY 248


>gi|318058612|ref|ZP_07977335.1| protein tyrosine/serine phosphatase [Streptomyces sp. SA3_actG]
 gi|318076458|ref|ZP_07983790.1| protein tyrosine/serine phosphatase [Streptomyces sp. SA3_actF]
          Length = 262

 Score = 42.0 bits (97), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 29/109 (26%)

Query: 71  GIKSILNLR--------GKLPESWHKEEEKAANDLGIQLINFPLSATRELND-------- 114
           GI+++++LR        G++P      E  A + LGI+   +  +AT  L D        
Sbjct: 57  GIRTVVDLRHGWEIARTGRVP----AREGLAFHHLGIEHRAWDQAATGPLPDPWRYLADK 112

Query: 115 ---------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                    ++I ++I +L  A  P + HC SG DRTG+ +A+ L ++ 
Sbjct: 113 LGEIFADGGKEIARVIDVLAHAEGPAVFHCASGKDRTGIVAALVLTLLG 161


>gi|307299829|ref|ZP_07579617.1| protein tyrosine/serine phosphatase [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306914530|gb|EFN44928.1| protein tyrosine/serine phosphatase [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 351

 Score = 42.0 bits (97), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 54/118 (45%), Gaps = 22/118 (18%)

Query: 47  VVPHEIYRSAQPN-----GTFIEYLKKEYGIKSILNLRGKLPE--------SWHKEEEKA 93
           + P ++YR + P+       +   L ++ GIK+++NL     E         ++K   +A
Sbjct: 155 IAPGKLYRCSHPSIDDPRAPYASALIEQAGIKTVINLSDSDEELASNLEYSEYYKSISEA 214

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGLASAV 148
            N     LIN  +     L D+  K+L   L+       P LIHC  G DR G+ASA+
Sbjct: 215 GN-----LINLNM-GVDPLADDFAKKLGEGLRFMIAHEPPYLIHCVEGKDRAGIASAL 266


>gi|46109578|ref|XP_381847.1| hypothetical protein FG01671.1 [Gibberella zeae PH-1]
          Length = 304

 Score = 42.0 bits (97), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 7/115 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+P  +YRS+ P     +Y+K   G+K+I++L  K  +    + E      GI+ +
Sbjct: 108 NFGIVIPG-VYRSSFPKSHDFDYIKG-LGLKTIVSLVKK--DDLDHDLETFITSEGIRQV 163

Query: 103 NFPLSATRE--LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
            F +  T++  +  + +K ++++ L  +  PLLIHC  G  RTG    V   I  
Sbjct: 164 VFNMKGTKKEAIPLDTMKGILNVVLDQSNYPLLIHCNHGKHRTGCVVGVVRKITG 218


>gi|228472848|ref|ZP_04057605.1| protein tyrosine/serine phosphatase [Capnocytophaga gingivalis ATCC
           33624]
 gi|228275430|gb|EEK14207.1| protein tyrosine/serine phosphatase [Capnocytophaga gingivalis ATCC
           33624]
          Length = 178

 Score = 41.6 bits (96), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 7/122 (5%)

Query: 72  IKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK-- 129
           IK+I+NLR     S  K+    +   GI LIN PL   R +  + I Q++  ++ + +  
Sbjct: 56  IKTIINLR-YFTRS--KDRNVFSPTDGITLINHPLLTWR-ITPKDIAQVLKRIRRSQEQG 111

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ-LSMLYGHFPVLKTITMDITFEKIT 188
            +LIHC  GAD TG+  A+Y  I   +    A ++ L   YG+  + K +    T E + 
Sbjct: 112 AVLIHCYHGADCTGIMVAMYRIIYHDWSIAAAKKEMLQGPYGYHSIWKNLEALFTEETVK 171

Query: 189 QL 190
           ++
Sbjct: 172 EV 173


>gi|302907190|ref|XP_003049591.1| hypothetical protein NECHADRAFT_30066 [Nectria haematococca mpVI
           77-13-4]
 gi|256730527|gb|EEU43878.1| hypothetical protein NECHADRAFT_30066 [Nectria haematococca mpVI
           77-13-4]
          Length = 299

 Score = 41.6 bits (96), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 7/110 (6%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VVP  +YRS+ P     +Y+K    +K+I++L  K  E +  + E      GI+ 
Sbjct: 104 HNFGVVVPG-VYRSSFPKSHDFDYIKG-LKLKTIVSLVKK--EEFDHDLEMFVAQEGIRQ 159

Query: 102 INFPLSATRE--LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAV 148
           + F +  T++  +  + +K ++SI L     PLLIHC  G  RTG    V
Sbjct: 160 VVFNMKGTKKEAIPLKTMKSILSIVLNKENYPLLIHCNHGKHRTGCVVGV 209


>gi|229093532|ref|ZP_04224634.1| hypothetical protein bcere0021_42570 [Bacillus cereus Rock3-42]
 gi|228689862|gb|EEL43667.1| hypothetical protein bcere0021_42570 [Bacillus cereus Rock3-42]
          Length = 141

 Score = 41.6 bits (96), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 58/128 (45%), Gaps = 18/128 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+   K++G+  + +LR  G+ PE +  E ++ A      
Sbjct: 3   NYHELVKGKVYIGGV---DAIQDAVKKHGVTEVFDLRSGGQEPEGFPVEAKRHA------ 53

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+    E  DE +K  I  +K A    + +  HC  G +RTG  +   L  + H  
Sbjct: 54  ---YPIVEGVEGEDESVKNAIGAVKEAVERGEKVFFHCSGGRNRTGTVATGLLVELGHAS 110

Query: 158 K-EEAHRQ 164
             EEA ++
Sbjct: 111 NVEEAEQK 118


>gi|87162589|gb|ABD28384.1| Tyrosine specific protein phosphatase and dual specificity protein
           phosphatase; Putative tyrosine phosphatase [Medicago
           truncatula]
          Length = 202

 Score = 41.6 bits (96), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   IYRS+ P  +   +L+    ++SI+ L    PE + +E      +  I+L 
Sbjct: 22  NF-SMVEDCIYRSSLPKPSSFPFLQT-LNLRSIIYL---CPEPYPEENLDFLKEQNIRLF 76

Query: 103 NFPLSATRE-----LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    E     L D  ++ L  ++     P+L+HCK G  RTG     +  +  ++ 
Sbjct: 77  QFGIEGKTEVSLPALRDSIMEALKVLVDVRNHPILVHCKQGKHRTGCLVGCFRKL-QNWC 135

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
              A  +    Y  F  +K+   D+TF
Sbjct: 136 LSSAFEE----YQRFAGVKSRAADLTF 158


>gi|85709646|ref|ZP_01040711.1| hypothetical protein NAP1_12213 [Erythrobacter sp. NAP1]
 gi|85688356|gb|EAQ28360.1| hypothetical protein NAP1_12213 [Erythrobacter sp. NAP1]
          Length = 143

 Score = 41.6 bits (96), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 15/121 (12%)

Query: 68  KEYGIKSILNLR--GKLPESWHKEE-EKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
           KE G   I+N R  G+ P +   +E    A D G++ +  P+  T   ++ Q+ ++++ L
Sbjct: 26  KEQGFAMIVNNRPDGEEPTAPQGDEIANLARDAGLEYVAIPIGHTG-FSEAQVNEMVAAL 84

Query: 125 KTAPKPLLIHCKSGADRTGLASAVYLYIVAH-----YPKEEAHRQLSMLYGHFPVLKTIT 179
             A  P+L +C+SG   T      +L+ +A       P E     ++  Y   P+   I 
Sbjct: 85  DAADGPVLAYCRSGTRST------FLWALAQAKSGAAPDEIVSAAMAAGYDVSPIRPMID 138

Query: 180 M 180
           M
Sbjct: 139 M 139


>gi|328860709|gb|EGG09814.1| hypothetical protein MELLADRAFT_30357 [Melampsora larici-populina
           98AG31]
          Length = 136

 Score = 41.6 bits (96), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 16/112 (14%)

Query: 46  AVVPHEIYRSAQPN---GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           A+V   IYRS  PN     F+E LK    + SI+ L     +++       A D G+++ 
Sbjct: 11  AMVSPGIYRSGHPNYRNFAFLEGLK----LTSIMYL---CADNYRPHTFNWAQDRGLKIF 63

Query: 103 NFPLSATRELNDE------QIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           ++ +  +++ N          + L  IL T   P+LIHC  G +R G   A+
Sbjct: 64  HYRIDLSKDPNSPITPHSIYSEALTDILDTRNHPILIHCNKGKNRVGTICAI 115


>gi|302517479|ref|ZP_07269821.1| conventional protein tyrosine phosphatase [Streptomyces sp. SPB78]
 gi|302426374|gb|EFK98189.1| conventional protein tyrosine phosphatase [Streptomyces sp. SPB78]
          Length = 287

 Score = 41.6 bits (96), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 29/109 (26%)

Query: 71  GIKSILNLR--------GKLPESWHKEEEKAANDLGIQLINFPLSATRELND-------- 114
           GI+++++LR        G++P      E  A + LGI+   +  +AT  L D        
Sbjct: 82  GIRTVVDLRHGWEIARTGRVP----AREGLAFHHLGIEHRAWDQAATGPLPDPWRYLADK 137

Query: 115 ---------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                    ++I ++I +L  A  P + HC SG DRTG+ +A+ L ++ 
Sbjct: 138 LDEIFADGGKEIARVIDVLAHAEGPAVFHCASGKDRTGIVAALVLTLLG 186


>gi|149239280|ref|XP_001525516.1| hypothetical protein LELG_03444 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451009|gb|EDK45265.1| hypothetical protein LELG_03444 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 369

 Score = 41.6 bits (96), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 56/115 (48%), Gaps = 10/115 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF A+V + IYRS+ P  T   +LK       +      +PE +   +E+     G
Sbjct: 205 TPPENF-ALVINAIYRSSFPQPTNFSFLKLLKLKSVLC----LIPEDYPLLQEQFLASQG 259

Query: 99  IQLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAV 148
           I+L   P+S  +E    ++ + I Q I I L  + +P+LIHC  G  RTG    V
Sbjct: 260 IKLFQLPMSGNKEPFVKISSDLITQAIQIVLDPSNQPILIHCNRGKHRTGCLVGV 314


>gi|158314035|ref|YP_001506543.1| protein tyrosine/serine phosphatase [Frankia sp. EAN1pec]
 gi|158109440|gb|ABW11637.1| protein tyrosine/serine phosphatase [Frankia sp. EAN1pec]
          Length = 243

 Score = 41.6 bits (96), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%)

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +A  ++   ++ +++ +   AP PLL+HC +G DRTG+  A+ L +    P++
Sbjct: 111 AAMLDIATPRLVEILDLAAEAPGPLLVHCAAGKDRTGVVVALLLRLAGVVPEQ 163


>gi|111221430|ref|YP_712224.1| putative tyrosine specific protein phosphatase [Frankia alni
           ACN14a]
 gi|111148962|emb|CAJ60642.1| putative Tyrosine specific protein phosphatase [Frankia alni
           ACN14a]
          Length = 264

 Score = 41.6 bits (96), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%)

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           Q+  ++ ++  AP P+L+HC +G DRTG+  AV L +  
Sbjct: 139 QLAAIVKVVGEAPGPVLVHCAAGKDRTGVTIAVLLRLAG 177


>gi|320169800|gb|EFW46699.1| hypothetical protein CAOG_04657 [Capsaspora owczarzaki ATCC 30864]
          Length = 436

 Score = 41.6 bits (96), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 56/106 (52%), Gaps = 16/106 (15%)

Query: 47  VVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPES----WHKEEEKAANDLGI 99
           +V  ++YR A P   N  F+  LK    +K++L+L  K P+S    + KEE     ++ I
Sbjct: 14  IVDEQVYRGAYPTHLNFAFLARLK----LKTVLSLTPKKPDSNIDFFCKEE--GVQNIFI 67

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGL 144
           Q+  F  + T  L  + I Q++ IL  A   P+ IHC  GA+ TGL
Sbjct: 68  QVDKFKENVT--LTHQHIVQILPILLNASCHPIYIHCLDGANVTGL 111


>gi|256372064|ref|YP_003109888.1| protein tyrosine/serine phosphatase [Acidimicrobium ferrooxidans
           DSM 10331]
 gi|256008648|gb|ACU54215.1| protein tyrosine/serine phosphatase [Acidimicrobium ferrooxidans
           DSM 10331]
          Length = 289

 Score = 41.6 bits (96), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVY 149
            +L TAP PL++HC +G DRTGL  A++
Sbjct: 195 DVLDTAPDPLVVHCTAGKDRTGLVVALW 222


>gi|60459387|gb|AAX20039.1| tyrosine specific protein phosphatase family protein [Capsicum
           annuum]
          Length = 225

 Score = 41.6 bits (96), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (54%), Gaps = 12/108 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL-PESWHKEEEKAANDLGIQL 101
           NF ++V + I+RS  P+     +L+   G++SI+ L  +L PES    E   AND  I+L
Sbjct: 68  NF-SMVDNGIFRSGFPDVANFSFLQT-LGLRSIIYLCPELYPES--NMEFLKAND--IRL 121

Query: 102 INFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGL 144
             F +   +E    + +E+I++ + +L      P+LIHCK G  RTG 
Sbjct: 122 FQFGIKNCKEPFVNIPEEKIREALGVLIDVRNHPVLIHCKRGKHRTGC 169


>gi|86158096|ref|YP_464881.1| dual specificity protein phosphatase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774607|gb|ABC81444.1| dual specificity protein phosphatase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 189

 Score = 41.2 bits (95), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 55/102 (53%), Gaps = 11/102 (10%)

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
           + L +E+GI+ +L++RG+       ++  A    GIQL++ P   T  ++ E++++ ++ 
Sbjct: 23  QRLAREHGIRRVLDVRGEA-----CDDAGALGACGIQLLHLPTPDTCAVSQERLREGVAF 77

Query: 124 ----LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
               L+   + +L+HC+ G  R+ L  A+ + +    P  EA
Sbjct: 78  ACEGLRRGER-VLVHCQYGIGRSALV-ALCVLVARGVPPLEA 117


>gi|253582031|ref|ZP_04859255.1| protein tyrosine/serine phosphatase [Fusobacterium varium ATCC
           27725]
 gi|251836380|gb|EES64917.1| protein tyrosine/serine phosphatase [Fusobacterium varium ATCC
           27725]
          Length = 132

 Score = 41.2 bits (95), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTITMDI 182
           L      +LIHC  GADR G+  A+Y  +  ++ +EE     L+  YG+  + K I   I
Sbjct: 57  LSANEDTILIHCYHGADRIGMMGALYRMVYQNWEREETLSEMLNDGYGYHSMWKDIVAFI 116

Query: 183 TFEKITQL 190
               + QL
Sbjct: 117 KEVNVEQL 124


>gi|225469129|ref|XP_002273080.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 210

 Score = 41.2 bits (95), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 16/110 (14%)

Query: 43  NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           NF A+V   ++RS  P   N TF++ L    G++SI+ L    PE + +   +     GI
Sbjct: 50  NF-AMVDCGVFRSGFPDTANFTFLQTL----GLRSIIYL---CPEPYPEPNIEFLKCNGI 101

Query: 100 QLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGL 144
           +L  F +   +E    + ++ I++ + + L     PLLIHCK G  RTG 
Sbjct: 102 RLFQFGIDGCKEPFVNIPEDTIREALKVVLDKRNHPLLIHCKRGKHRTGC 151


>gi|118380815|ref|XP_001023570.1| Dual specificity phosphatase, catalytic domain containing protein
           [Tetrahymena thermophila]
 gi|89305337|gb|EAS03325.1| Dual specificity phosphatase, catalytic domain containing protein
           [Tetrahymena thermophila SB210]
          Length = 373

 Score = 41.2 bits (95), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 5/116 (4%)

Query: 47  VVPHEIY-----RSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           VVP++IY     R+ + NG  +   +   GI   +N++  +  +  K +E      GIQ 
Sbjct: 190 VVPNKIYAFRGPRNVRENGINVAKPEDFVGIFKQINIQKVIQLNQEKYDESKFTQAGIQH 249

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +           +EQ+++ I  +      + +HC++G  RTG   A+Y     ++P
Sbjct: 250 VKIIFPDGGIPTNEQVEKFIQEVDRTEGNVAVHCQAGLGRTGTMIALYCMKQYYFP 305


>gi|261331354|emb|CBH14348.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 321

 Score = 41.2 bits (95), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 16/116 (13%)

Query: 41  TQNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
           T NF  V P  +YRS  P   N  FI  L    G+++I+ L    PE + +   K   + 
Sbjct: 18  TINFAMVCPG-VYRSGYPTRKNYRFIRAL----GLRTIIYL---CPEDYAESNVKFCEES 69

Query: 98  GIQLINFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAV 148
           GI +  F     +E    +++  + +++S L  T   P+LIHC  G  RTG  +A 
Sbjct: 70  GITIRRFATEGNKEPFMDISEPLMHRILSALIDTRLHPVLIHCNKGKHRTGTVAAC 125


>gi|312199595|ref|YP_004019656.1| protein tyrosine/serine phosphatase [Frankia sp. EuI1c]
 gi|311230931|gb|ADP83786.1| protein tyrosine/serine phosphatase [Frankia sp. EuI1c]
          Length = 261

 Score = 40.8 bits (94), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 50/124 (40%), Gaps = 37/124 (29%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL------------- 112
           L+ +YG+++IL+LR   PE   +E      D  I   N     TR L             
Sbjct: 49  LRDDYGLRTILDLR--TPEEATREGRGPLGDEPIAYHNLSFLRTRWLMPAEIAAEEEAAL 106

Query: 113 -------NDEQIKQLISILK---------------TAPKPLLIHCKSGADRTGLASAVYL 150
                  +D++++  +  L+                A  P L HC +G DRTG+ +AV L
Sbjct: 107 ALIRIRTSDDRVEHYLDYLRLAGDSVTTAIGLIADEASGPTLFHCAAGKDRTGVLAAVVL 166

Query: 151 YIVA 154
            IV 
Sbjct: 167 SIVG 170


>gi|71744982|ref|XP_827121.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70831286|gb|EAN76791.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 321

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 16/116 (13%)

Query: 41  TQNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
           T NF  V P  +YRS  P   N  FI  L    G+++I+ L    PE + +   K   + 
Sbjct: 18  TINFAMVCPG-VYRSGYPTRKNYRFIRAL----GLRTIIYL---CPEDYAESNVKFCEES 69

Query: 98  GIQLINFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAV 148
           GI +  F     +E    +++  + +++S L  T   P+LIHC  G  RTG  +A 
Sbjct: 70  GITIRRFATEGNKEPFMDISEPLMHRILSALIDTRLHPVLIHCNKGKHRTGTVAAC 125


>gi|302537672|ref|ZP_07290014.1| predicted protein [Streptomyces sp. C]
 gi|302446567|gb|EFL18383.1| predicted protein [Streptomyces sp. C]
          Length = 287

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 27/39 (69%)

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           ++I++ + ++   P P++ HC SG DRTGL +A+ L ++
Sbjct: 164 DEIRRAVELIADGPGPVVFHCTSGKDRTGLIAALVLTLL 202


>gi|254480325|ref|ZP_05093573.1| hypothetical protein GPB2148_3364 [marine gamma proteobacterium
           HTCC2148]
 gi|214039887|gb|EEB80546.1| hypothetical protein GPB2148_3364 [marine gamma proteobacterium
           HTCC2148]
          Length = 299

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 98  GIQLINFPLSATRELNDE---QIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           G +   F + A RE       Q  Q I  +LK   +P++ HC +G DRTG A+A+ L ++
Sbjct: 150 GFEPTAFMIEANREFAKTFTPQFSQFIQEVLKAKGQPIVWHCSAGKDRTGFAAAILLRLL 209

Query: 154 A 154
            
Sbjct: 210 G 210


>gi|300776463|ref|ZP_07086321.1| conserved hypothetical protein [Chryseobacterium gleum ATCC 35910]
 gi|300501973|gb|EFK33113.1| conserved hypothetical protein [Chryseobacterium gleum ATCC 35910]
          Length = 291

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           A+D   ++I+F      E N E IK +I+ +  +  P+L HC +G DRTG+ +A+ L I+
Sbjct: 140 ASDADKRMIDFYREYVTE-NPETIKTIITEVLESKDPVLYHCTAGKDRTGIITALILTIL 198


>gi|217075344|gb|ACJ86032.1| unknown [Medicago truncatula]
          Length = 186

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   IYRS+ P  +   +L+    ++SI+ L    PE + +E      +  I+L 
Sbjct: 22  NF-SMVEDCIYRSSLPKPSSFPFLQT-LNLRSIIYL---CPEPYPEENLDFLKEQNIRLF 76

Query: 103 NFPLSATRE-----LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    E     L D  ++ L  ++     P+L+HCK G  RTG     +  +  ++ 
Sbjct: 77  QFGIEGKTEVSLPALRDSIMEALKVLVDVRNHPILVHCKQGKHRTGRLVGCFRKL-QNWC 135

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
              A  +    Y  F  +K+   D+TF
Sbjct: 136 LSSAFEE----YQRFAGVKSRAADLTF 158


>gi|320582458|gb|EFW96675.1| Tyrosine phosphatase [Pichia angusta DL-1]
          Length = 236

 Score = 40.8 bits (94), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF A+V   IYRS+ P     E++ K   +KS+L L   +PE +  E  +   +  
Sbjct: 73  TPPENF-ALVCGSIYRSSFPRIENFEFMLK-LKLKSVLCL---IPEEYPSENMEFLREND 127

Query: 99  IQLINFPLSATRE----LNDEQIKQLISILKTAPK-PLLIHCKSGADRTG 143
           IQ     LS  +E    +  +Q+ + + I+      P+L+HC  G  RTG
Sbjct: 128 IQFFQVGLSGNKEPFVKIKPDQVNEALKIIANPEHHPILVHCNRGKHRTG 177


>gi|282856589|ref|ZP_06265860.1| lipoprotein [Pyramidobacter piscolens W5455]
 gi|282585580|gb|EFB90877.1| lipoprotein [Pyramidobacter piscolens W5455]
          Length = 320

 Score = 40.8 bits (94), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 17/111 (15%)

Query: 52  IYRSAQPNGT------FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA----------N 95
           +YRS+ P+ T      + + L +E GI+++LNL    PE   K  E  A           
Sbjct: 124 LYRSSIPSSTERPRAPYADRLAREAGIRTVLNL-ANSPERLKKNMESPACRSSYYRMLWR 182

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
             G+     P +         + + +  +   P P LIHC  G DR G  S
Sbjct: 183 GGGVIARALPAAPEHAAFRAGLAEELRFMTKRPAPYLIHCAEGKDRAGFVS 233


>gi|199597647|ref|ZP_03211075.1| Protein tyrosine/serine phosphatase [Lactobacillus rhamnosus HN001]
 gi|199591454|gb|EDY99532.1| Protein tyrosine/serine phosphatase [Lactobacillus rhamnosus HN001]
          Length = 249

 Score = 40.8 bits (94), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 30/142 (21%)

Query: 43  NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLR-----GKLPES-WHKEE--- 90
           N  AV    IYRS Q    +     YL K+ GIK I+++R      + P++ W   +   
Sbjct: 17  NGQAVKEGLIYRSGQLFELDEAQEHYLAKDLGIKQIVDMRSADERAQFPDTVWPGADYTV 76

Query: 91  -----EKAANDLGIQLINFPLSATRE-----------LNDEQI--KQLISILKTAPKPLL 132
                +  AN+  +  +     + RE            +  QI  ++LI  L    +P +
Sbjct: 77  LDILKDATANNASLGRMITEQGSVRENMLATYEQLAISSSAQIGYRKLIQALLVPDRPTI 136

Query: 133 IHCKSGADRTGLASAVYLYIVA 154
            HC +G DRTG+ +A+ L I+ 
Sbjct: 137 FHCYAGKDRTGVGAAIILEILG 158


>gi|255645646|gb|ACU23317.1| unknown [Glycine max]
          Length = 203

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 63/147 (42%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   I+RS  PN +   +L+    ++SI+ L    PE + +E         I+L 
Sbjct: 24  NF-SMVEDCIFRSGLPNPSNFPFLQT-LNLRSIIYL---CPEPYPEENLDFLRSQNIRLF 78

Query: 103 NFPLSATRE-----LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    +     L D  +  L  ++     P+LIHCK G  RTG      L  + ++ 
Sbjct: 79  QFGIEGKTDISMPILKDSIMDALEVLIDVRNHPVLIHCKRGKHRTGCLVGC-LRKLQNWC 137

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +    Y  F   K+ TMD+ F
Sbjct: 138 LSSVFEE----YQRFAGAKSRTMDLAF 160


>gi|258509788|ref|YP_003172539.1| protein tyrosine/serine phosphatase [Lactobacillus rhamnosus GG]
 gi|257149715|emb|CAR88688.1| Protein tyrosine/serine phosphatase [Lactobacillus rhamnosus GG]
 gi|259651052|dbj|BAI43214.1| phosphatase [Lactobacillus rhamnosus GG]
          Length = 249

 Score = 40.0 bits (92), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 61/142 (42%), Gaps = 30/142 (21%)

Query: 43  NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLR-----GKLPES-WHKEE--- 90
           N  AV    IYRS Q    +     YL K+ GIK I+++R      + P++ W   +   
Sbjct: 17  NGQAVKADLIYRSGQLFELDEAQEHYLAKDLGIKQIVDMRSADERAQFPDTVWPGADYTV 76

Query: 91  -----EKAANDLGIQLINFPLSATRE---LNDEQI----------KQLISILKTAPKPLL 132
                +  AN+  +  +     + RE      EQ+          + LI  L    +P +
Sbjct: 77  LDILKDATANNASLGRMITEQGSVRENMLATYEQLAVSSSAQTGYRALIQALLVPDRPTI 136

Query: 133 IHCKSGADRTGLASAVYLYIVA 154
            HC +G DRTG+ +A+ L I+ 
Sbjct: 137 FHCFAGKDRTGVGAAIILEILG 158


>gi|149176007|ref|ZP_01854624.1| hypothetical protein PM8797T_04110 [Planctomyces maris DSM 8797]
 gi|148845161|gb|EDL59507.1| hypothetical protein PM8797T_04110 [Planctomyces maris DSM 8797]
          Length = 149

 Score = 40.0 bits (92), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 51  EIYRSAQPNGTFIEYLKKEYGIKSILNLR----GKLPESWHKEEEKAANDLGIQLINFPL 106
           E+    QP+   I  L ++ G KS++N R     + P S   E+EK  ND  ++ ++ P+
Sbjct: 10  EVTVGPQPSAEEINQLSQQ-GFKSVVNFRTEGEDEQPLSPTAEKEKV-NDAEMEYLHIPV 67

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           S  + +  E + +        PKP+  HCKSG  R G    ++L +
Sbjct: 68  S-MKAMGPELVDEFREKYPQLPKPVFAHCKSGK-RAGAMVMMHLAV 111


>gi|282901585|ref|ZP_06309504.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193511|gb|EFA68489.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 150

 Score = 40.0 bits (92), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  + +   QP+   +  L  + G+KSI+NLR          E++ +    ++ +N PL 
Sbjct: 7   ISEKFWAGGQPSPEDLAQLAHQ-GVKSIVNLRSPDETGSLSNEQELSKSNSLEYVNLPLE 65

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           +    N E+I  L++ +   P P+  HC +G    G AS   L  +A
Sbjct: 66  SNSS-NGEKIDYLLTEIVDLPTPIYFHCGAG----GRASVTALIALA 107


>gi|225430987|ref|XP_002278743.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147766881|emb|CAN67527.1| hypothetical protein VITISV_002127 [Vitis vinifera]
 gi|297735279|emb|CBI17641.3| unnamed protein product [Vitis vinifera]
          Length = 202

 Score = 40.0 bits (92), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 16/109 (14%)

Query: 43  NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           NF ++V   I+RS  P   N  F+E L     ++SI+ L    PE + +E  K      I
Sbjct: 20  NF-SMVEENIFRSGLPSPINFPFLETLN----LRSIIYL---CPEPYPEENCKFLQSQNI 71

Query: 100 QLINFPLSATRE----LNDEQIKQLISILKTAPK-PLLIHCKSGADRTG 143
           +L  F +   +E    ++ + I + + +L      P+LIHCK G  RTG
Sbjct: 72  RLFQFGIEGKKEPPVAMSTDTISEALKVLMDVRNHPILIHCKRGKHRTG 120


>gi|225851439|ref|YP_002731673.1| dual specificity protein phosphatase [Persephonella marina EX-H1]
 gi|225646038|gb|ACO04224.1| dual specificity protein phosphatase [Persephonella marina EX-H1]
          Length = 149

 Score = 40.0 bits (92), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ---IKQLISILKTA 127
           G+ +++NL G    S+  E+++   + G ++I  P S    + +E+   + + +  L+  
Sbjct: 27  GVNTVINLLGGDYGSFIAEKQR---EKGFEVIRIPFSMADPIPEEEFTAVYEYVDQLRED 83

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            K +++HCK G  R+G   A YL I + Y  EEA
Sbjct: 84  RKKVVVHCKYGQARSGTFLAGYL-IHSGYSYEEA 116


>gi|149186542|ref|ZP_01864854.1| hypothetical protein ED21_31694 [Erythrobacter sp. SD-21]
 gi|148829769|gb|EDL48208.1| hypothetical protein ED21_31694 [Erythrobacter sp. SD-21]
          Length = 148

 Score = 40.0 bits (92), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 48/83 (57%), Gaps = 6/83 (7%)

Query: 69  EYGIKSILNLR--GKLPESWHKEEE-KAANDLGIQLINFPLSATRELNDEQIKQLISILK 125
           + G KSI+NLR  G+  E  + + E + A + G++ +++P+S   +L  E+ +   + L+
Sbjct: 27  DAGFKSIVNLRQVGEQGEKLNPQAEAEEARENGLEYLHYPVSPP-DLTAEKAQDFTARLE 85

Query: 126 TAPKPLLIHCKSG--ADRTGLAS 146
             P P+ IHC SG  A   GLAS
Sbjct: 86  QLPGPVAIHCASGRRASLLGLAS 108


>gi|34811073|pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14
 gi|34811074|pdb|1OHD|A Chain A, Structure Of Cdc14 In Complex With Tungstate
          Length = 348

 Score = 40.0 bits (92), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 209 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 261

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 262 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 295


>gi|296090655|emb|CBI41055.3| unnamed protein product [Vitis vinifera]
          Length = 158

 Score = 40.0 bits (92), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 15/101 (14%)

Query: 52  IYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
           ++RS  P   N TF++ L    G++SI+ L    PE + +   +     GI+L  F +  
Sbjct: 6   VFRSGFPDIANFTFLQTL----GLRSIIYL---CPEPYPEPNIEFLKCNGIRLFQFGIDG 58

Query: 109 TRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGL 144
            +E    + ++ I++ + + L     PLLIHCK G  RTG 
Sbjct: 59  CKEPFVNIPEDTIREALKVVLDKRNHPLLIHCKRGKHRTGC 99


>gi|220917375|ref|YP_002492679.1| dual specificity protein phosphatase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955229|gb|ACL65613.1| dual specificity protein phosphatase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 189

 Score = 40.0 bits (92), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 49/88 (55%), Gaps = 8/88 (9%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK 125
           L +E+GI+ +L++RG+       ++ +A    GI+L++ P   T  ++ E++++ ++   
Sbjct: 25  LAREHGIQRVLDVRGEA-----CDDAEALGACGIRLLHLPTRDTCAVSQERLREGVAFAC 79

Query: 126 TA---PKPLLIHCKSGADRTGLASAVYL 150
            A    + +L+HC+ G  R+ L +   L
Sbjct: 80  EALERGERVLVHCQYGIGRSALVALCVL 107


>gi|168053205|ref|XP_001779028.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669590|gb|EDQ56174.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 182

 Score = 40.0 bits (92), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   +YRS  PN   + +L+K   ++S++ L    PE + +   +     GI++ 
Sbjct: 13  NF-AMVDKGVYRSGYPNKKNLPFLQK-LRLRSVVYL---CPEPYPEANIEFMEKNGIKMF 67

Query: 103 NFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTG 143
           +F +   +E    + +  I+  + +L     +P+LIHC  G  RTG
Sbjct: 68  HFGIEGNKEPFVDIPENVIRDALKVLLDVKNQPILIHCNKGKHRTG 113


>gi|91793880|ref|YP_563531.1| Dual specificity protein phosphatase [Shewanella denitrificans
           OS217]
 gi|91715882|gb|ABE55808.1| dual specificity protein phosphatase [Shewanella denitrificans
           OS217]
          Length = 156

 Score = 40.0 bits (92), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 15/90 (16%)

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGI--QLINFPLSATRELND--------EQIKQL 120
           GIK I++L        ++ +E A  ++GI  ++   P S    L+D         +I   
Sbjct: 32  GIKVIVSLNDA-----NQCDESAMAEVGILHRVFTLPDSIPPTLDDLAICTEILPKILAF 86

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           I+  +    P+LIHC+SG DRTGL  A YL
Sbjct: 87  IAQCEADNLPVLIHCRSGKDRTGLMMAYYL 116


>gi|123409707|ref|XP_001303489.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121884873|gb|EAX90559.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 179

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   IYR + PN     +L+   G+K+IL L    PE + +  ++  +   I+LI
Sbjct: 19  NF-SLVAKGIYRGSYPNQRNFSFLR-HLGLKTILFL---CPEDYSQSNQEFLDANNIKLI 73

Query: 103 NFPLSATRE----LNDEQIKQ-LISILKTAPKPLLIHCKSGADRTG 143
             P+   +E    +  E + + +  +      P+ IHC  G  RTG
Sbjct: 74  RVPMEGNKEPFKIIPTELMNEAMCHLADRRSHPIYIHCNKGKHRTG 119


>gi|166226979|sp|A6N3Q4|CC14C_HYLSY RecName: Full=Dual specificity protein phosphatase CDC14C; AltName:
           Full=CDC14 cell division cycle 14 homolog C
 gi|148763625|gb|ABR10606.1| CDC14Bretro [Symphalangus syndactylus]
          Length = 483

 Score = 40.0 bits (92), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K    + +I+ L  K+ ++      K   D G    +   +      D  +K  
Sbjct: 246 TYIQYFKNR-NVTTIIRLNKKMYDA------KCFTDAGFDHHDLFFADGSSPTDAIVKGF 298

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 299 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 332


>gi|229196249|ref|ZP_04322997.1| hypothetical protein bcere0001_18080 [Bacillus cereus m1293]
 gi|228587103|gb|EEK45173.1| hypothetical protein bcere0001_18080 [Bacillus cereus m1293]
          Length = 141

 Score = 39.7 bits (91), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 18/128 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+    ++GI  + +LR  G+ PE +           G +
Sbjct: 3   NYHELVKGKVYIGGVE---AIQDAVNKHGITEVFDLRAGGEEPEGF---------PAGTK 50

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+    E  DE ++  I+ +K A    K +  HC  G +RTG  +   L  + H  
Sbjct: 51  RHAYPIVEGVEGQDESVRNAIAAVKEAVEQDKKVFFHCSGGRNRTGTVATGLLVELGHAS 110

Query: 158 K-EEAHRQ 164
             EEA ++
Sbjct: 111 NVEEAEQK 118


>gi|325192716|emb|CCA27129.1| tyrosine phosphatase putative [Albugo laibachii Nc14]
          Length = 154

 Score = 39.7 bits (91), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 10/112 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   +YRS  PN     +L+ + G++SIL L     +    +      + GIQ+ 
Sbjct: 13  NF-SMVDAGVYRSGYPNKKNHSFLR-QLGLRSILYL---CHQPLRADNLLFFQENGIQIF 67

Query: 103 NFPLSATRE----LNDEQIK-QLISILKTAPKPLLIHCKSGADRTGLASAVY 149
           + P+   +E    ++ E +   L  +L  +  P+L+HC  G  RTG     Y
Sbjct: 68  HCPIDGNKEPFIGIDPEAMAGALRHLLDPSNHPILVHCTKGTHRTGCVIGCY 119


>gi|325265784|ref|ZP_08132471.1| protein tyrosine/serine phosphatase [Kingella denitrificans ATCC
           33394]
 gi|324982767|gb|EGC18392.1| protein tyrosine/serine phosphatase [Kingella denitrificans ATCC
           33394]
          Length = 193

 Score = 39.7 bits (91), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 68/150 (45%), Gaps = 7/150 (4%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H V   ++YRS QP             I++I+NLR     + ++  +  A +  I+L+
Sbjct: 40  NLHRV-DDKLYRSEQPI-ADDIAAINAAQIRTIVNLRYF---NRNRNNDLFAQNPHIRLV 94

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL   R    +    L  I +      +L+HC  GADRTG+  A Y  I  ++   +A
Sbjct: 95  NQPLLTWRVRPKDLAAALYQIEQGQKHGAVLVHCYHGADRTGIVIAFYRMIYQNWTLADA 154

Query: 162 HRQ-LSMLYGHFPVLKTITMDITFEKITQL 190
             + L   +G+  V K +    T E + ++
Sbjct: 155 KAEMLQGGFGYHSVWKNLENLFTEETLAEV 184


>gi|57160685|emb|CAI39619.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|57162208|emb|CAI40539.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
          Length = 455

 Score = 39.7 bits (91), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 217 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 269

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 270 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 303


>gi|229551271|ref|ZP_04439996.1| protein tyrosine/serine phosphatase [Lactobacillus rhamnosus
           LMS2-1]
 gi|258540972|ref|YP_003175471.1| protein tyrosine/serine phosphatase [Lactobacillus rhamnosus Lc
           705]
 gi|229315230|gb|EEN81203.1| protein tyrosine/serine phosphatase [Lactobacillus rhamnosus
           LMS2-1]
 gi|257152648|emb|CAR91620.1| Protein tyrosine/serine phosphatase [Lactobacillus rhamnosus Lc
           705]
          Length = 249

 Score = 39.7 bits (91), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 61/142 (42%), Gaps = 30/142 (21%)

Query: 43  NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLR-----GKLPES-WHKEE--- 90
           N  AV    IYRS Q    +     YL K+ GIK I+++R      + P++ W   +   
Sbjct: 17  NGQAVKAGLIYRSGQLFELDEAQEHYLAKDLGIKQIVDMRSADERAQFPDTVWPGADYAV 76

Query: 91  -----EKAANDLGIQLINFPLSATRE---LNDEQI----------KQLISILKTAPKPLL 132
                +  AN+  +  +     + RE      EQ+          + LI  L    +P +
Sbjct: 77  LDILKDATANNASLGRMITEQGSVRENMLATYEQLAVSSSAQTGYRALIQALLVPDRPTI 136

Query: 133 IHCKSGADRTGLASAVYLYIVA 154
            HC +G DRTG+ +A+ L I+ 
Sbjct: 137 FHCFAGKDRTGVGAAIILEILG 158


>gi|301111440|ref|XP_002904799.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
 gi|262095129|gb|EEY53181.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
          Length = 172

 Score = 39.7 bits (91), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 14/109 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL--RGKLPESWHKEEEKAANDLGIQ 100
           NF ++V   +YRS  PN     +L+ + G+KS+L L  +G  PE+    EE       I+
Sbjct: 13  NF-SMVASGVYRSGFPNRKNHAFLQ-QLGLKSVLYLCHQGHQPENVAFFEEN-----NIE 65

Query: 101 LINFPLSATRE----LN-DEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
           +   P+   +E    +N D     L  +L     P+L+HC  G  RTG 
Sbjct: 66  VFQCPIDGNKEPFISINPDAMADALRHLLDVRNHPILVHCTKGTHRTGC 114


>gi|149920113|ref|ZP_01908586.1| dual specificity protein phosphatase [Plesiocystis pacifica SIR-1]
 gi|149819056|gb|EDM78493.1| dual specificity protein phosphatase [Plesiocystis pacifica SIR-1]
          Length = 157

 Score = 39.7 bits (91), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 10/122 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLK----KEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
            F  ++P ++  SA P             +E GI  I+ L  + P +  +  E AA    
Sbjct: 9   GFRWILPGQLAGSAAPGLLSSLSADLSFLREQGIARIVTLTER-PLALDEAPELAAQ--- 64

Query: 99  IQLINFPLSATRELNDEQIKQLISIL--KTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            ++I+FP+           + L+ +L  K   +P+L+HC+ G  RTG  +A  L  +   
Sbjct: 65  FEIIHFPIDDMSIPTPRACEGLVRVLAPKLESQPVLLHCRGGLGRTGTIAACVLVDLGEE 124

Query: 157 PK 158
           P 
Sbjct: 125 PD 126


>gi|114625693|ref|XP_001152646.1| PREDICTED: CDC14 homolog B isoform 5 [Pan troglodytes]
          Length = 475

 Score = 39.7 bits (91), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 224 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 276

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 277 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 310


>gi|44004493|ref|NP_982161.1| hypothetical protein BCE_A0154 [Bacillus cereus ATCC 10987]
 gi|190015145|ref|YP_001966797.1| conserved hypothetical protein [Bacillus cereus]
 gi|190015411|ref|YP_001967121.1| hypothetical protein pPER272_0257 [Bacillus cereus]
 gi|218848378|ref|YP_002455190.1| hypothetical protein BCAH820_B0309 [Bacillus cereus AH820]
 gi|229113456|ref|ZP_04242906.1| hypothetical protein bcere0018_56280 [Bacillus cereus Rock1-15]
 gi|229125503|ref|ZP_04254550.1| hypothetical protein bcere0016_57190 [Bacillus cereus 95/8201]
 gi|296506574|ref|YP_003667808.1| hypothetical protein BMB171_P0196 [Bacillus thuringiensis BMB171]
 gi|42741559|gb|AAS45004.1| hypothetical protein BCE_A0154 [Bacillus cereus ATCC 10987]
 gi|116584821|gb|ABK00936.1| conserved hypothetical protein [Bacillus cereus]
 gi|116585092|gb|ABK01201.1| conserved hypothetical protein [Bacillus cereus]
 gi|218540429|gb|ACK92825.1| conserved hypothetical protein [Bacillus cereus AH820]
 gi|228657970|gb|EEL13763.1| hypothetical protein bcere0016_57190 [Bacillus cereus 95/8201]
 gi|228669974|gb|EEL25367.1| hypothetical protein bcere0018_56280 [Bacillus cereus Rock1-15]
 gi|296327161|gb|ADH10088.1| hypothetical protein BMB171_P0196 [Bacillus thuringiensis BMB171]
          Length = 141

 Score = 39.7 bits (91), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 18/128 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+    ++GI  + +LR  G+ PE +           G +
Sbjct: 3   NYHELVKGKVYIGGV---DAIQDAVNKHGITEVFDLRAGGEEPEGFPS---------GTK 50

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+    E  DE ++  I+ +K A    K +  HC  G +RTG  +   L  + H  
Sbjct: 51  RHAYPIVEGVEGQDESVRNAIAAVKEAVEQDKKVFFHCSGGRNRTGTVATGLLVELGHAS 110

Query: 158 K-EEAHRQ 164
             EEA ++
Sbjct: 111 NVEEAEQK 118


>gi|73537423|ref|YP_297790.1| hypothetical protein Reut_B3588 [Ralstonia eutropha JMP134]
 gi|72120760|gb|AAZ62946.1| Protein of unknown function DUF442 [Ralstonia eutropha JMP134]
          Length = 558

 Score = 39.7 bits (91), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 45/72 (62%), Gaps = 4/72 (5%)

Query: 70  YGIKSILNLR--GKLPESWHKEE-EKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           +G +S++  R  G+ P+  + +E E+ A+ LG+Q    P+ + + ++DEQ +    +L +
Sbjct: 27  FGFRSLICNRPDGEGPDQPNFQEIERKASALGLQAHYLPVESGK-VSDEQAQAFGQLLDS 85

Query: 127 APKPLLIHCKSG 138
            PKP+L +C++G
Sbjct: 86  LPKPVLAYCRTG 97


>gi|226493145|ref|NP_001150333.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|195638458|gb|ACG38697.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 222

 Score = 39.7 bits (91), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 53/121 (43%), Gaps = 28/121 (23%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDLGI 99
           NF A+V   I+RS  P+     +L         LNLR  +   PE + +E  +     GI
Sbjct: 57  NF-AMVDDGIFRSGLPDAGSFRFLLS-------LNLRSVVYLCPEPYPEENARFLQQNGI 108

Query: 100 QLINFPLSATRE----------------LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRT 142
           QL  F +  ++                 + +E I++ +  IL    +P+LIHCK G  RT
Sbjct: 109 QLHQFGIEGSKSGSTVPDAMVVQEPFVYIPEETIREALKVILDARNQPVLIHCKRGKHRT 168

Query: 143 G 143
           G
Sbjct: 169 G 169


>gi|297194749|ref|ZP_06912147.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297152430|gb|EFH31739.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 266

 Score = 39.7 bits (91), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           L ++    P PLL HC +G DRTG A+ + L ++   PK
Sbjct: 143 LNAVADPDPGPLLFHCTAGKDRTGWAATIVLTLLGATPK 181


>gi|332222838|ref|XP_003260576.1| PREDICTED: dual specificity protein phosphatase CDC14B [Nomascus
           leucogenys]
          Length = 461

 Score = 39.7 bits (91), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 210 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 262

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 263 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 296


>gi|114625695|ref|XP_001152510.1| PREDICTED: CDC14 homolog B isoform 3 [Pan troglodytes]
 gi|114625697|ref|XP_001152575.1| PREDICTED: CDC14 homolog B isoform 4 [Pan troglodytes]
          Length = 403

 Score = 39.7 bits (91), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 152 TYIQYFK-NHNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 204

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 205 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 238


>gi|30248796|ref|NP_840866.1| hypothetical protein NE0792 [Nitrosomonas europaea ATCC 19718]
 gi|30180391|emb|CAD84703.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 177

 Score = 39.7 bits (91), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 4/81 (4%)

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           ++  +++++LR +   +    E+KA   +GI  IN P++    +N+ Q+      L+ A 
Sbjct: 60  KHSFQTVIDLRSESEGT--PSEKKAVEAVGITYINIPVTG-EGVNESQLTAFKQALEQAA 116

Query: 129 KPLLIHCKSGADRTGLASAVY 149
            P+LIHC +G +R G     Y
Sbjct: 117 PPVLIHCATG-NRAGAMWTAY 136


>gi|109112399|ref|XP_001106436.1| PREDICTED: dual specificity protein phosphatase CDC14B-like isoform
           3 [Macaca mulatta]
          Length = 461

 Score = 39.7 bits (91), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 210 TYIQYFKN-HSVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 262

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 263 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 296


>gi|148793101|gb|ABR12627.1| CDC14B isoform [Homo sapiens]
          Length = 485

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|119613062|gb|EAW92656.1| hCG32512, isoform CRA_c [Homo sapiens]
          Length = 491

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|114625679|ref|XP_001152257.1| PREDICTED: CDC14 homolog B isoform 1 [Pan troglodytes]
 gi|5706724|gb|AAC16662.2| Cdc14B3 phosphatase [Homo sapiens]
 gi|50234991|gb|AAT70726.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|119613060|gb|EAW92654.1| hCG32512, isoform CRA_a [Homo sapiens]
          Length = 471

 Score = 39.7 bits (91), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|302661320|ref|XP_003022329.1| tyrosine phosphatase family protein [Trichophyton verrucosum HKI
           0517]
 gi|291186269|gb|EFE41711.1| tyrosine phosphatase family protein [Trichophyton verrucosum HKI
           0517]
          Length = 267

 Score = 39.3 bits (90), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 10/113 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E      D GI  
Sbjct: 57  NNFAEVV-KGIYRSSFPLPVHLSSLA-QLNLKTIVTL---VDEEWSPEYSSFVRDNGITS 111

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
              P+ A ++ N        ++ L  +L T   P+++HC  G  RTG   A +
Sbjct: 112 RIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACF 164


>gi|116008458|ref|NP_001070649.1| dual specificity protein phosphatase CDC14B isoform 3 [Homo
           sapiens]
 gi|114625689|ref|XP_001152956.1| PREDICTED: dual specificity protein phosphatase CDC14B isoform 9
           [Pan troglodytes]
 gi|193785168|dbj|BAG54321.1| unnamed protein product [Homo sapiens]
          Length = 461

 Score = 39.3 bits (90), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 210 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 262

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 263 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 296


>gi|67528456|ref|XP_662030.1| hypothetical protein AN4426.2 [Aspergillus nidulans FGSC A4]
 gi|40741001|gb|EAA60191.1| hypothetical protein AN4426.2 [Aspergillus nidulans FGSC A4]
 gi|259482760|tpe|CBF77547.1| TPA: tyrosine phosphatase family protein (AFU_orthologue;
           AFUA_4G07000) [Aspergillus nidulans FGSC A4]
          Length = 232

 Score = 39.3 bits (90), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 10/113 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV   IYR A P    +  LK   G+++I+ L   + E + +  EK   + GI  
Sbjct: 42  ENFGEVV-KGIYRCAFPQPWNLPALKT-LGLRTIITL---VDEPYTQSHEKFLEETGITH 96

Query: 102 INFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVY 149
              P  A ++   +  +++++     +L  +  P+LIHC  G  RTG  +A +
Sbjct: 97  HRIPFIANKDPAIKTPERVVNTILRLMLNKSNHPILIHCNKGKHRTGCVTACF 149


>gi|114625691|ref|XP_001152898.1| PREDICTED: CDC14 homolog B isoform 8 [Pan troglodytes]
          Length = 458

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 210 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 262

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 263 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 296


>gi|327542372|gb|EGF28856.1| Beta-lactamase hydrolase-like protein [Rhodopirellula baltica WH47]
          Length = 153

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEE-KAANDLGIQLINFPLSATRELN 113
           QP+   ++ L  + G +S++N R  G+  +    EEE +A    G++ ++ P+S    ++
Sbjct: 16  QPSQDELKSLPDD-GFRSVINFRTAGEDEQPLSPEEEGEAVRATGLKYLHVPVSMDG-MD 73

Query: 114 DEQIKQLISILKTAPKPLLIHCKSG 138
           ++++ Q     ++ PKP+  HCKSG
Sbjct: 74  EKKVDQFREQYQSLPKPVFAHCKSG 98


>gi|206975071|ref|ZP_03235985.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|206746492|gb|EDZ57885.1| conserved hypothetical protein [Bacillus cereus H3081.97]
          Length = 141

 Score = 39.3 bits (90), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 18/128 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQ 100
           N+H +V  ++Y         I+    ++GI  + +LR  G+ PE +           G +
Sbjct: 3   NYHELVKGKVYIGGVD---AIQDAVNKHGITEVFDLRDGGEEPEGF---------PAGTK 50

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +P+    E  DE ++  I+ +K A    K +  HC  G +RTG  +   L  + H  
Sbjct: 51  RHVYPIVEGVEGQDESVRNAIAAVKEAVEQDKKVFFHCSGGRNRTGTVATGLLVELGHAS 110

Query: 158 K-EEAHRQ 164
             EEA ++
Sbjct: 111 NVEEAEQK 118


>gi|332865187|ref|XP_003318471.1| PREDICTED: dual specificity protein phosphatase CDC14C-like isoform
           1 [Pan troglodytes]
          Length = 447

 Score = 39.3 bits (90), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 217 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 269

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 270 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 303


>gi|283768619|ref|ZP_06341531.1| conserved hypothetical protein [Bulleidia extructa W1219]
 gi|283105011|gb|EFC06383.1| conserved hypothetical protein [Bulleidia extructa W1219]
          Length = 253

 Score = 39.3 bits (90), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 42/144 (29%)

Query: 52  IYRSAQPNGTFIEYLKK--EYGIKSILNLRGKLPESWHKEEEKAAN-DLGIQLINFPLSA 108
            YRS+  N    + L+K  + G+K I++LR K      +E EK  + DLG+ +I F    
Sbjct: 29  FYRSSGLNQFSSQDLEKIRKIGLKKIIDLRSK------EEREKHPDPDLGVPIICFDAYR 82

Query: 109 TRELND----------------EQ-----------------IKQLISILKTAPKPLLIHC 135
            + ++D                +Q                 +K+++ +++    PLL HC
Sbjct: 83  AKYMDDIDFSFNGMLSLGEKGLQQKALRLKYYENMPFGNPYLKKVMELIQEDELPLLFHC 142

Query: 136 KSGADRTGLASAVYLYIVAHYPKE 159
            SG DRTGL + V L +    P++
Sbjct: 143 ASGKDRTGLMAMVILGLFEVEPEK 166


>gi|119613061|gb|EAW92655.1| hCG32512, isoform CRA_b [Homo sapiens]
          Length = 477

 Score = 39.3 bits (90), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|28199758|ref|NP_780072.1| hypothetical protein PD1890 [Xylella fastidiosa Temecula1]
 gi|182682508|ref|YP_001830668.1| hypothetical protein XfasM23_1995 [Xylella fastidiosa M23]
 gi|81585639|sp|Q87AD6|BLH_XYLFT RecName: Full=Beta-lactamase hydrolase-like protein
 gi|28057879|gb|AAO29721.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182632618|gb|ACB93394.1| protein of unknown function DUF442 [Xylella fastidiosa M23]
 gi|307578785|gb|ADN62754.1| hypothetical protein XFLM_03920 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 431

 Score = 39.3 bits (90), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 55  SAQPN-GTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINF-PLSATR 110
           S QPN   FI + ++ Y  +SI+NLR  G+ P     + E+AA        NF P+  T 
Sbjct: 13  SGQPNTDEFINFARRGY--RSIINLRPDGEEPNQPGNDAEQAAARRAGLAYNFVPVIGT- 69

Query: 111 ELNDEQIKQLISILKTAPKPLLIHCKSG 138
            + +  I+     + T    +L+HCKSG
Sbjct: 70  SITEADIQAFQRAIATTEGSVLVHCKSG 97


>gi|291301629|ref|YP_003512907.1| protein tyrosine/serine phosphatase [Stackebrandtia nassauensis DSM
           44728]
 gi|290570849|gb|ADD43814.1| protein tyrosine/serine phosphatase [Stackebrandtia nassauensis DSM
           44728]
          Length = 248

 Score = 39.3 bits (90), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 60/137 (43%), Gaps = 43/137 (31%)

Query: 52  IYRSAQ---PNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA-----NDLGIQLIN 103
           ++RS Q    +   I+Y+  E G+K++++LR        +  E AA      D G+ + N
Sbjct: 44  VFRSDQFGNASSEDIDYIVDELGVKTVVDLR--------RPTEIAATASFPGDRGVAVHN 95

Query: 104 FPLSATRELNDEQ--------------------------IKQLISILKTAPKPLLIHCKS 137
             L   R  N E+                          I+  ++++ TA  P++ HC +
Sbjct: 96  LELGHIRWENIERDAGREPSPVPFLVERYTAMVETGAITIRDTLNMMITA-TPMVFHCMA 154

Query: 138 GADRTGLASAVYLYIVA 154
           G DRTG+ +AV L ++ 
Sbjct: 155 GKDRTGITAAVALKLLG 171


>gi|238618737|ref|YP_002913562.1| dual specificity protein phosphatase [Sulfolobus islandicus M.16.4]
 gi|238379806|gb|ACR40894.1| dual specificity protein phosphatase [Sulfolobus islandicus M.16.4]
          Length = 161

 Score = 39.3 bits (90), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 14/115 (12%)

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL--------GIQLINFPLSATRELN 113
            +E+ K+  G+K +L     LPE W  EE     D         G+Q ++ P+      +
Sbjct: 21  ILEWRKE--GVKRVL----VLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIQDGGVPS 74

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML 168
           D Q   ++  L +  +  L+HC  G  RTG   A YL +      E A  ++ ++
Sbjct: 75  DSQFLTIMRWLLSEKEGNLVHCVGGIGRTGTILASYLILTEGLDVESAINEVRLV 129


>gi|119613066|gb|EAW92660.1| hCG32512, isoform CRA_g [Homo sapiens]
          Length = 450

 Score = 39.3 bits (90), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 239 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 291

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 292 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 325


>gi|15837370|ref|NP_298058.1| hypothetical protein XF0768 [Xylella fastidiosa 9a5c]
 gi|81623802|sp|Q9PFB0|BLH_XYLFA RecName: Full=Beta-lactamase hydrolase-like protein
 gi|9105660|gb|AAF83578.1|AE003917_12 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 431

 Score = 39.3 bits (90), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 55  SAQPN-GTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINF-PLSATR 110
           S QPN   FI + ++ Y  +SI+NLR  G+ P     + E+AA        NF P+  T 
Sbjct: 13  SGQPNTDEFINFARRGY--RSIINLRPDGEEPNQPGNDAEQAAARRAGLAYNFVPVIGT- 69

Query: 111 ELNDEQIKQLISILKTAPKPLLIHCKSG 138
            + +  I+     + T    +L+HCKSG
Sbjct: 70  SITEADIQAFQRAIATTEGSVLVHCKSG 97


>gi|71898224|ref|ZP_00680398.1| Protein of unknown function DUF442 [Xylella fastidiosa Ann-1]
 gi|71731963|gb|EAO34020.1| Protein of unknown function DUF442 [Xylella fastidiosa Ann-1]
          Length = 482

 Score = 39.3 bits (90), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 55  SAQPN-GTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINF-PLSATR 110
           S QPN   FI + ++ Y  +SI+NLR  G+ P     + E+AA        NF P+  T 
Sbjct: 64  SGQPNTDEFINFARRGY--RSIINLRPDGEEPNQPGNDAEQAAARRAGLAYNFVPVIGT- 120

Query: 111 ELNDEQIKQLISILKTAPKPLLIHCKSG 138
            + +  I+     + T    +L+HCKSG
Sbjct: 121 SITEADIQAFQRAIATTEGSVLVHCKSG 148


>gi|226355275|ref|YP_002785015.1| protein tyrosine/serine phosphatase [Deinococcus deserti VCD115]
 gi|226317265|gb|ACO45261.1| putative Protein tyrosine/serine phosphatase [Deinococcus deserti
           VCD115]
          Length = 232

 Score = 39.3 bits (90), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 8/51 (15%)

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYL--------YIVAHYPKEEAHRQ 164
           ++L  AP  +LIHC +G DRTGL +A+ L         I A Y + + H Q
Sbjct: 115 AVLDAAPGKVLIHCHAGKDRTGLVTALALELTGVSRRAIAADYVETDQHMQ 165


>gi|32476832|ref|NP_869826.1| hypothetical protein RB11176 [Rhodopirellula baltica SH 1]
 gi|32447378|emb|CAD77204.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 153

 Score = 39.3 bits (90), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEE-KAANDLGIQLINFPLSATRELN 113
           QP+   ++ L  + G +S++N R  G+  +    EEE +A    G++ ++ P+S    ++
Sbjct: 16  QPSQDELKSLPDD-GFRSVINFRTAGEDEQPLSPEEEGEAVRATGLKYLHVPVSMDG-MD 73

Query: 114 DEQIKQLISILKTAPKPLLIHCKSG 138
           ++++ Q     ++ PKP+  HCKSG
Sbjct: 74  EKKVDQFREQYQSLPKPVFAHCKSG 98


>gi|255656254|ref|ZP_05401663.1| hypothetical protein CdifQCD-2_11299 [Clostridium difficile
           QCD-23m63]
 gi|296450307|ref|ZP_06892067.1| protein-tyrosine phosphatase [Clostridium difficile NAP08]
 gi|296878719|ref|ZP_06902723.1| protein-tyrosine phosphatase [Clostridium difficile NAP07]
 gi|296260868|gb|EFH07703.1| protein-tyrosine phosphatase [Clostridium difficile NAP08]
 gi|296430293|gb|EFH16136.1| protein-tyrosine phosphatase [Clostridium difficile NAP07]
          Length = 246

 Score = 39.3 bits (90), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASA 147
           E++ A N L     N P+      N+   K+L+ +++     P+L HC +G DRTG+ SA
Sbjct: 98  EKDGAFNMLNNSYYNLPI------NNPSYKKLVELIRDYSNLPILNHCTAGKDRTGVGSA 151

Query: 148 VYLYIVA 154
           + L I+ 
Sbjct: 152 IILMILG 158


>gi|4502699|ref|NP_003662.1| dual specificity protein phosphatase CDC14B isoform 1 [Homo
           sapiens]
 gi|114625687|ref|XP_001152769.1| PREDICTED: CDC14 homolog B isoform 7 [Pan troglodytes]
 gi|297684894|ref|XP_002820046.1| PREDICTED: dual specificity protein phosphatase CDC14B-like isoform
           2 [Pongo abelii]
 gi|2662463|gb|AAB88293.1| tyrosine phosphatase [Homo sapiens]
 gi|57160683|emb|CAI39617.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|57162206|emb|CAI40537.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|119613064|gb|EAW92658.1| hCG32512, isoform CRA_e [Homo sapiens]
          Length = 459

 Score = 39.3 bits (90), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|51094654|gb|EAL23905.1| hypothetical protein MGC26484 [Homo sapiens]
          Length = 520

 Score = 39.3 bits (90), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 290 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 342

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 343 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 376


>gi|126699887|ref|YP_001088784.1| hypothetical protein CD2272 [Clostridium difficile 630]
 gi|254975863|ref|ZP_05272335.1| hypothetical protein CdifQC_11149 [Clostridium difficile QCD-66c26]
 gi|255093250|ref|ZP_05322728.1| hypothetical protein CdifC_11429 [Clostridium difficile CIP 107932]
 gi|255101414|ref|ZP_05330391.1| hypothetical protein CdifQCD-6_11444 [Clostridium difficile
           QCD-63q42]
 gi|255307287|ref|ZP_05351458.1| hypothetical protein CdifA_11902 [Clostridium difficile ATCC 43255]
 gi|255314992|ref|ZP_05356575.1| hypothetical protein CdifQCD-7_11607 [Clostridium difficile
           QCD-76w55]
 gi|255517667|ref|ZP_05385343.1| hypothetical protein CdifQCD-_11196 [Clostridium difficile
           QCD-97b34]
 gi|255650777|ref|ZP_05397679.1| hypothetical protein CdifQCD_11371 [Clostridium difficile
           QCD-37x79]
 gi|260683862|ref|YP_003215147.1| hypothetical protein CD196_2127 [Clostridium difficile CD196]
 gi|260687522|ref|YP_003218656.1| hypothetical protein CDR20291_2170 [Clostridium difficile R20291]
 gi|306520680|ref|ZP_07407027.1| hypothetical protein CdifQ_13201 [Clostridium difficile QCD-32g58]
 gi|115251324|emb|CAJ69156.1| putative protein-tyrosine phosphatase [Clostridium difficile]
 gi|260210025|emb|CBA64078.1| conserved hypothetical protein [Clostridium difficile CD196]
 gi|260213539|emb|CBE05281.1| conserved hypothetical protein [Clostridium difficile R20291]
          Length = 246

 Score = 39.3 bits (90), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASA 147
           E++ A N L     N P+      N+   K+L+ +++     P+L HC +G DRTG+ SA
Sbjct: 98  EKDGAFNMLNNSYYNLPI------NNPSYKKLVELIRDYSNLPILNHCTAGKDRTGVGSA 151

Query: 148 VYLYIVA 154
           + L I+ 
Sbjct: 152 IILMILG 158


>gi|15237359|ref|NP_197152.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|9759130|dbj|BAB09615.1| unnamed protein product [Arabidopsis thaliana]
 gi|107738251|gb|ABF83668.1| At5g16480 [Arabidopsis thaliana]
 gi|332004915|gb|AED92298.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
          Length = 204

 Score = 39.3 bits (90), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 49/109 (44%), Gaps = 16/109 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDLGI 99
           NF ++V  EIYRS  P         + +G  S LNLR  +   PE + ++  K+     I
Sbjct: 19  NF-SMVEDEIYRSGFPE-------LENFGFLSTLNLRSIIYLCPEPYPEDNLKSLASNNI 70

Query: 100 QLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
           +L  F +    +       D  +  L  ++     P+LIHCK G  RTG
Sbjct: 71  KLFQFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTG 119


>gi|82802744|gb|ABB92423.1| CDC14B2 [Gorilla gorilla]
          Length = 459

 Score = 39.3 bits (90), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFK-NHNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|119581390|gb|EAW60986.1| hCG2003284 [Homo sapiens]
          Length = 301

 Score = 39.3 bits (90), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 71  TYIQYFKN-HNVTTIIRLNKRIYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 123

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 124 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 157


>gi|82802740|gb|ABB92421.1| CDC14B2 [Homo sapiens]
          Length = 459

 Score = 39.3 bits (90), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFK-NHNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|82802742|gb|ABB92422.1| CDC14B2 [Pan troglodytes]
          Length = 459

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFK-NHNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|326469879|gb|EGD93888.1| hypothetical protein TESG_01419 [Trichophyton tonsurans CBS 112818]
 gi|326479102|gb|EGE03112.1| tyrosine phosphatase [Trichophyton equinum CBS 127.97]
          Length = 265

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 10/113 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E      D GI  
Sbjct: 55  NNFAEVV-KGIYRSSFPMPVHLSSLA-QLNLKTIVTL---VEEEWSPEYSAFVRDKGITS 109

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
              P+ A ++ N        ++ L  +L T   P+++HC  G  RTG   A +
Sbjct: 110 RIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACF 162


>gi|255932299|ref|XP_002557706.1| Pc12g08770 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582325|emb|CAP80504.1| Pc12g08770 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 289

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 79/192 (41%), Gaps = 43/192 (22%)

Query: 40  FTQNFHAVVPHEIYRSAQPN---GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
            + + + V P  IYRS   +   GT    +  + G+ +I +LR +      +++  + + 
Sbjct: 45  LSHDGNQVRPGFIYRSGTLSDIYGTGKSVIATQLGVTTIFDLRNE----GERQKAPSPSI 100

Query: 97  LGIQLINFPLSA---TRELNDEQ---------IKQLISILKTAP---------------K 129
            G++ I  P  A   T  L D           +K  + IL+ A                 
Sbjct: 101 TGVKTIWLPYGARPATLNLGDFTGADKGAAGFVKMYLGILEAATPSFMEIFKHIRDKPHD 160

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           P ++HC +G DRTG+ SA+ L ++     +  H ++   Y    +L  + ++   E + +
Sbjct: 161 PFIVHCSAGKDRTGVFSALVLLLI-----DRPHDEIVNDY----ILTRVGLESARENLME 211

Query: 190 LYPNNVSKGDTE 201
            +  N+  G  +
Sbjct: 212 AFAVNLGAGGVD 223


>gi|158288754|ref|XP_310601.4| AGAP000492-PA [Anopheles gambiae str. PEST]
 gi|157018722|gb|EAA06425.4| AGAP000492-PA [Anopheles gambiae str. PEST]
          Length = 365

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 47/97 (48%), Gaps = 11/97 (11%)

Query: 61  TFIEYLKKEYGIKSI-LNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
            ++EY ++ +    + LN+R        K + KA  + G Q  +         +D+ ++Q
Sbjct: 184 AYLEYFRRNHVTTVVRLNMR--------KYDAKAFTEAGFQHHDLIFPDGSNPDDDILQQ 235

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            + I ++    + +HCK+G  RTG  + +  Y++ HY
Sbjct: 236 FLKICESTGGAVAVHCKAGLGRTG--TLIGAYLIKHY 270


>gi|119613063|gb|EAW92657.1| hCG32512, isoform CRA_d [Homo sapiens]
          Length = 500

 Score = 39.3 bits (90), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFK-NHNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|296189505|ref|XP_002742803.1| PREDICTED: dual specificity protein phosphatase CDC14B [Callithrix
           jacchus]
          Length = 461

 Score = 39.3 bits (90), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
           Y    P+ T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +     
Sbjct: 203 YHQHSPD-TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTP 254

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            D  +K+ + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 255 ADAIVKEFLDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 296


>gi|15451936|ref|NP_201588.1| dual specificity protein phosphatase CDC14B isoform 2 [Homo
           sapiens]
 gi|114625681|ref|XP_001152707.1| PREDICTED: CDC14 homolog B isoform 6 [Pan troglodytes]
 gi|114625683|ref|XP_520708.2| PREDICTED: CDC14 homolog B isoform 10 [Pan troglodytes]
 gi|297684892|ref|XP_002820045.1| PREDICTED: dual specificity protein phosphatase CDC14B-like isoform
           1 [Pongo abelii]
 gi|55976216|sp|O60729|CC14B_HUMAN RecName: Full=Dual specificity protein phosphatase CDC14B; AltName:
           Full=CDC14 cell division cycle 14 homolog B
 gi|3136332|gb|AAC16661.1| Cdc14B2 phosphatase [Homo sapiens]
 gi|57160682|emb|CAI39616.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|57162205|emb|CAI40536.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|119613065|gb|EAW92659.1| hCG32512, isoform CRA_f [Homo sapiens]
 gi|162319048|gb|AAI56667.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [synthetic
           construct]
 gi|307685951|dbj|BAJ20906.1| CDC14 cell division cycle 14 homolog B [synthetic construct]
          Length = 498

 Score = 39.3 bits (90), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFK-NHNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|114625685|ref|XP_001152444.1| PREDICTED: CDC14 homolog B isoform 2 [Pan troglodytes]
          Length = 495

 Score = 39.3 bits (90), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFK-NHNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|332865189|ref|XP_003318472.1| PREDICTED: dual specificity protein phosphatase CDC14C-like isoform
           2 [Pan troglodytes]
          Length = 554

 Score = 38.9 bits (89), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 324 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 376

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 377 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 410


>gi|269849544|sp|A4D256|CC14C_HUMAN RecName: Full=Dual specificity protein phosphatase CDC14C; AltName:
           Full=CDC14 cell division cycle 14 homolog C
          Length = 554

 Score = 38.9 bits (89), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 324 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 376

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 377 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 410


>gi|51094655|gb|EAL23906.1| hypothetical protein MGC26484 [Homo sapiens]
          Length = 554

 Score = 38.9 bits (89), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 324 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKRF 376

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 377 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 410


>gi|89096042|ref|ZP_01168935.1| hypothetical protein B14911_25135 [Bacillus sp. NRRL B-14911]
 gi|89088896|gb|EAR68004.1| hypothetical protein B14911_25135 [Bacillus sp. NRRL B-14911]
          Length = 294

 Score = 38.9 bits (89), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (46%), Gaps = 19/148 (12%)

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI---QLINFPLSATRELNDEQIKQLI 121
           + + E G    +  R KL     KE +K+A  +G+   ++ +FP     E+N E+IKQ+I
Sbjct: 88  FTRGEAGPDGGVVPRDKLGAERTKEVKKSAEIIGVDRLEIFDFPDGGLEEVNGEEIKQVI 147

Query: 122 SILKTAPKPLLIHCKSGADRTGLAS----AVYLYIVAHYPKEEAHRQLSMLYGHF----- 172
             L T  KP ++   S  D  GL       V   +V    KEE  +  S +  H+     
Sbjct: 148 RDLITEIKPTVLI--SYDDEIGLYGHPDHVVTGQLVREVAKEELFKGNSSVKRHYMVTLP 205

Query: 173 -PVLK-TITMDITFEKITQLYPNNVSKG 198
            P+++  + +  TF+   + YP + SKG
Sbjct: 206 KPMIEVALKLSPTFK---EKYPKDTSKG 230


>gi|159483417|ref|XP_001699757.1| cell division cycle protein 14 [Chlamydomonas reinhardtii]
 gi|158281699|gb|EDP07453.1| cell division cycle protein 14 [Chlamydomonas reinhardtii]
          Length = 306

 Score = 38.9 bits (89), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
           YR   P   + EY ++  G+ +I+ L  K+       + K   D G +            
Sbjct: 171 YRLHTPE-DYWEYFRRR-GVTTIVRLNKKV------YDRKRFLDGGFKHHEMYFPDGSCP 222

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ND  I++ +  ++  P  + +HCK+G  RTG+   + LYI+ HY
Sbjct: 223 NDAIIQRFLDTVEAEPGSIAVHCKAGLGRTGV--LICLYIMKHY 264


>gi|226306519|ref|YP_002766479.1| protein-tyrosine-phosphatase [Rhodococcus erythropolis PR4]
 gi|226185636|dbj|BAH33740.1| putative protein-tyrosine-phosphatase [Rhodococcus erythropolis
           PR4]
          Length = 266

 Score = 38.9 bits (89), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            QL + L T   P L HC +G DRTG A+A+ L  +A  P+E
Sbjct: 141 SQLFAALATTAGPQLFHCTAGKDRTGWAAAL-LQTLAGVPRE 181


>gi|154321169|ref|XP_001559900.1| hypothetical protein BC1G_01459 [Botryotinia fuckeliana B05.10]
 gi|150851997|gb|EDN27189.1| hypothetical protein BC1G_01459 [Botryotinia fuckeliana B05.10]
          Length = 198

 Score = 38.9 bits (89), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 25/111 (22%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE------LNDEQIK- 118
           +K+ YGI++IL+LR        K+ +K A D+   ++    SA RE      +N  +I  
Sbjct: 7   VKEHYGIRTILDLRTVTEHD--KQAKKRATDMRDPVLTASNSALRESMKIPGINYREINV 64

Query: 119 ----------------QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
                            +++       P+L HC  G DRTGL  A+ L+I+
Sbjct: 65  NGKGFERSLVWQLSPYSIVTYCSPENYPILAHCTQGKDRTGLTIALILFIL 115


>gi|255034226|ref|YP_003084847.1| hypothetical protein Dfer_0413 [Dyadobacter fermentans DSM 18053]
 gi|254946982|gb|ACT91682.1| conserved hypothetical protein, membrane [Dyadobacter fermentans
           DSM 18053]
          Length = 773

 Score = 38.9 bits (89), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 40  FTQNFHAVVPHEIY-RSAQPNGTFIEYLKKEYGIKSILNLRGKLPE 84
           F +NF+ V+P E+   + QPNG F +  K  Y IK+  N   K PE
Sbjct: 446 FEKNFNGVLPFEVMINTKQPNGVFADQAKTLYKIKAFQNEMAKFPE 491


>gi|71019803|ref|XP_760132.1| hypothetical protein UM03985.1 [Ustilago maydis 521]
 gi|46099762|gb|EAK84995.1| hypothetical protein UM03985.1 [Ustilago maydis 521]
          Length = 569

 Score = 38.9 bits (89), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 10/107 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V  H +YRS+ P      +L+   G++S+L L   + E + +      +  GI  
Sbjct: 365 DNFAMVNSH-VYRSSFPKKKHFPFLRT-LGLRSVLTL---ILEEYPETNSTFLDQNGITF 419

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
             F +   +E       D+    L++IL     P+LIHC  G  RTG
Sbjct: 420 FQFGIPGNKEPFVSIPTDKITSALVTILDRRNHPILIHCNKGKHRTG 466


>gi|94495152|ref|ZP_01301733.1| hypothetical protein SKA58_01625 [Sphingomonas sp. SKA58]
 gi|94425418|gb|EAT10438.1| hypothetical protein SKA58_01625 [Sphingomonas sp. SKA58]
          Length = 254

 Score = 38.9 bits (89), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 57/134 (42%), Gaps = 31/134 (23%)

Query: 52  IYRSAQPNGTFIEYLKK--EYGIKSILNLRGKL-----PESWHKEEEKAAN-----DLGI 99
           ++RS  P   F ++  +  + G +S+ +LR  +     P  W   + +  +     DL  
Sbjct: 29  LFRSEGPASFFEDHHAELSDLGFRSVADLRSTIERDAAPHGWCGPDCRMLDLDMNTDLRA 88

Query: 100 QLINFPLSATRELNDEQ-------------------IKQLISILKTAPKPLLIHCKSGAD 140
           Q  +  LS  RE    +                   + +++  L     P+L+HC +G D
Sbjct: 89  QGEDMWLSLGREPTAARAVEVMTHNYGLMPQAFLPHLSRMVDALLAQDTPMLVHCTAGKD 148

Query: 141 RTGLASAVYLYIVA 154
           RTG+  A++L ++A
Sbjct: 149 RTGVVVALFLDLLA 162


>gi|262376560|ref|ZP_06069789.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262308699|gb|EEY89833.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 174

 Score = 38.9 bits (89), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 8/112 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  +  H ++ S QP  T ++ L KEYG+ +++N+     E +   E+K   +LG+  
Sbjct: 12  ENFQFIHEH-LFSSGQPTTTQLQ-LMKEYGVSTVINVALTDSEQYLPHEDKICLELGLNY 69

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKP--LLIHCKSGADRTGLASAVYLY 151
           I  P+S     +D Q   ++ ++    K   + +HC      + L   +YLY
Sbjct: 70  IQVPISWETP-SDNQCLLVLDLIDHLVKEQMVWVHCSQNYHVSCL---MYLY 117


>gi|297684896|ref|XP_002820047.1| PREDICTED: dual specificity protein phosphatase CDC14B-like isoform
           3 [Pongo abelii]
          Length = 581

 Score = 38.9 bits (89), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 330 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 382

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 383 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 416


>gi|94968590|ref|YP_590638.1| dual specificity protein phosphatase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94550640|gb|ABF40564.1| dual specificity protein phosphatase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 168

 Score = 38.9 bits (89), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 59/111 (53%), Gaps = 11/111 (9%)

Query: 68  KEYGIKSILNL--RGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK 125
           ++ GI +IL+L   G+ P  W  E E   N+L I   + P+        +++++++ +L 
Sbjct: 36  QKIGITTILSLLTPGERP-GWDNEGE-ICNELDINFYSLPIRDHSVPRPDEMQKVVDVLT 93

Query: 126 T------APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYG 170
                  A + ++ HC +G  R+G+A+ V L ++A  P E+A  ++S+  G
Sbjct: 94  KVEARLKAGERVVAHCFAGIGRSGIAT-VGLLMIAGIPMEDAIDRVSLARG 143


>gi|326935133|ref|XP_003213633.1| PREDICTED: dual specificity protein phosphatase CDC14B-like,
           partial [Meleagris gallopavo]
          Length = 306

 Score = 38.9 bits (89), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 52/115 (45%), Gaps = 18/115 (15%)

Query: 49  PHEIYRSAQPNG-------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           PH   RS   NG        +  Y +K + + +I+ L  K+ ++      +   D G + 
Sbjct: 90  PHS--RSKIENGYPHHAPEAYFPYFRK-HKVTTIIRLNKKMYDA------RRFTDAGFEH 140

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            +   +     ND  +K  +SI + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 141 FDLFFADGSIPNDTIVKAFLSICENAEGVIAVHCKAGLGRTG--TLIACYIMKHY 193


>gi|229583274|ref|YP_002841673.1| dual specificity protein phosphatase [Sulfolobus islandicus
           Y.N.15.51]
 gi|228013990|gb|ACP49751.1| dual specificity protein phosphatase [Sulfolobus islandicus
           Y.N.15.51]
          Length = 161

 Score = 38.9 bits (89), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 14/115 (12%)

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL--------GIQLINFPLSATRELN 113
            +E+ K+  G+K +L     LPE W  EE     D         G+Q ++ P+      +
Sbjct: 21  ILEWRKE--GVKRVL----VLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIPDGGVPS 74

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML 168
           D Q   ++  L +  +  L+HC  G  RTG   A YL +      E A  ++ ++
Sbjct: 75  DSQFLTIMKWLLSEKEGNLVHCVGGIGRTGTILASYLILTEELEVESAIDEVRLV 129


>gi|229493688|ref|ZP_04387473.1| protein-tyrosine phosphatase [Rhodococcus erythropolis SK121]
 gi|229319649|gb|EEN85485.1| protein-tyrosine phosphatase [Rhodococcus erythropolis SK121]
          Length = 256

 Score = 38.9 bits (89), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            QL + L T   P L HC +G DRTG A+A+ L  +A  P+E
Sbjct: 131 SQLFAALATTEGPQLFHCTAGKDRTGWAAAL-LQTLAGVPRE 171


>gi|213403272|ref|XP_002172408.1| tyrosine-protein phosphatase SIW14 [Schizosaccharomyces japonicus
           yFS275]
 gi|212000455|gb|EEB06115.1| tyrosine-protein phosphatase SIW14 [Schizosaccharomyces japonicus
           yFS275]
          Length = 244

 Score = 38.9 bits (89), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 58/146 (39%), Gaps = 33/146 (22%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P+     +L + + I+SIL+LR    E +  EE        IQ  
Sbjct: 65  NFGVVCPGLVYRSGCPSLQAFPFLHQLH-IRSILSLR---QEEYTDEELAYMRQNNIQYF 120

Query: 103 NFPLSATR------------------------ELNDEQIKQLIS-----ILKTAPKPLLI 133
           +  +  ++                        E ND  I  L+      +L +   P+L+
Sbjct: 121 HIAMPGSKLRKNGSSTSSSSATSTSNSTEVAGEFNDIDIDALVHKALSVLLDSKNLPILV 180

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKE 159
           HC  G  RTG+    +  ++   P++
Sbjct: 181 HCSGGKHRTGIVIGCFRALLGWQPEK 206


>gi|164658257|ref|XP_001730254.1| hypothetical protein MGL_2636 [Malassezia globosa CBS 7966]
 gi|159104149|gb|EDP43040.1| hypothetical protein MGL_2636 [Malassezia globosa CBS 7966]
          Length = 287

 Score = 38.9 bits (89), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF A+V   +YRS+ P     ++LK   G++S+L L   + E + ++  +  ++ GI+ 
Sbjct: 95  DNF-AMVNSWVYRSSFPKKKHFQFLKT-LGLRSVLTL---ILEDYPEQNIQFLDENGIRF 149

Query: 102 INFPLSATRE----LNDEQI-KQLISILKTAPKPLLIHCKSGADRTG 143
             + +   +E    +  E I   L +IL     P+LIHC  G  RTG
Sbjct: 150 FQYGIPGNKEPFVQIPSETITAALATILDRRNHPMLIHCNKGKHRTG 196


>gi|212634503|ref|YP_002311028.1| tyrosine-specific protein phosphatase [Shewanella piezotolerans
           WP3]
 gi|212555987|gb|ACJ28441.1| Tyrosine-specific protein phosphatase, putative [Shewanella
           piezotolerans WP3]
          Length = 156

 Score = 38.9 bits (89), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 18/121 (14%)

Query: 42  QNFHAVVPHEIYRSAQPN--GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           Q+   +V  +I   + PN     +  LK E GI +IL++           E++  + +GI
Sbjct: 2   QHLFWLVEGQIAGRSGPNKDAWDLSELKGE-GIDAILSVNNG-----ESCEDEDFSSVGI 55

Query: 100 Q--LINFPLSATRELND-----EQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVY 149
           +   I F  +A  E  D     EQ+ + ++ ++      K +LIHC+SG DRTGL  A Y
Sbjct: 56  EYKCIPFSRNAPPEAGDLEYCVEQVPKALAYIRQCEAQNKTVLIHCRSGKDRTGLIMAYY 115

Query: 150 L 150
           L
Sbjct: 116 L 116


>gi|294463032|gb|ADE77054.1| unknown [Picea sitchensis]
          Length = 194

 Score = 38.9 bits (89), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 9/105 (8%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           +A+V   +YRS  P+     YL+    ++SI+ L    PE + +   +      IQL  F
Sbjct: 27  YAMVHKGVYRSGFPSAVNFPYLET-LRLRSIIYL---CPEPYPEANTEFLRAHNIQLFQF 82

Query: 105 PLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGL 144
            +   +E    + ++ I++ + +L      P+LIHCK G  RTG 
Sbjct: 83  GIEGHKEPFVNIPEDTIREALKVLLDPRNHPVLIHCKRGKHRTGC 127


>gi|197122591|ref|YP_002134542.1| dual specificity protein phosphatase [Anaeromyxobacter sp. K]
 gi|196172440|gb|ACG73413.1| dual specificity protein phosphatase [Anaeromyxobacter sp. K]
          Length = 189

 Score = 38.9 bits (89), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 57/112 (50%), Gaps = 11/112 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           + H V P     +  P    +  L +E+GI+ +L++RG+       ++ +A    GI+L+
Sbjct: 3   DLHFVAPGLAVGACFPADAALR-LAREHGIQRVLDVRGEA-----CDDAEALGACGIRLL 56

Query: 103 NFPLSATRELNDEQIKQLISI----LKTAPKPLLIHCKSGADRTGLASAVYL 150
           + P   T  ++ E++++ ++     L+   + +L+HC+ G  R+ L +   L
Sbjct: 57  HLPTRDTCAVSQERLREGVAFACEGLERGER-VLVHCQYGIGRSALVALCVL 107


>gi|319947961|ref|ZP_08022141.1| tyrosine phosphatase [Dietzia cinnamea P4]
 gi|319438389|gb|EFV93329.1| tyrosine phosphatase [Dietzia cinnamea P4]
          Length = 293

 Score = 38.9 bits (89), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           + +S+L  +P P ++HC +G DRTG  SA+   +V 
Sbjct: 169 RAVSVLAESPGPAIVHCTAGKDRTGWVSALLQLLVG 204


>gi|260772401|ref|ZP_05881317.1| hypothetical protein VIB_000849 [Vibrio metschnikovii CIP 69.14]
 gi|260611540|gb|EEX36743.1| hypothetical protein VIB_000849 [Vibrio metschnikovii CIP 69.14]
          Length = 139

 Score = 38.9 bits (89), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 71  GIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           G KS++N R    ES     +  E+ A+ LG+  ++ P+    ++++ QI Q   +L+T 
Sbjct: 29  GFKSVINNRPDGEESGQPLNQVIEQHADQLGLVYVHLPVVGG-QISEAQIHQFGELLQTL 87

Query: 128 PKPLLIHCKSGADRTGLAS 146
           P+P+L  C++G   + L S
Sbjct: 88  PQPILAFCRTGTRSSMLWS 106


>gi|227826651|ref|YP_002828430.1| dual specificity protein phosphatase [Sulfolobus islandicus
           M.14.25]
 gi|229583815|ref|YP_002842316.1| dual specificity protein phosphatase [Sulfolobus islandicus
           M.16.27]
 gi|227458446|gb|ACP37132.1| dual specificity protein phosphatase [Sulfolobus islandicus
           M.14.25]
 gi|228018864|gb|ACP54271.1| dual specificity protein phosphatase [Sulfolobus islandicus
           M.16.27]
 gi|323473730|gb|ADX84336.1| dual specificity protein phosphatase [Sulfolobus islandicus REY15A]
 gi|323476382|gb|ADX81620.1| dual specificity protein phosphatase [Sulfolobus islandicus
           HVE10/4]
          Length = 161

 Score = 38.9 bits (89), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 14/115 (12%)

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL--------GIQLINFPLSATRELN 113
            +E+ K+  G+K +L     LPE W  EE     D         G+Q ++ P+      +
Sbjct: 21  ILEWRKE--GVKRVL----VLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIQDGGVPS 74

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML 168
           D Q   ++  L +  +  L+HC  G  RTG   A YL +      E A  ++ ++
Sbjct: 75  DSQFLTIMRWLLSEKEGNLVHCVGGIGRTGTILASYLILSEGLDVESAINEVRLV 129


>gi|108803961|ref|YP_643898.1| protein tyrosine phosphatase/dual specificity protein phosphatase
           [Rubrobacter xylanophilus DSM 9941]
 gi|108765204|gb|ABG04086.1| protein tyrosine phosphatase / dual specificity protein phosphatase
           [Rubrobacter xylanophilus DSM 9941]
          Length = 189

 Score = 38.9 bits (89), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 92  KAANDLGIQLINFPL---SATRELNDEQ----IKQLISILKTAPKPLLIHCKSGADRTGL 144
           ++A + G+++ +FP+      R   DE+    I  +I  L+   K +++HC+ G  RTG 
Sbjct: 80  ESAREAGLKVRHFPILDVDVPRPEQDEEYAEYIGDIIGDLREG-KTVIVHCRGGIGRTGT 138

Query: 145 ASAVYLYIVAHYPKE 159
            +A  L  + H P E
Sbjct: 139 VAASVLVGLGHEPDE 153


>gi|302921727|ref|XP_003053340.1| hypothetical protein NECHADRAFT_103887 [Nectria haematococca mpVI
           77-13-4]
 gi|256734280|gb|EEU47627.1| hypothetical protein NECHADRAFT_103887 [Nectria haematococca mpVI
           77-13-4]
          Length = 268

 Score = 38.5 bits (88), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 117 IKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           IK ++S L K  P PLL+HC +G DRTG+  A  L I  
Sbjct: 135 IKTILSHLAKPDPSPLLVHCTAGKDRTGVVCAFVLSICG 173


>gi|329668025|gb|AEB93973.1| protein tyrosine/serine phosphatase [Lactobacillus johnsonii DPC
           6026]
          Length = 267

 Score = 38.5 bits (88), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 107 SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           S ++E + +    L+SI   T    ++ HC  G DRTGLA+ + LYI+ 
Sbjct: 123 SVSKEYSQKAFNSLLSIFANTKDGAIIFHCSEGKDRTGLATVLILYILG 171


>gi|242066678|ref|XP_002454628.1| hypothetical protein SORBIDRAFT_04g034500 [Sorghum bicolor]
 gi|241934459|gb|EES07604.1| hypothetical protein SORBIDRAFT_04g034500 [Sorghum bicolor]
          Length = 223

 Score = 38.5 bits (88), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 54/118 (45%), Gaps = 22/118 (18%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P+     +L     ++SI+ L    PE + +E  +     GIQL 
Sbjct: 58  NF-AMVDDGIFRSGLPDAANFRFLLS-LNLRSIVYL---CPEPYPEENVQFLQQNGIQLH 112

Query: 103 NFPLSATRE----------------LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTG 143
            F +  ++                 + +E I++ +  IL    +P+LIHCK G  RTG
Sbjct: 113 QFGIEGSKSGPTVPDTMLAQEPFVYIPEETIREALKVILDVRNQPVLIHCKRGKHRTG 170


>gi|238763673|ref|ZP_04624633.1| Protein tyrosine/serine phosphatase [Yersinia kristensenii ATCC
           33638]
 gi|238698151|gb|EEP90908.1| Protein tyrosine/serine phosphatase [Yersinia kristensenii ATCC
           33638]
          Length = 265

 Score = 38.5 bits (88), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 112 LNDEQIKQLISILKTAPKP------LLIHCKSGADRTGLASAVYLYIVA 154
            N++  KQL+S+L+ +  P      ++ HC  G DRTG+ SA+ L+ + 
Sbjct: 128 FNNQAYKQLVSLLQNSASPEHAAAGVIQHCAVGKDRTGVGSALVLFALG 176


>gi|302867762|ref|YP_003836399.1| tyrosine phosphatase [Micromonospora aurantiaca ATCC 27029]
 gi|302570621|gb|ADL46823.1| tyrosine phosphatase [Micromonospora aurantiaca ATCC 27029]
          Length = 226

 Score = 38.5 bits (88), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 49/96 (51%), Gaps = 18/96 (18%)

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI---------- 117
           ++ G++++++LR  + E   + +  A   LG++  +FP+   +   D+Q+          
Sbjct: 52  EDLGLRTVIDLR-SIREVADRPDRCAG--LGVKHCHFPVFTEQSWPDDQVALYPYMAEQA 108

Query: 118 -KQLISILKT----APKPLLIHCKSGADRTGLASAV 148
            +  ++I++        P L+HC SG DRTG+  AV
Sbjct: 109 GRATVAIIRQLITPGALPALVHCASGKDRTGVVVAV 144


>gi|327294633|ref|XP_003232012.1| hypothetical protein TERG_07628 [Trichophyton rubrum CBS 118892]
 gi|326465957|gb|EGD91410.1| hypothetical protein TERG_07628 [Trichophyton rubrum CBS 118892]
          Length = 265

 Score = 38.5 bits (88), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 10/113 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E      D GI  
Sbjct: 55  NNFAEVV-KGIYRSSFPMPVHLSSLA-QLNLKTIVTL---VEEEWSPEYSAFVRDKGITS 109

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
              P+ A ++ N        ++ L  +L T   P+++HC  G  RTG   A +
Sbjct: 110 RIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCIMACF 162


>gi|227509120|ref|ZP_03939169.1| protein-tyrosine phosphatase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227525012|ref|ZP_03955061.1| protein-tyrosine phosphatase [Lactobacillus hilgardii ATCC 8290]
 gi|227087823|gb|EEI23135.1| protein-tyrosine phosphatase [Lactobacillus hilgardii ATCC 8290]
 gi|227191397|gb|EEI71464.1| protein-tyrosine phosphatase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 284

 Score = 38.5 bits (88), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
            +++L    K +L HC SG DRTGL  A+ +Y++ 
Sbjct: 160 FMTLLNANDKAVLWHCASGKDRTGLGGALIMYVLG 194


>gi|194014558|ref|ZP_03053175.1| putative protein-tyrosine-phosphatase [Bacillus pumilus ATCC 7061]
 gi|194013584|gb|EDW23149.1| putative protein-tyrosine-phosphatase [Bacillus pumilus ATCC 7061]
          Length = 268

 Score = 38.5 bits (88), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 115 EQIKQLISILKTAPK-PLLIHCKSGADRTGLASAV 148
           E+I+QL ++L      PL++HC SG DRTG  SA+
Sbjct: 127 EEIQQLFTLLSDKSNYPLMLHCTSGKDRTGFLSAL 161


>gi|238759609|ref|ZP_04620770.1| Protein tyrosine/serine phosphatase [Yersinia aldovae ATCC 35236]
 gi|238702152|gb|EEP94708.1| Protein tyrosine/serine phosphatase [Yersinia aldovae ATCC 35236]
          Length = 254

 Score = 38.5 bits (88), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 112 LNDEQIKQLISILKTAPKP------LLIHCKSGADRTGLASAVYLYIVA 154
            N++  KQL+S+L+ +  P      ++ HC  G DRTG+ SA+ L+ + 
Sbjct: 117 FNNQAYKQLVSLLQNSASPEHAAAGVVQHCAVGKDRTGVGSALVLFALG 165


>gi|15899198|ref|NP_343803.1| hypothetical protein SSO2453 [Sulfolobus solfataricus P2]
 gi|227829292|ref|YP_002831071.1| tyrosine specific protein phosphatase [Sulfolobus islandicus
           L.S.2.15]
 gi|229578062|ref|YP_002836460.1| dual specificity protein phosphatase [Sulfolobus islandicus
           Y.G.57.14]
 gi|284996649|ref|YP_003418416.1| tyrosine specific protein phosphatase [Sulfolobus islandicus
           L.D.8.5]
 gi|145579561|pdb|2I6I|A Chain A, Crystal Structures Of The Archaeal Sulfolobus Ptp-Fold
           Phosphatase
 gi|145579562|pdb|2I6J|A Chain A, Crystal Structure Of The Complex Of The Archaeal
           Sulfolobus Ptp-Fold Phosphatase With Phosphate Ion
 gi|145579563|pdb|2I6M|A Chain A, Crystal Structure Of The Complexes Of The Archaeal
           Sulfolobus Ptp-Fold Phosphatase With Tungstate
 gi|13815756|gb|AAK42593.1| Conserved hypothetical protein [Sulfolobus solfataricus P2]
 gi|227455739|gb|ACP34426.1| tyrosine specific protein phosphatase [Sulfolobus islandicus
           L.S.2.15]
 gi|228008776|gb|ACP44538.1| dual specificity protein phosphatase [Sulfolobus islandicus
           Y.G.57.14]
 gi|284444544|gb|ADB86046.1| tyrosine specific protein phosphatase [Sulfolobus islandicus
           L.D.8.5]
          Length = 161

 Score = 38.5 bits (88), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 14/115 (12%)

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL--------GIQLINFPLSATRELN 113
            +E+ K+  G+K +L     LPE W  EE     D         G+Q ++ P+      +
Sbjct: 21  ILEWRKE--GVKRVL----VLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIPDGGVPS 74

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML 168
           D Q   ++  L +  +  L+HC  G  RTG   A YL +      E A  ++ ++
Sbjct: 75  DSQFLTIMKWLLSEKEGNLVHCVGGIGRTGTILASYLILTEGLEVESAIDEVRLV 129


>gi|227512026|ref|ZP_03942075.1| possible protein-tyrosine-phosphatase [Lactobacillus buchneri ATCC
           11577]
 gi|227084678|gb|EEI19990.1| possible protein-tyrosine-phosphatase [Lactobacillus buchneri ATCC
           11577]
          Length = 284

 Score = 38.5 bits (88), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
            +++L    K +L HC SG DRTGL  A+ +Y++ 
Sbjct: 160 FMTLLNANDKAVLWHCASGKDRTGLGGALIMYVLG 194


>gi|226304300|ref|YP_002764258.1| protein-tyrosine-phosphatase [Rhodococcus erythropolis PR4]
 gi|226183415|dbj|BAH31519.1| putative protein-tyrosine-phosphatase [Rhodococcus erythropolis
           PR4]
          Length = 244

 Score = 38.5 bits (88), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           Q+ +++ +      P L+HC +G DRTG+A+A+ L I  
Sbjct: 120 QLAKVLEVAAVCDGPFLLHCAAGKDRTGIAAALLLSIAG 158


>gi|207725072|ref|YP_002255469.1| tyrosine phosphatase protein [Ralstonia solanacearum MolK2]
 gi|206590302|emb|CAQ37263.1| tyrosine phosphatase protein [Ralstonia solanacearum MolK2]
          Length = 216

 Score = 38.5 bits (88), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 57/146 (39%), Gaps = 19/146 (13%)

Query: 43  NFHAVV--PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  V   P  IYR  QP         KE  +K I+ L          +E+K A    I+
Sbjct: 48  NFGVVSEGPISIYRGGQPVDDKEWQFLKEKKVKDIVKLNKYSEAVSESDEDKFAEKYNIK 107

Query: 101 LI-----------NFPLSATRELNDEQIKQLISI------LKTAPKPLLIHCKSGADRTG 143
           +I               S   +L++   K  ++       +     P+ +HC  G DRTG
Sbjct: 108 VIKVFMGPEDCVPGVHCSIDPDLDEMPAKNSVATAIEEITVAAGNGPVYVHCSHGQDRTG 167

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLY 169
           L  A+Y   V  Y K++A  + +  +
Sbjct: 168 LVVALYRMRVQGYCKKKADDERNQYH 193


>gi|170726100|ref|YP_001760126.1| dual specificity protein phosphatase [Shewanella woodyi ATCC 51908]
 gi|169811447|gb|ACA86031.1| dual specificity protein phosphatase [Shewanella woodyi ATCC 51908]
          Length = 156

 Score = 38.5 bits (88), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 10/56 (17%)

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           +DLGI +   P  A   + D + K L         P+LIHC+SG DRTGL  A YL
Sbjct: 71  DDLGICVEQLP-KALAFIRDCEAKDL---------PVLIHCRSGKDRTGLLMAYYL 116


>gi|212710322|ref|ZP_03318450.1| hypothetical protein PROVALCAL_01381 [Providencia alcalifaciens DSM
           30120]
 gi|212687129|gb|EEB46657.1| hypothetical protein PROVALCAL_01381 [Providencia alcalifaciens DSM
           30120]
          Length = 260

 Score = 38.5 bits (88), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLI-HCKSGADRTGLASAVYLYIVA 154
           Q   F L     LN+    QL+S+LK   K  L+ HC  G DRTG+ SA+ L+ + 
Sbjct: 116 QAFMFRLYELLPLNNAAYHQLVSMLKQPEKGGLVQHCAVGKDRTGIGSALVLFALG 171


>gi|134098365|ref|YP_001104026.1| protein tyrosine/serine phosphatase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291006933|ref|ZP_06564906.1| protein tyrosine/serine phosphatase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133910988|emb|CAM01101.1| protein tyrosine/serine phosphatase [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 245

 Score = 38.5 bits (88), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 3/40 (7%)

Query: 114 DEQIKQLISILK---TAPKPLLIHCKSGADRTGLASAVYL 150
           D   K+L+ + +    +  P+LIHC +G DRTG+ASA+ L
Sbjct: 112 DRAAKKLVEVFRIVLESDGPVLIHCAAGKDRTGVASAMLL 151


>gi|229820531|ref|YP_002882057.1| protein tyrosine/serine phosphatase [Beutenbergia cavernae DSM
           12333]
 gi|229566444|gb|ACQ80295.1| protein tyrosine/serine phosphatase [Beutenbergia cavernae DSM
           12333]
          Length = 270

 Score = 38.5 bits (88), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGL 144
           E +   + ++ T+P P+L+HC +G DRTGL
Sbjct: 149 EALGTALQLVATSPGPVLVHCAAGKDRTGL 178


>gi|123440644|ref|YP_001008365.1| hypothetical protein YE0252 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087605|emb|CAL10386.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 265

 Score = 38.5 bits (88), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 112 LNDEQIKQLISILKTAPKP------LLIHCKSGADRTGLASAVYLYIVA 154
            N++  KQL+S+L+ +  P      ++ HC  G DRTG+ SA+ L+ + 
Sbjct: 128 FNNQAYKQLVSLLQNSASPEHAAAGVVQHCAVGKDRTGVGSALVLFALG 176


>gi|332159877|ref|YP_004296454.1| hypothetical protein YE105_C0253 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607573|emb|CBY29071.1| protein tyrosine phosphatase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664107|gb|ADZ40751.1| hypothetical protein YE105_C0253 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330859144|emb|CBX69496.1| hypothetical protein YEW_EW21010 [Yersinia enterocolitica W22703]
          Length = 265

 Score = 38.5 bits (88), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 112 LNDEQIKQLISILKTAPKP------LLIHCKSGADRTGLASAVYLYIVA 154
            N++  KQL+S+L+ +  P      ++ HC  G DRTG+ SA+ L+ + 
Sbjct: 128 FNNQAYKQLVSLLQNSASPEHAAAGVVQHCAVGKDRTGVGSALVLFALG 176


>gi|261346536|ref|ZP_05974180.1| tyrosine specific protein phosphatase [Providencia rustigianii DSM
           4541]
 gi|282565240|gb|EFB70775.1| tyrosine specific protein phosphatase [Providencia rustigianii DSM
           4541]
          Length = 260

 Score = 38.5 bits (88), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 112 LNDEQIKQLISILKTAPKPLLI-HCKSGADRTGLASAVYLYIVA 154
           LN+    QL+S+LK   K  L+ HC  G DRTG+ SA+ L+ + 
Sbjct: 128 LNNAAYHQLVSMLKQPEKGGLVQHCAVGKDRTGIGSALVLFALG 171


>gi|207341642|gb|EDZ69639.1| YNL032Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 219

 Score = 38.5 bits (88), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        GI+L
Sbjct: 120 ENFSHVVG-EIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLTGIKL 175

Query: 102 INFPLSATRE--LNDEQ---IKQLISILKTAPKPLLIHCKSG 138
               +S  +E  +N       K L  +L  A +P+LIHC  G
Sbjct: 176 YQVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRG 217


>gi|225554558|gb|EEH02855.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 269

 Score = 38.1 bits (87), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMD 181
           I   + +PLL HC +G DRTG+ +A+ L+I      E   R+  +       L+  ++D
Sbjct: 141 IRDRSEEPLLFHCSAGKDRTGVCAALILWIAGVQDDEVIGREYELTEAGLCELRQQSID 199


>gi|302813786|ref|XP_002988578.1| hypothetical protein SELMODRAFT_447369 [Selaginella moellendorffii]
 gi|300143685|gb|EFJ10374.1| hypothetical protein SELMODRAFT_447369 [Selaginella moellendorffii]
          Length = 774

 Score = 38.1 bits (87), Expect = 0.66,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 54/105 (51%), Gaps = 9/105 (8%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW-HKEEEKAANDLGIQLIN 103
           +A+V   +YR A P      +LK+ + +K+I++L    PE+  +K+      D GI L +
Sbjct: 596 YAIVEESLYRGAYPTMKNFRFLKRLH-LKTIVSLT---PEAQPNKDLRSFCQDQGIHLQH 651

Query: 104 FPLSATRE---LNDEQIKQLI-SILKTAPKPLLIHCKSGADRTGL 144
           F +   ++   L+  Q+ +++  I+     P  +HC  GA  TGL
Sbjct: 652 FHVDKFQDVVTLSHNQVVEILHRIISVENLPAYLHCLDGAHVTGL 696


>gi|291383511|ref|XP_002708314.1| PREDICTED: CDC14 homolog B [Oryctolagus cuniculus]
          Length = 583

 Score = 38.1 bits (87), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I Y K  + + +I+ L  K+ ++      K   D G    +   +      D  +K+ 
Sbjct: 345 TYIPYFKN-HNVTTIIRLNKKMYDA------KRFTDAGFDHHDLFFADGSTPTDTIVKEF 397

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 398 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 431


>gi|297680446|ref|XP_002818002.1| PREDICTED: dual specificity protein phosphatase CDC14C-like [Pongo
           abelii]
          Length = 484

 Score = 38.1 bits (87), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K  
Sbjct: 247 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKGF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|82802746|gb|ABB92424.1| CDC14B2 [Pongo pygmaeus]
          Length = 456

 Score = 38.1 bits (87), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K  
Sbjct: 244 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKGF 296

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 297 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 330


>gi|71419804|ref|XP_811280.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70875926|gb|EAN89429.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 340

 Score = 38.1 bits (87), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L+    +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNFRFLRA-LRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAV 148
            F     +E    +++  + +++S L  T   P+LIHC  G  RTG   A 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVAC 134


>gi|124263088|ref|YP_001023558.1| protein tyrosine/serine phosphatase [Methylibium petroleiphilum
           PM1]
 gi|124262334|gb|ABM97323.1| protein tyrosine/serine phosphatase [Methylibium petroleiphilum
           PM1]
          Length = 254

 Score = 38.1 bits (87), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           E  + L ++ + A +P LIHC SG DRTG  +AV L
Sbjct: 116 EYRRMLEAVEEAAGRPTLIHCVSGKDRTGFGAAVIL 151


>gi|224168487|ref|XP_002190472.1| PREDICTED: similar to dual specificity phosphatase 23 [Taeniopygia
           guttata]
          Length = 183

 Score = 38.1 bits (87), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAH 155
           I+L  FP++     + EQI+  +SI++ A    + + +HC  G  RTG   A YL    H
Sbjct: 57  IRLHRFPVADFTPPSPEQIRSFLSIVEEANGRGEAVAVHCMLGHGRTGTLLACYLCQERH 116

Query: 156 YPKEEAHRQLSML 168
            P  +A R++  L
Sbjct: 117 LPAADAIREIRRL 129


>gi|315056643|ref|XP_003177696.1| tyrosine-protein phosphatase SIW14 [Arthroderma gypseum CBS 118893]
 gi|311339542|gb|EFQ98744.1| tyrosine-protein phosphatase SIW14 [Arthroderma gypseum CBS 118893]
          Length = 265

 Score = 38.1 bits (87), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 66/150 (44%), Gaps = 19/150 (12%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   +YRS+ P    +  L  +  +K+I+ L   + E W  E      + GI  
Sbjct: 55  NNFAEVV-KGVYRSSFPMSVHLSSLA-QLNLKTIVTL---VEEEWSPEYSAFVREKGITS 109

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              P+ A ++ +        ++ L  +L T   P+L+HC  G  RTG        ++A +
Sbjct: 110 RIIPILANKQPDVFTPFSTIVEVLTILLDTRNHPILVHCNKGKHRTGC-------VMACF 162

Query: 157 PKEEAHRQLSML--YGHFPVLKTITMDITF 184
            K +    +S +  Y ++   KT T+D  +
Sbjct: 163 RKAQGWNSVSAIAEYIYYSAPKTRTLDRNY 192


>gi|46130692|ref|XP_389126.1| hypothetical protein FG08950.1 [Gibberella zeae PH-1]
          Length = 266

 Score = 38.1 bits (87), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 111 ELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           E   + I  +IS L K  P PLLIHC +G DRTG+  A  L I  
Sbjct: 129 EAGTKPISTIISHLAKPDPSPLLIHCTAGKDRTGVICAFILSICG 173


>gi|302867750|ref|YP_003836387.1| conventional protein tyrosine phosphatase [Micromonospora
           aurantiaca ATCC 27029]
 gi|302570609|gb|ADL46811.1| conventional protein tyrosine phosphatase [Micromonospora
           aurantiaca ATCC 27029]
          Length = 262

 Score = 38.1 bits (87), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 32/141 (22%)

Query: 34  FLTITTF-------TQNFHAVVPHEIYRS---AQPNGTFIEYLKKEYGIKSILNLR---- 79
           F T+  F       T +   V    +YRS   A+  G  +E      G++++++LR    
Sbjct: 7   FATLCNFRDLGGWRTGDGRTVARGRLYRSDSLAKLAGEDLERFAA-LGVRTVIDLRYPWE 65

Query: 80  ----GKLPES----WH------KEEEKAANDLGIQLINFPLSATRELNDE---QIKQLIS 122
               G+ PES    WH      +   +A  D  +    +      E+ ++   +++Q I 
Sbjct: 66  IADRGRAPESLGVTWHNLSIEHRPYVQADIDPDVDPWRYLADRYAEVAEDGVAELRQAIE 125

Query: 123 ILKTAPKPLLIHCKSGADRTG 143
           ++     PL+ HC SG DRTG
Sbjct: 126 VIADGEHPLVFHCASGKDRTG 146


>gi|328773804|gb|EGF83841.1| hypothetical protein BATDEDRAFT_21375 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 172

 Score = 38.1 bits (87), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (47%), Gaps = 20/120 (16%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
           LY+ TIT F      +V   +YRS QPN     +L+K  G+K+++ L  + P       +
Sbjct: 9   LYYKTITNF-----GLVEERLYRSGQPNELNFPFLEK-LGLKTVIFLAPEEP------NQ 56

Query: 92  KAANDLGIQLINF-------PLSATRELNDEQI-KQLISILKTAPKPLLIHCKSGADRTG 143
           +  N +  Q INF         +A   +++E + + L  +L     P+++ C  G  RTG
Sbjct: 57  RFLNFIDDQEINFFHLGFNSTANAWDPISEEVVLESLEHMLDPRNYPVMVMCNLGRHRTG 116


>gi|71656659|ref|XP_816873.1| tyrosine phosphatase [Trypanosoma cruzi strain CL Brener]
 gi|70882030|gb|EAN95022.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 340

 Score = 38.1 bits (87), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L+    +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNFRFLRA-LRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAV 148
            F     +E    +++  + +++S L  T   P+LIHC  G  RTG   A 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVAC 134


>gi|195642742|gb|ACG40839.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 220

 Score = 38.1 bits (87), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 22/118 (18%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P+     +L     ++SI+ L    PE + +E  +     GI+L 
Sbjct: 54  NF-AMVDDGIFRSGLPDAANFRFLLS-LNLRSIVYL---CPEPYPEENARFLRTNGIRLH 108

Query: 103 NFPLSATRE----------------LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG 143
            F +  ++                 + +E I++ + + L    +P+LIHCK G  RTG
Sbjct: 109 QFAVEGSKSGPTVLDTMSAQEPFVHIPEETIREALKVVLDVRNQPVLIHCKRGKHRTG 166


>gi|224128928|ref|XP_002329001.1| predicted protein [Populus trichocarpa]
 gi|222839235|gb|EEE77586.1| predicted protein [Populus trichocarpa]
          Length = 202

 Score = 38.1 bits (87), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 17/116 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDLGI 99
           NF ++V   I+RS  P  +        +G    LNLR  +   PE++ +E     +   I
Sbjct: 20  NF-SMVEDGIFRSGLPQPS-------NFGFLETLNLRSIIYLCPEAYPQENMDFVDAHDI 71

Query: 100 QLINFPLSATRELNDEQIKQ------LISILKTAPKPLLIHCKSGADRTGLASAVY 149
           +L  F +    E +   I        L  ++     P+LIHCK G  RTG     +
Sbjct: 72  KLFQFGIEGKTESSSTSIPNHTITGALKVLIDVRNHPVLIHCKRGKHRTGCLVGCF 127


>gi|315505847|ref|YP_004084734.1| protein tyrosine/serine phosphatase [Micromonospora sp. L5]
 gi|315412466|gb|ADU10583.1| protein tyrosine/serine phosphatase [Micromonospora sp. L5]
          Length = 262

 Score = 38.1 bits (87), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 32/141 (22%)

Query: 34  FLTITTF-------TQNFHAVVPHEIYRS---AQPNGTFIEYLKKEYGIKSILNLR---- 79
           F T+  F       T +   V    +YRS   A+  G  +E      G++++++LR    
Sbjct: 7   FATLCNFRDLGGWRTGDGRTVARGRLYRSDSLAKLAGEDLERFAA-LGVRTVIDLRYPWE 65

Query: 80  ----GKLPES----WH------KEEEKAANDLGIQLINFPLSATRELNDE---QIKQLIS 122
               G+ PES    WH      +   +A  D  +    +      E+ ++   +++Q I 
Sbjct: 66  IADRGRAPESLGVTWHNLSIEHRPYVQADIDPDVDPWRYLADRYAEVAEDGVAELRQAIE 125

Query: 123 ILKTAPKPLLIHCKSGADRTG 143
           ++     PL+ HC SG DRTG
Sbjct: 126 VIADGEHPLVFHCASGKDRTG 146


>gi|225459659|ref|XP_002284607.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 1006

 Score = 38.1 bits (87), Expect = 0.84,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 3/95 (3%)

Query: 71  GIKSILNLRGKLPESWHKEE--EKAANDLGIQLINFPLSATRELNDEQIKQLISILK-TA 127
           G K+I++LR +  +    E     A     ++L+ FP+ A    + EQ+++  S++  ++
Sbjct: 296 GYKTIVDLRAENVKDIFYEAVVHDAVLSGKVELVKFPVEARTAPSMEQVEKFASLVSDSS 355

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
            KP+ +H K GA RT    + +   +A    EE H
Sbjct: 356 KKPIYLHSKEGAWRTSAMVSRWRQYMARSALEELH 390


>gi|169633556|ref|YP_001707292.1| hypothetical protein ABSDF1938 [Acinetobacter baumannii SDF]
 gi|169152348|emb|CAP01273.1| conserved hypothetical protein [Acinetobacter baumannii]
          Length = 551

 Score = 38.1 bits (87), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           E E+AA   G+++I  P+++ + + D+Q+ +   + K A KP+L +C+SG
Sbjct: 49  EIEEAAQQYGLKVIYQPVTSGK-ITDQQVAEFKQLYKNAQKPVLAYCRSG 97


>gi|152968345|ref|YP_001364129.1| ADP-ribosylation/Crystallin J1 [Kineococcus radiotolerans SRS30216]
 gi|151362862|gb|ABS05865.1| ADP-ribosylation/Crystallin J1 [Kineococcus radiotolerans SRS30216]
          Length = 463

 Score = 38.1 bits (87), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%)

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF 172
           + +   ++ L+   KP+L+HC +GA RTGL    +L         EA ++++  + H 
Sbjct: 387 DDVLDDVAALRAEGKPVLVHCHAGASRTGLVLRAWLVRSEGLSAREATQRVAAAWPHL 444


>gi|227510096|ref|ZP_03940145.1| protein tyrosine/serine phosphatase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227190475|gb|EEI70542.1| protein tyrosine/serine phosphatase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 247

 Score = 37.7 bits (86), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           Q ++ L   PKP   HC +G DRTG+A+A+ L
Sbjct: 123 QFMTALVDDPKPTFFHCFAGKDRTGVAAALIL 154


>gi|323500119|ref|ZP_08105068.1| tyrosine-specific protein phosphatase [Vibrio sinaloensis DSM
           21326]
 gi|323314822|gb|EGA67884.1| tyrosine-specific protein phosphatase [Vibrio sinaloensis DSM
           21326]
          Length = 156

 Score = 37.7 bits (86), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 9/65 (13%)

Query: 95  NDLGIQLINFPLSATR-------ELNDEQIKQLISILKTAPKP--LLIHCKSGADRTGLA 145
           + LGI   N PLS+         +L  + + Q+++ ++   +   +++HCKSG DRTGLA
Sbjct: 50  DSLGIAYKNVPLSSNAPPLDGDLDLCLKALPQILNFIEQHERNGVVVVHCKSGKDRTGLA 109

Query: 146 SAVYL 150
            A YL
Sbjct: 110 LAAYL 114


>gi|172079509|ref|ZP_02708084.2| protein tyrosine phosphatase [Streptococcus pneumoniae CDC1873-00]
 gi|172043425|gb|EDT51471.1| protein tyrosine phosphatase [Streptococcus pneumoniae CDC1873-00]
 gi|332201536|gb|EGJ15606.1| hypothetical protein SPAR93_1132 [Streptococcus pneumoniae GA47368]
          Length = 147

 Score = 37.7 bits (86), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 118 KQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVA 154
           K+   +L + PK   LL HC  G DRTG+AS   LYI+ 
Sbjct: 19  KKFFKLLLSHPKDESLLFHCSMGKDRTGIASLFLLYILG 57


>gi|313201382|ref|YP_004040040.1| hypothetical protein MPQ_1649 [Methylovorus sp. MP688]
 gi|312440698|gb|ADQ84804.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 146

 Score = 37.7 bits (86), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 5/68 (7%)

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           AA   G+Q I FP+  + ++  +Q+ +   ++  AP+P+L  C+SG      AS +YL  
Sbjct: 56  AAEAAGLQFIAFPV-ISNQITAQQVAEYKHLIAHAPRPILGFCRSG----NRASTLYLRA 110

Query: 153 VAHYPKEE 160
              YP+++
Sbjct: 111 KMLYPQDK 118


>gi|24374642|ref|NP_718685.1| tyrosine-specific protein phosphatase, putative [Shewanella
           oneidensis MR-1]
 gi|24349272|gb|AAN56129.1|AE015749_6 tyrosine-specific protein phosphatase, putative [Shewanella
           oneidensis MR-1]
          Length = 156

 Score = 37.7 bits (86), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 15/100 (15%)

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K  GI+++L++ G         E  +    G++    P S      D  I   ++ L  A
Sbjct: 29  KAAGIRAVLSVNGG-----EGCEPGSFQHHGLRYECIPFSRNVPPQDGDIAVCVAQLPKA 83

Query: 128 PK----------PLLIHCKSGADRTGLASAVYLYIVAHYP 157
                       P+L+HC+SG DRTGL  A YL +    P
Sbjct: 84  LAFIQQCEADNLPVLVHCRSGKDRTGLIMAYYLMVNGAAP 123


>gi|157692558|ref|YP_001487020.1| protein-tyrosine-phosphatase [Bacillus pumilus SAFR-032]
 gi|157681316|gb|ABV62460.1| possible protein-tyrosine-phosphatase [Bacillus pumilus SAFR-032]
          Length = 268

 Score = 37.7 bits (86), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 115 EQIKQLISILKTAPK-PLLIHCKSGADRTGLASAV 148
           E+I+QL  +L      PL++HC SG DRTG  SA+
Sbjct: 127 EEIQQLFKLLSDKSNYPLMLHCTSGKDRTGFLSAL 161


>gi|126668284|ref|ZP_01739244.1| pyridine nucleotide-disulphide oxidoreductase [Marinobacter sp.
           ELB17]
 gi|126627310|gb|EAZ97947.1| pyridine nucleotide-disulphide oxidoreductase [Marinobacter sp.
           ELB17]
          Length = 182

 Score = 37.7 bits (86), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           E+AA + G+Q +  P+ A  +++D+ +++  ++++TA  P+L  C+SG
Sbjct: 90  EEAAREHGLQWVYMPV-APGDISDDDVERFGAMIRTADAPVLAFCRSG 136


>gi|148994772|ref|ZP_01823843.1| hypothetical protein CGSSp9BS68_01228 [Streptococcus pneumoniae
           SP9-BS68]
 gi|149013149|ref|ZP_01833966.1| hypothetical protein CGSSp19BS75_12193 [Streptococcus pneumoniae
           SP19-BS75]
 gi|168488900|ref|ZP_02713099.1| protein tyrosine phosphatase [Streptococcus pneumoniae SP195]
 gi|303256107|ref|ZP_07342127.1| hypothetical protein CGSSpBS455_11415 [Streptococcus pneumoniae
           BS455]
 gi|303260592|ref|ZP_07346557.1| hypothetical protein CGSSp9vBS293_01642 [Streptococcus pneumoniae
           SP-BS293]
 gi|303263004|ref|ZP_07348937.1| hypothetical protein CGSSp14BS292_06294 [Streptococcus pneumoniae
           SP14-BS292]
 gi|303264852|ref|ZP_07350768.1| hypothetical protein CGSSpBS397_01766 [Streptococcus pneumoniae
           BS397]
 gi|303266929|ref|ZP_07352806.1| hypothetical protein CGSSpBS457_08644 [Streptococcus pneumoniae
           BS457]
 gi|303269097|ref|ZP_07354877.1| hypothetical protein CGSSpBS458_06479 [Streptococcus pneumoniae
           BS458]
 gi|147763000|gb|EDK69944.1| hypothetical protein CGSSp19BS75_12193 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147927038|gb|EDK78080.1| hypothetical protein CGSSp9BS68_01228 [Streptococcus pneumoniae
           SP9-BS68]
 gi|183572449|gb|EDT92977.1| protein tyrosine phosphatase [Streptococcus pneumoniae SP195]
 gi|301802051|emb|CBW34783.1| Protein tyrosine phosphatase [Streptococcus pneumoniae INV200]
 gi|302596954|gb|EFL64080.1| hypothetical protein CGSSpBS455_11415 [Streptococcus pneumoniae
           BS455]
 gi|302635831|gb|EFL66333.1| hypothetical protein CGSSp14BS292_06294 [Streptococcus pneumoniae
           SP14-BS292]
 gi|302638242|gb|EFL68712.1| hypothetical protein CGSSpBS293_01642 [Streptococcus pneumoniae
           SP-BS293]
 gi|302641346|gb|EFL71713.1| hypothetical protein CGSSpBS458_06479 [Streptococcus pneumoniae
           BS458]
 gi|302643562|gb|EFL73832.1| hypothetical protein CGSSpBS457_08644 [Streptococcus pneumoniae
           BS457]
 gi|302645540|gb|EFL75771.1| hypothetical protein CGSSpBS397_01766 [Streptococcus pneumoniae
           BS397]
 gi|332073412|gb|EGI83891.1| hypothetical protein SPAR50_1064 [Streptococcus pneumoniae GA17570]
          Length = 255

 Score = 37.7 bits (86), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 118 KQLISILKTAPKP--LLIHCKSGADRTGLASAVYLYIVA 154
           K+   +L + PK   LL HC  G DRTG+AS   LYI+ 
Sbjct: 127 KKFFKLLLSHPKDESLLFHCSMGKDRTGIASLFLLYILG 165


>gi|331700988|ref|YP_004397947.1| protein tyrosine/serine phosphatase [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128331|gb|AEB72884.1| protein tyrosine/serine phosphatase [Lactobacillus buchneri NRRL
           B-30929]
          Length = 287

 Score = 37.7 bits (86), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVA 154
           K LL HC SG DRTG+A+A+ LY++ 
Sbjct: 172 KSLLWHCASGKDRTGVAAALILYVLG 197


>gi|163793454|ref|ZP_02187429.1| hypothetical protein BAL199_03064 [alpha proteobacterium BAL199]
 gi|159181256|gb|EDP65771.1| hypothetical protein BAL199_03064 [alpha proteobacterium BAL199]
          Length = 153

 Score = 37.7 bits (86), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 69  EYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           + G  SI+NLR   +  E     E + A + G+  ++ P+S   +L+++ +++    + +
Sbjct: 28  QNGFGSIVNLRTTAEKQELAPDAEGRIAKNQGLAYLHHPVSGD-DLSEDAVERFRQKINS 86

Query: 127 APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            P P+L+HC +G  R+G    ++L I      E+A
Sbjct: 87  LPGPILVHCATG-RRSGALVMMHLAIEQGLSGEQA 120


>gi|322816108|gb|EFZ24541.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 340

 Score = 37.7 bits (86), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L+    +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNFRFLRA-LRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATRE----LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAV 148
            F     +E    +++  + +++S L  T   P+LIHC  G  RTG   A 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVAC 134


>gi|115433352|ref|XP_001216813.1| predicted protein [Aspergillus terreus NIH2624]
 gi|114189665|gb|EAU31365.1| predicted protein [Aspergillus terreus NIH2624]
          Length = 283

 Score = 37.7 bits (86), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE--EAHRQLSMLYGHFPVLKT 177
           L+ IL+    PLLIHCK G DRTG+  A+ L + A  P E   A   LS L G +P    
Sbjct: 156 LLYILEHPTSPLLIHCKVGKDRTGVVFAIILSL-AGVPDEIVAAEYSLSTL-GLYPAKPN 213

Query: 178 I 178
           I
Sbjct: 214 I 214


>gi|117919871|ref|YP_869063.1| Dual specificity protein phosphatase [Shewanella sp. ANA-3]
 gi|117612203|gb|ABK47657.1| dual specificity protein phosphatase [Shewanella sp. ANA-3]
          Length = 156

 Score = 37.7 bits (86), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYP 157
           P+LIHC+SG DRTGL  A YL +    P
Sbjct: 96  PVLIHCRSGKDRTGLIMAYYLMVNGAAP 123


>gi|120598332|ref|YP_962906.1| dual specificity protein phosphatase [Shewanella sp. W3-18-1]
 gi|146293590|ref|YP_001184014.1| dual specificity protein phosphatase [Shewanella putrefaciens
           CN-32]
 gi|120558425|gb|ABM24352.1| dual specificity protein phosphatase [Shewanella sp. W3-18-1]
 gi|145565280|gb|ABP76215.1| dual specificity protein phosphatase [Shewanella putrefaciens
           CN-32]
 gi|319426889|gb|ADV54963.1| Dual specificity protein phosphatase [Shewanella putrefaciens 200]
          Length = 156

 Score = 37.7 bits (86), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 53/127 (41%), Gaps = 16/127 (12%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLK-KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           Q+   +V  +I   + PN    +  + K  GI ++L++ G         +  +   LG++
Sbjct: 2   QHLFWLVEGQIAGRSGPNKDPWDLTELKAAGIGAVLSVNGG-----EGCDPHSFKGLGLR 56

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPK----------PLLIHCKSGADRTGLASAVYL 150
               P S      D  I   ++ L  A            P++IHC+SG DRTGL  A YL
Sbjct: 57  YECIPFSRNVPPQDGDIAICVAQLPKALAFIQQCEADNLPVVIHCRSGKDRTGLIMAYYL 116

Query: 151 YIVAHYP 157
            +    P
Sbjct: 117 MVNGAAP 123


>gi|262368392|ref|ZP_06061721.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316070|gb|EEY97108.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 174

 Score = 37.7 bits (86), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 59/113 (52%), Gaps = 8/113 (7%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF  +  H ++ S QP    ++ +K EYG+ +++NL      ++   E++   +LG+ 
Sbjct: 11  TLNFQFIHEH-LFTSGQPTAEQLQQIK-EYGVNTVINLALSNSNNYLANEDQICLELGLN 68

Query: 101 LINFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLY 151
            I+ P+S     +D+Q   ++ ++      + + +HC   ++   ++S +YLY
Sbjct: 69  YIHVPISWDTP-SDDQCLLVLDMIDHLVQEQTIWVHC---SENYRVSSLMYLY 117


>gi|297811789|ref|XP_002873778.1| hypothetical protein ARALYDRAFT_488502 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297319615|gb|EFH50037.1| hypothetical protein ARALYDRAFT_488502 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 203

 Score = 37.7 bits (86), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 16/109 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDLGI 99
           NF ++V   IYRS  P         + +G  S LNLR  +   PE + ++  K+     I
Sbjct: 18  NF-SMVEDGIYRSGFPQ-------LENFGFLSTLNLRSVIYLCPEPYPEDNLKSLQSNNI 69

Query: 100 QLINFPLSA-----TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
           +L  F +       T    D  +  L  ++     P+LIHCK G  RTG
Sbjct: 70  KLFQFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTG 118


>gi|254249180|ref|ZP_04942500.1| hypothetical protein BCPG_04040 [Burkholderia cenocepacia PC184]
 gi|124875681|gb|EAY65671.1| hypothetical protein BCPG_04040 [Burkholderia cenocepacia PC184]
          Length = 608

 Score = 37.7 bits (86), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
           +E   AA +LG+     P+   R + D ++    +++ T PKP+L +C+SG+ R+GL
Sbjct: 543 EEIAAAARELGMDARYLPVERDR-IGDAEVDAFGALVDTLPKPVLAYCRSGS-RSGL 597


>gi|182684196|ref|YP_001835943.1| hypothetical protein SPCG_1226 [Streptococcus pneumoniae CGSP14]
 gi|182629530|gb|ACB90478.1| hypothetical protein SPCG_1226 [Streptococcus pneumoniae CGSP14]
          Length = 263

 Score = 37.7 bits (86), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 118 KQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVA 154
           K+   +L + PK   LL HC  G DRTG+AS   LYI+ 
Sbjct: 135 KKFFKLLLSHPKDESLLFHCSMGKDRTGIASLFLLYILG 173


>gi|321261553|ref|XP_003195496.1| tyrosine phosphatase; Siw14p [Cryptococcus gattii WM276]
 gi|317461969|gb|ADV23709.1| Tyrosine phosphatase, putative; Siw14p [Cryptococcus gattii WM276]
          Length = 281

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 16/110 (14%)

Query: 42  QNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           +NF A+V   +YR   P   N  F+E L+    +K++L L   + E + K   +      
Sbjct: 85  ENF-ALVSSGVYRCGFPKKRNFKFMETLR----LKTVLTL---VLEEYPKANLEWCQSQD 136

Query: 99  IQLINFPLSATRELND---EQI--KQLISILKTAPKPLLIHCKSGADRTG 143
           IQ + F +   +E  D   E +    L++IL     P+LIHC  G  RTG
Sbjct: 137 IQFMQFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTG 186


>gi|146420698|ref|XP_001486303.1| hypothetical protein PGUG_01974 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 296

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 22/121 (18%)

Query: 39  TFTQNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T  +NF  V+ + IYRS+ P   + +F+  LK    +KSIL L   +PE + +  +    
Sbjct: 127 TPPENFAPVI-NNIYRSSFPQIHSFSFLRTLK----LKSILCL---IPEEYPQMHKDFFE 178

Query: 96  DLGIQLINFPLSATRE--------LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
           + GI+L    +S  +E        L  E +K    +L    +P+LIHC  G  RTG    
Sbjct: 179 EEGIKLFQMGMSGNKEPFVKIPPDLVTEAVK---VVLDPRNQPILIHCNRGKHRTGCLVG 235

Query: 148 V 148
           V
Sbjct: 236 V 236


>gi|300698028|ref|YP_003748689.1| tyrosine phosphatase protein [Ralstonia solanacearum CFBP2957]
 gi|299074752|emb|CBJ54312.1| putative tyrosine phosphatase protein [Ralstonia solanacearum
           CFBP2957]
          Length = 216

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 58/146 (39%), Gaps = 19/146 (13%)

Query: 43  NFHAVV--PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  V   P  IYR  QP         KE  +K+I+ L          +E+K A    I+
Sbjct: 48  NFGVVSEGPISIYRGGQPVDDKEWGFLKEKKVKTIVKLNKYSDAVSEYDEDKFAEKYNIK 107

Query: 101 LI-----------NFPLSATRELNDEQIKQLISI------LKTAPKPLLIHCKSGADRTG 143
           +I               S   +L++   K  ++       +     P+ +HC  G DRTG
Sbjct: 108 VIKVFMGPEDCVPGVHCSIDPDLDEMPAKNSVATAIEEITVAAGNGPVYVHCSHGQDRTG 167

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLY 169
           L  A+Y   V  Y K++A  + +  +
Sbjct: 168 LVVALYRMRVQGYCKKKADDERNQYH 193


>gi|319936532|ref|ZP_08010946.1| protein tyrosine/serine phosphatase [Coprobacillus sp. 29_1]
 gi|319808330|gb|EFW04890.1| protein tyrosine/serine phosphatase [Coprobacillus sp. 29_1]
          Length = 160

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 29/134 (21%)

Query: 40  FTQNFHAVVPHEIYRS---AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +T++      H   RS   +Q     IE+L   YG+ S+++LR +     H +     N 
Sbjct: 22  YTKDKQITQWHRFLRSDDISQLTDQDIEFLLN-YGVNSVIDLRSQSECQAHPD--SLMNI 78

Query: 97  LGIQLINFPLSATR--------------ELND---------EQIKQLISILKTAPKPLLI 133
            GI   + P  +                +L D         E + QL+S++  A +  L 
Sbjct: 79  EGIDYYHLPFMSGDIDDVTKIMDNLEQFDLGDFYVELLKEKELVAQLLSLITDAKEGCLF 138

Query: 134 HCKSGADRTGLASA 147
           HC +G DRTG+ S 
Sbjct: 139 HCSAGKDRTGILSV 152


>gi|167042507|gb|ABZ07232.1| putative dual specificity phosphatase, catalytic domain protein
           [uncultured marine crenarchaeote HF4000_ANIW133C7]
          Length = 164

 Score = 37.7 bits (86), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 64/136 (47%), Gaps = 17/136 (12%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK--EYGIKSILNLRGK-LPESWHKEEEK 92
           TIT     F  ++ +++  SA P  T I+ ++   E G+KSI+ +R + L + W K+   
Sbjct: 14  TITGRPDRFSWLIENKLAGSAIP--TSIDEVQWLIEQGVKSIVTVREEPLDDDWIKDVNY 71

Query: 93  ---AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
               +ND+G+   N  + A            I    T  + +++HC +G  RTG   A Y
Sbjct: 72  LHIMSNDMGVPEFNDLVHAV---------DFIHRRITNKESVMVHCLAGLGRTGTVLASY 122

Query: 150 LYIVAHYPKEEAHRQL 165
           L    +   +EA +++
Sbjct: 123 LIKYQNMSADEAMKKV 138


>gi|237650046|ref|ZP_04524298.1| hypothetical protein SpneC1_04860 [Streptococcus pneumoniae CCRI
           1974]
 gi|237821802|ref|ZP_04597647.1| hypothetical protein SpneC19_05732 [Streptococcus pneumoniae CCRI
           1974M2]
          Length = 213

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 118 KQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVA 154
           K+   +L + PK   LL HC  G DRTG+AS   LYI+ 
Sbjct: 127 KKFFKLLLSHPKDESLLFHCSMGKDRTGIASLFLLYILG 165


>gi|75675084|ref|YP_317505.1| hypothetical protein Nwi_0889 [Nitrobacter winogradskyi Nb-255]
 gi|74419954|gb|ABA04153.1| Protein of unknown function DUF442 [Nitrobacter winogradskyi
           Nb-255]
          Length = 554

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 68  KEYGIKSILNLR-----GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           K+ G +SI+  R        P +  +E E AA+  G++ ++ P+ A + ++D+   Q   
Sbjct: 25  KQSGFRSIICNRPDGEAADQPSA--RELELAASSHGLEFVHQPVVAGK-MSDDDAVQFAQ 81

Query: 123 ILKTAPKPLLIHCKSG 138
            LK+ PKP L  C++G
Sbjct: 82  TLKSLPKPTLAFCRTG 97


>gi|225858840|ref|YP_002740350.1| putative phosphatase H16_A0669 [Streptococcus pneumoniae 70585]
 gi|225858844|ref|YP_002740354.1| putative phosphatase H16_A0669 [Streptococcus pneumoniae 70585]
 gi|225720677|gb|ACO16531.1| putative phosphatase H16_A0669 [Streptococcus pneumoniae 70585]
 gi|225721414|gb|ACO17268.1| putative phosphatase H16_A0669 [Streptococcus pneumoniae 70585]
          Length = 188

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 118 KQLISILKTAPKP--LLIHCKSGADRTGLASAVYLYIVA 154
           K+   +L + PK   LL HC  G DRTG+AS   LYI+ 
Sbjct: 127 KKFFKLLLSHPKDESLLFHCSMGKDRTGIASLFLLYILG 165


>gi|150866081|ref|XP_001385557.2| tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
 gi|149387337|gb|ABN67528.2| tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
          Length = 242

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 39  TFTQNFHAVVPHEIYRSA--QPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T  +NF  ++ ++IYRS+  QPN  TF+  LK    +KS+L L   +PE + +   +   
Sbjct: 78  TPPENFAPII-NKIYRSSFPQPNNFTFLRKLK----LKSVLCL---IPEEYPQLHLEFLE 129

Query: 96  DLGIQLINFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAV 148
              I+L    +S  +E   +    LI+     +L    +P+LIHC  G  RTG    V
Sbjct: 130 HENIKLFQLGMSGNKEPFVKISSDLITEAAKIVLNPENQPILIHCNRGKHRTGCLVGV 187


>gi|320104939|ref|YP_004180530.1| hypothetical protein Isop_3423 [Isosphaera pallida ATCC 43644]
 gi|319752221|gb|ADV63981.1| hypothetical protein Isop_3423 [Isosphaera pallida ATCC 43644]
          Length = 231

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 58/136 (42%), Gaps = 11/136 (8%)

Query: 40  FTQNFHAVVPHEIYRSA-QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           F +    + P  + R A Q  G     L++E GI+SI+ L    P+    +    AN L 
Sbjct: 48  FEKRVVVIEPGGLVRGAWQKPGPLRRLLERE-GIRSIVTLTAINPDD--PKYVGQANALA 104

Query: 99  -----IQLINFPLSATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYI 152
                I+ I      +     EQ+ Q   +L     +P+  HC +G  RTGLA A YL  
Sbjct: 105 GVGRPIRWIQLDWRGS-TATLEQMAQAADLLADQSLRPIFFHCVAGHHRTGLAHAAYLIR 163

Query: 153 VAHYPKEEAHRQLSML 168
              +   +A  QLS L
Sbjct: 164 HRGFTAAQAWDQLSRL 179


>gi|149003960|ref|ZP_01828768.1| hypothetical protein CGSSp14BS69_02831 [Streptococcus pneumoniae
           SP14-BS69]
 gi|147758019|gb|EDK65025.1| hypothetical protein CGSSp14BS69_02831 [Streptococcus pneumoniae
           SP14-BS69]
          Length = 167

 Score = 37.4 bits (85), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 118 KQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVA 154
           K+   +L + PK   LL HC  G DRTG+AS   LYI+ 
Sbjct: 81  KKFFKLLLSHPKDESLLFHCSMGKDRTGIASLFLLYILG 119


>gi|58269578|ref|XP_571945.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57228181|gb|AAW44638.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 279

 Score = 37.4 bits (85), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 16/110 (14%)

Query: 42  QNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           +NF A+V   +YR   P   N  F+E L+    +K++L L   + E + K   +      
Sbjct: 83  ENF-ALVSSGVYRCGFPKKRNFKFMETLR----LKTVLTL---VLEEYPKANLEWCQSQD 134

Query: 99  IQLINFPLSATRELND---EQI--KQLISILKTAPKPLLIHCKSGADRTG 143
           IQ + F +   +E  D   E +    L++IL     P+LIHC  G  RTG
Sbjct: 135 IQFMQFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTG 184


>gi|190345908|gb|EDK37876.2| hypothetical protein PGUG_01974 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 296

 Score = 37.4 bits (85), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 22/121 (18%)

Query: 39  TFTQNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T  +NF  V+ + IYRS+ P   + +F+  LK    +KSIL L   +PE + +  +    
Sbjct: 127 TPPENFAPVI-NNIYRSSFPQIHSFSFLRTLK----LKSILCL---IPEEYPQMHKDFFE 178

Query: 96  DLGIQLINFPLSATRE--------LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
           + GI+L    +S  +E        L  E +K    +L    +P+LIHC  G  RTG    
Sbjct: 179 EEGIKLFQMGMSGNKEPFVKIPPDLVTEAVK---VVLDPRNQPILIHCNRGKHRTGCLVG 235

Query: 148 V 148
           V
Sbjct: 236 V 236


>gi|17549688|ref|NP_523028.1| putative tyrosine specific protein phosphatase [Ralstonia
           solanacearum GMI1000]
 gi|17431943|emb|CAD18620.1| probable tyrosine phosphatase protein [Ralstonia solanacearum
           GMI1000]
          Length = 214

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 53/130 (40%), Gaps = 19/130 (14%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI--------- 102
           IYR  +P         K+  IK+I+ L          EE+  A   GI++I         
Sbjct: 59  IYRGGEPVDEQEWQFLKDSKIKTIVKLNQYSKAVSESEEDHLAEKYGIKVIKVFMGPEDC 118

Query: 103 ------NFPLSATRELN--DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                 N  L    + N  ++ I ++ +     P  + +HC  G DRTGL  A+Y   V 
Sbjct: 119 ILGKHCNIDLDEMPDPNLVEKAINEITAAAGNGP--VYVHCSHGQDRTGLVVALYRMRVQ 176

Query: 155 HYPKEEAHRQ 164
            Y +++A  +
Sbjct: 177 GYCRKKADDE 186


>gi|227484663|ref|ZP_03914979.1| protein tyrosine/serine phosphatase [Anaerococcus lactolyticus ATCC
           51172]
 gi|227237383|gb|EEI87398.1| protein tyrosine/serine phosphatase [Anaerococcus lactolyticus ATCC
           51172]
          Length = 238

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 59/148 (39%), Gaps = 37/148 (25%)

Query: 50  HEIYRSA---QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           HE +R+A     N   +E LKK   + +I++LR      +  E  K   +      +  L
Sbjct: 32  HEFFRTASLDDINDADMEQLKK-LNVSTIIDLRRINEIDFESESHKKIKE-NFDYHHISL 89

Query: 107 SATRELNDEQIKQLIS------------------------ILKTAPKPLLIHCKSGADRT 142
           +  RE   E+I+++IS                        +L  A   +L HC+ G DRT
Sbjct: 90  APDREFRKEEIEKIISGKISVGQSYRNLIDHYVAVKEIVEVLARAEGSVLYHCQEGKDRT 149

Query: 143 GLASAVYL--------YIVAHYPKEEAH 162
           G+ S + +         I+A Y    AH
Sbjct: 150 GIVSMIIMGLADVARGDIIADYEISSAH 177


>gi|238750739|ref|ZP_04612238.1| Protein tyrosine/serine phosphatase [Yersinia rohdei ATCC 43380]
 gi|238711129|gb|EEQ03348.1| Protein tyrosine/serine phosphatase [Yersinia rohdei ATCC 43380]
          Length = 265

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 112 LNDEQIKQLISILKTAPKP------LLIHCKSGADRTGLASAVYLYIVA 154
            N++  KQL+S+L+ +  P      ++ HC  G DRTG+ SA+ L+ + 
Sbjct: 128 FNNQAYKQLVSLLQNSVSPAHAATGVVQHCAVGKDRTGVGSALVLFALG 176


>gi|119488020|ref|ZP_01621464.1| hypothetical protein L8106_11502 [Lyngbya sp. PCC 8106]
 gi|119455309|gb|EAW36448.1| hypothetical protein L8106_11502 [Lyngbya sp. PCC 8106]
          Length = 727

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 12/94 (12%)

Query: 87  HKEEEKAANDLGI-QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGA------ 139
           ++E+ + A  +G+ Q+I   ++  R+ N E ++  ++ILK  P  +LIH  +G       
Sbjct: 520 NREQFRKAYRIGLDQVIYLSVAPGRKFNRELVEAQVAILKQVPNSILIHKAAGDVAVFQG 579

Query: 140 --DRTGLASAVYLY---IVAHYPKEEAHRQLSML 168
             ++   A  V L+    +  +P EE HRQ+  L
Sbjct: 580 AYEQACQAVGVSLHRVKFIPRFPTEEEHRQVYAL 613


>gi|298483848|ref|ZP_07002020.1| outer membrane protein [Bacteroides sp. D22]
 gi|298270035|gb|EFI11624.1| outer membrane protein [Bacteroides sp. D22]
          Length = 506

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 168 LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           L+G FPV+ T+  DIT E I ++YP    K +TE
Sbjct: 165 LWGDFPVITTVADDITSENIDEVYPQYFPKQNTE 198


>gi|293370907|ref|ZP_06617451.1| putative lipoprotein [Bacteroides ovatus SD CMC 3f]
 gi|292634016|gb|EFF52561.1| putative lipoprotein [Bacteroides ovatus SD CMC 3f]
          Length = 511

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 168 LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           L+G FPV+ T+  DIT E I ++YP    K +TE
Sbjct: 170 LWGDFPVITTVADDITSENIDEVYPQYFPKQNTE 203


>gi|302838013|ref|XP_002950565.1| hypothetical protein VOLCADRAFT_60622 [Volvox carteri f.
           nagariensis]
 gi|300264114|gb|EFJ48311.1| hypothetical protein VOLCADRAFT_60622 [Volvox carteri f.
           nagariensis]
          Length = 313

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           I++ +  ++T P  + +HCK+G  RTGL   + LYI+ HY
Sbjct: 227 IQRFLDTVETEPGAIAVHCKAGLGRTGL--LICLYIMKHY 264


>gi|42519774|ref|NP_965704.1| hypothetical protein LJ0551 [Lactobacillus johnsonii NCC 533]
 gi|41584064|gb|AAS09670.1| hypothetical protein LJ_0551 [Lactobacillus johnsonii NCC 533]
          Length = 267

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 107 SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           S ++E + +    L++I   T    ++ HC  G DRTGLA+ + LYI+ 
Sbjct: 123 SVSKEYSQKAFNSLLNIFANTKDGAIIFHCSEGKDRTGLATVLILYILG 171


>gi|134113933|ref|XP_774214.1| hypothetical protein CNBG1960 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256849|gb|EAL19567.1| hypothetical protein CNBG1960 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 279

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 16/110 (14%)

Query: 42  QNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           +NF A+V   +YR   P   N  F+E L+    +K++L L   + E + K   +      
Sbjct: 83  ENF-ALVSSGVYRCGFPKKRNFKFMETLR----LKTVLTL---VLEEYPKANLEWCQSQD 134

Query: 99  IQLINFPLSATRELND---EQI--KQLISILKTAPKPLLIHCKSGADRTG 143
           IQ + F +   +E  D   E +    L++IL     P+LIHC  G  RTG
Sbjct: 135 IQFMQFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTG 184


>gi|320102657|ref|YP_004178248.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319749939|gb|ADV61699.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 256

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/134 (20%), Positives = 53/134 (39%), Gaps = 6/134 (4%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
            F  + P  +YR A      +  L  +Y IK+++ L           E+      G + +
Sbjct: 85  QFAEIEPGRVYRGAWQKPWPMSRLLNDYDIKTVVALAHPADHPLAIREKAQVEAHGARWV 144

Query: 103 NFPLSATRELND-----EQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + P+   R         +QI + + ++   A +P+  HC  G +R  +    Y   V  +
Sbjct: 145 HLPIVDDRRFMQGRDLFDQIDEAVKVVGDPANQPVFFHCHHGINRASMVQMAYRMKVCGW 204

Query: 157 PKEEAHRQLSMLYG 170
             +EA  ++   +G
Sbjct: 205 SFDEAVAEIDRTFG 218


>gi|260172601|ref|ZP_05759013.1| hypothetical protein BacD2_12111 [Bacteroides sp. D2]
          Length = 511

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 168 LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           L+G FPV+ T+  DIT E I ++YP    K +TE
Sbjct: 170 LWGDFPVITTVADDITSENIDEVYPQYFPKQNTE 203


>gi|237716807|ref|ZP_04547288.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262405578|ref|ZP_06082128.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|229442790|gb|EEO48581.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262356453|gb|EEZ05543.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
          Length = 506

 Score = 37.4 bits (85), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 168 LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           L+G FPV+ T+  DIT E I ++YP    K +TE
Sbjct: 165 LWGDFPVITTVADDITSENIDEVYPQYFPKQNTE 198


>gi|294644543|ref|ZP_06722297.1| putative lipoprotein [Bacteroides ovatus SD CC 2a]
 gi|294809576|ref|ZP_06768269.1| putative lipoprotein [Bacteroides xylanisolvens SD CC 1b]
 gi|292640096|gb|EFF58360.1| putative lipoprotein [Bacteroides ovatus SD CC 2a]
 gi|294443188|gb|EFG11962.1| putative lipoprotein [Bacteroides xylanisolvens SD CC 1b]
 gi|295086087|emb|CBK67610.1| SusD family. [Bacteroides xylanisolvens XB1A]
          Length = 511

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 168 LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           L+G FPV+ T+  DIT E I ++YP    K +TE
Sbjct: 170 LWGDFPVITTVADDITSENIDEVYPQYFPKQNTE 203


>gi|268320138|ref|YP_003293794.1| hypothetical protein FI9785_1674 [Lactobacillus johnsonii FI9785]
 gi|262398513|emb|CAX67527.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
          Length = 267

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 107 SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           S ++E + +    L++I   T    ++ HC  G DRTGLA+ + LYI+ 
Sbjct: 123 SVSKEYSQKAFNSLLNIFANTKDGAIIFHCSEGKDRTGLATVLILYILG 171


>gi|171463702|ref|YP_001797815.1| protein of unknown function DUF442 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193240|gb|ACB44201.1| protein of unknown function DUF442 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 114

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 71  GIKSILNLR----GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           G KS++N R    G   +  +   +  A  LG+  +  P+         Q++++  +LKT
Sbjct: 30  GYKSVINNRPDGEGGPDQPTNASIQAEAEKLGLNYVYLPV-VPGAFTPAQVQEMARLLKT 88

Query: 127 APKPLLIHCKSGADRTGL 144
            P P+L  C+SGA  T L
Sbjct: 89  LPGPILAFCRSGARSTNL 106


>gi|145588999|ref|YP_001155596.1| hypothetical protein Pnuc_0814 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047405|gb|ABP34032.1| protein of unknown function DUF442 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 127

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 71  GIKSILNLR----GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           G KS++N R    G   +  + + +  A  LG+     P+  +  +  EQ+ ++  +L T
Sbjct: 43  GYKSVINNRPDGEGGPDQPKNADIQAEAEKLGLNYAYLPV-VSGAITPEQVIEMARLLAT 101

Query: 127 APKPLLIHCKSGADRTGL 144
            P+P+L  C+SGA  T L
Sbjct: 102 MPEPVLAFCRSGARSTNL 119


>gi|328477678|gb|EGF47704.1| protein tyrosine/serine phosphatase [Lactobacillus rhamnosus MTCC
           5462]
          Length = 217

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 27/117 (23%)

Query: 65  YLKKEYGIKSILNLR-----GKLPES-WHKEE--------EKAANDLGIQLINFPLSATR 110
           YL K+ GIK I+++R      + P++ W   +        +  AN+  +  +     + R
Sbjct: 10  YLAKDLGIKQIVDMRSADERAQFPDTVWPGADYTVLDILKDATANNASLGRMITEQGSVR 69

Query: 111 E-----------LNDEQI--KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           E            +  QI  ++LI  L    +P + HC +G DRTG+ +A+ L I+ 
Sbjct: 70  ENMLATYEQLAVSSSAQIGYRKLIQALLVPDRPTIFHCFAGKDRTGVGAAIILEILG 126


>gi|303257300|ref|ZP_07343314.1| sigma-54 dependent transcriptional regulator RtcR [Burkholderiales
           bacterium 1_1_47]
 gi|302860791|gb|EFL83868.1| sigma-54 dependent transcriptional regulator RtcR [Burkholderiales
           bacterium 1_1_47]
          Length = 530

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 74/165 (44%), Gaps = 35/165 (21%)

Query: 25  LCAVSLGLYFLTITTF--TQNFH---AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           L  ++ G + + I  F  T++ H    ++   + +S  PNGT+           +I++L 
Sbjct: 108 LVHITTGTHVIQICLFLLTESRHIPGKLLQTHMQKSRNPNGTY-----------TIIDLD 156

Query: 80  ----GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
                K+ E +H+E++      GI+ +   +       +E I++L ++   +  P+L+  
Sbjct: 157 LSKYDKIAERFHQEQKD-----GIRFLKSGIETRNAKFNEMIRELATVSVKSKAPILLTG 211

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           K+G  +T +A  VY          E  +Q  M+ G+F  L   T+
Sbjct: 212 KTGVGKTKMARLVY----------EWKKQKRMVSGNFVELNCATL 246


>gi|237720560|ref|ZP_04551041.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229450311|gb|EEO56102.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 506

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 168 LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           L+G FPV+ T+  DIT E I ++YP    K +TE
Sbjct: 165 LWGDFPVITTVADDITSENIDEVYPQYFPKQNTE 198


>gi|315920892|ref|ZP_07917132.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313694767|gb|EFS31602.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 506

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 168 LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           L+G FPV+ T+  DIT E I ++YP    K +TE
Sbjct: 165 LWGDFPVITTVADDITSENIDEVYPQYFPKQNTE 198


>gi|302780857|ref|XP_002972203.1| hypothetical protein SELMODRAFT_412771 [Selaginella moellendorffii]
 gi|302791497|ref|XP_002977515.1| hypothetical protein SELMODRAFT_107045 [Selaginella moellendorffii]
 gi|300154885|gb|EFJ21519.1| hypothetical protein SELMODRAFT_107045 [Selaginella moellendorffii]
 gi|300160502|gb|EFJ27120.1| hypothetical protein SELMODRAFT_412771 [Selaginella moellendorffii]
          Length = 223

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 51/112 (45%), Gaps = 12/112 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V   IYRS+ P    + +LKK   ++SI+ L    PE +   E  A N   I+L 
Sbjct: 32  NF-GMVDWGIYRSSYPTAENLPFLKK-LRLRSIVYL---CPEPYLNHEFVAENK--IKLF 84

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVY 149
            F +    E   E  + +I      +L     PLLIHC  G  RTG+    Y
Sbjct: 85  QFGIEGKCEPAVEIPEGVIRDALRVVLDVENYPLLIHCNRGKHRTGVLVGCY 136


>gi|226366569|ref|YP_002784352.1| protein-tyrosine-phosphatase [Rhodococcus opacus B4]
 gi|226245059|dbj|BAH55407.1| putative protein-tyrosine-phosphatase [Rhodococcus opacus B4]
          Length = 243

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +++  L++++  A  P+L+HC +G DRTG+  A  L      P E
Sbjct: 118 DRVAGLLALVARADGPILVHCAAGKDRTGVVVASLLLGAGVEPSE 162


>gi|330999569|ref|ZP_08323282.1| Sigma-54 interaction domain protein [Parasutterella
           excrementihominis YIT 11859]
 gi|329574667|gb|EGG56230.1| Sigma-54 interaction domain protein [Parasutterella
           excrementihominis YIT 11859]
          Length = 530

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 74/165 (44%), Gaps = 35/165 (21%)

Query: 25  LCAVSLGLYFLTITTF--TQNFH---AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           L  ++ G + + I  F  T++ H    ++   + +S  PNGT+           +I++L 
Sbjct: 108 LVHITTGTHVIQICLFLLTESRHIPGKLLQTHMQKSRNPNGTY-----------TIIDLD 156

Query: 80  ----GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
                K+ E +H+E++      GI+ +   +       +E I++L ++   +  P+L+  
Sbjct: 157 LSKYDKIAERFHQEQKD-----GIRFLKSGIETRNAKFNEMIRELATVSVKSKAPILLTG 211

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           K+G  +T +A  VY          E  +Q  M+ G+F  L   T+
Sbjct: 212 KTGVGKTKMARLVY----------EWKKQKRMVSGNFVELNCATL 246


>gi|227889287|ref|ZP_04007092.1| possible tyrosine-phosphatase [Lactobacillus johnsonii ATCC 33200]
 gi|227850089|gb|EEJ60175.1| possible tyrosine-phosphatase [Lactobacillus johnsonii ATCC 33200]
          Length = 267

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 107 SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           S ++E + +    L++I   T    ++ HC  G DRTGLA+ + LYI+ 
Sbjct: 123 SVSKEYSQKAFNSLLNIFANTKDGAIIFHCSEGKDRTGLATVLILYILG 171


>gi|27379276|ref|NP_770805.1| hypothetical protein bll4165 [Bradyrhizobium japonicum USDA 110]
 gi|27352427|dbj|BAC49430.1| bll4165 [Bradyrhizobium japonicum USDA 110]
          Length = 247

 Score = 37.4 bits (85), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           N    + L   L     PL+IHC +G DRTG ASA+ L+ + 
Sbjct: 124 NTHSFRALFGHLLEDRAPLVIHCTAGKDRTGFASALILHALG 165


>gi|167045003|gb|ABZ09667.1| putative dual specificity phosphatase, catalytic domain protein
           [uncultured marine crenarchaeote HF4000_APKG8G15]
          Length = 164

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK-LPESWHKEEEK-- 92
           T+T     F  ++ +++  S  P          E GIKSI+ +R + L + W K+ +   
Sbjct: 14  TVTGRPDKFSWLIDNKLAGSGIPTSIDEVQWAIEQGIKSIVTVREEPLDDDWVKDIKYLH 73

Query: 93  -AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
             +ND+G+      +SA            I    T  +P+++HC +G  RTG   A YL
Sbjct: 74  IMSNDMGVPEFVDLVSAV---------DFIHSRITNNEPVMVHCLAGLGRTGTLLACYL 123


>gi|302337330|ref|YP_003802536.1| peptidoglycan-binding lysin domain protein [Spirochaeta smaragdinae
           DSM 11293]
 gi|301634515|gb|ADK79942.1| Peptidoglycan-binding lysin domain protein [Spirochaeta smaragdinae
           DSM 11293]
          Length = 798

 Score = 37.4 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 51/120 (42%), Gaps = 15/120 (12%)

Query: 44  FHAVVPHEIYRSAQP------NGTFIEYLKKEYGIKSILNLRGKLPE--------SWHKE 89
           F  + P  ++RS+ P         + + L K + I++++NL     E         +   
Sbjct: 168 FGDIAPGLLFRSSSPANNELGRAAYADELTKAFKIRTVINLADSKEELEGFFAGKDFASP 227

Query: 90  EEKAANDLG-IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
             K+  D G +  ++  +  T E    ++ + +  + +   P L+HC  G DR G  SA+
Sbjct: 228 YYKSLYDAGQVSFLDMGVDLTSEDFGAKLAEGLRFMISHEGPYLVHCTEGKDRAGFVSAL 287


>gi|223648802|gb|ACN11159.1| Dual specificity protein phosphatase CDC14A [Salmo salar]
          Length = 539

 Score = 37.4 bits (85), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            +  Y +K + I +I+ L  K+ ++      K   D+G +  +         ND  +++ 
Sbjct: 230 AYFPYFRK-HNITAIVRLNKKMYDA------KRFTDMGFEHHDLFFVDGSTPNDSIVRKF 282

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I + A   + +HCK+G  RTG  + +  Y++ HY
Sbjct: 283 LNICENADGAIAVHCKAGLGRTG--TLIGCYMMKHY 316


>gi|308811847|ref|XP_003083231.1| ATP-NAD kinase family protein (ISS) [Ostreococcus tauri]
 gi|116055110|emb|CAL57506.1| ATP-NAD kinase family protein (ISS) [Ostreococcus tauri]
          Length = 721

 Score = 37.4 bits (85), Expect = 1.4,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHK-----EEEKAANDLGIQLINFPL 106
           YR  QP      +L +    K++++LRG   ++ W +       +       + +++ P+
Sbjct: 178 YRGGQPTAEGRAWLVRN-NFKTVIDLRGSDRDNQWLQAFGGGSGQGTYGPSALNIVHIPI 236

Query: 107 SATRELNDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVY 149
                  DE + + I ++   + +P+L+HCK+G  RTG   A +
Sbjct: 237 HDMEPPTDEDVDRFIEAVNNESMRPVLVHCKAGIGRTGALVACW 280


>gi|260942159|ref|XP_002615378.1| hypothetical protein CLUG_04260 [Clavispora lusitaniae ATCC 42720]
 gi|238850668|gb|EEQ40132.1| hypothetical protein CLUG_04260 [Clavispora lusitaniae ATCC 42720]
          Length = 675

 Score = 37.0 bits (84), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 115 EQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVA 154
           E  KQ+   ++  P KP L HC +G DRTG+ + + L +V 
Sbjct: 503 ESFKQMFEYIRDHPDKPFLFHCTAGKDRTGVFAMLLLRLVG 543


>gi|22902095|gb|AAN10162.1| CDC14 [Takifugu rubripes]
          Length = 431

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ND  +++ +SI + A   + +HCK+G  RTG  + +  Y++ HY
Sbjct: 238 NDSIVRKFLSICENAEGAVAVHCKAGLGRTG--TLIGCYMMKHY 279


>gi|153827431|ref|ZP_01980098.1| dual specificity protein phosphatase [Vibrio cholerae MZO-2]
 gi|149738637|gb|EDM52986.1| dual specificity protein phosphatase [Vibrio cholerae MZO-2]
          Length = 156

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           +++HCKSG DRTGLA A YL     +  EE+
Sbjct: 95  VVVHCKSGKDRTGLALAAYLLKSKGFGVEES 125


>gi|325849038|ref|ZP_08170530.1| hypothetical protein HMPREF9246_0218 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325480283|gb|EGC83346.1| hypothetical protein HMPREF9246_0218 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 240

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           IK+++ I+ ++   +L HC+ G DRTG+ S + L I  
Sbjct: 126 IKEILEIMASSDGRVLYHCQEGKDRTGIISMILLLIAG 163


>gi|255587792|ref|XP_002534397.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
 gi|223525370|gb|EEF27985.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
          Length = 212

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V + I+RS  P+     +L+    ++SI+ L    PE + +   +     GI L 
Sbjct: 55  NF-SMVDNGIFRSGFPDSANFSFLQT-LELRSIICL---CPEPYPELNTEFLKANGITLF 109

Query: 103 NFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGL 144
            F +   +E    + ++ I++ + + L     P+L+HCK G  RTG 
Sbjct: 110 QFGIEGYKEPFVNIPEDMIREALKVVLDVRNHPVLVHCKRGKHRTGC 156


>gi|163744309|ref|ZP_02151669.1| hypothetical protein OIHEL45_01960 [Oceanibulbus indolifex HEL-45]
 gi|161381127|gb|EDQ05536.1| hypothetical protein OIHEL45_01960 [Oceanibulbus indolifex HEL-45]
          Length = 152

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 14/122 (11%)

Query: 71  GIKSILNLRGKLPESW--HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           G+K+++N R    +      EE   A  LG+  ++ P++    L  E + +    L   P
Sbjct: 34  GMKTVINFRAADEKGGLSPDEERLVAEKLGLNYLHHPVTPDT-LGPETVDEFRRSLDDLP 92

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           +P+ +HC SG  R G  + + L     +  + A ++           KT  +D+T EKI 
Sbjct: 93  QPVFLHCASGK-RAGAMTLMALAADKGWDGDTALQE----------GKTRGIDLTEEKIG 141

Query: 189 QL 190
           Q 
Sbjct: 142 QF 143


>gi|91094781|ref|XP_968252.1| PREDICTED: similar to Dual specificity protein phosphatase CDC14A
           (CDC14 cell division cycle 14 homolog A) [Tribolium
           castaneum]
 gi|270016553|gb|EFA12999.1| hypothetical protein TcasGA2_TC001964 [Tribolium castaneum]
          Length = 421

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ND  + + ISI + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 257 NDRILNKFISICENAKGVIAVHCKAGLGRTG--TLIACYIMKHY 298


>gi|163761120|ref|ZP_02168197.1| hypothetical protein HPDFL43_13410 [Hoeflea phototrophica DFL-43]
 gi|162281671|gb|EDQ31965.1| hypothetical protein HPDFL43_13410 [Hoeflea phototrophica DFL-43]
          Length = 130

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 46/80 (57%), Gaps = 4/80 (5%)

Query: 68  KEYGIKSILNLR--GKLPESWHKEE-EKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
           K  G KSI+  R  G+ P+    +  ++AA  LG+++ + P+     +  + +++++  +
Sbjct: 43  KAAGFKSIVCHRPDGEAPDQPGFDSVKQAAEALGLEVRHIPIGPM-GVTADAVREMVDAI 101

Query: 125 KTAPKPLLIHCKSGADRTGL 144
           +  P+P+L +C+SGA  T +
Sbjct: 102 EEMPQPMLGYCRSGARSTSV 121


>gi|242044034|ref|XP_002459888.1| hypothetical protein SORBIDRAFT_02g013070 [Sorghum bicolor]
 gi|241923265|gb|EER96409.1| hypothetical protein SORBIDRAFT_02g013070 [Sorghum bicolor]
          Length = 129

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 76  LNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE----LNDEQIKQLIS-ILKTAPKP 130
           L  R   PE + +   +     GI+L  F +  ++E    + +++I++ +  IL  +  P
Sbjct: 3   LRPRCLCPEPYPEANLEFLRAHGIKLFQFGIDGSKEPFVNIPEDRIREALKVILDASNHP 62

Query: 131 LLIHCKSGADRTGLASAVY 149
           +LIHCK G  RTG     +
Sbjct: 63  VLIHCKRGKHRTGCVVGCF 81


>gi|298713544|emb|CBJ27072.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 319

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           I+Q I+  +  P  + +HCK+G  RTG  + +  YI+ HY
Sbjct: 233 IRQFIAACEATPGAVAVHCKAGLGRTG--TCIGCYIMKHY 270


>gi|221195527|ref|ZP_03568582.1| lipoprotein [Atopobium rimae ATCC 49626]
 gi|221184714|gb|EEE17106.1| lipoprotein [Atopobium rimae ATCC 49626]
          Length = 260

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 54/133 (40%), Gaps = 34/133 (25%)

Query: 43  NFHAV-----VPHEIYRSAQP------NGTFIEYLKKEYGIKSILNLRGKLPE------- 84
           NF A+         +YRSA P         +   L ++ G++ IL+      E       
Sbjct: 43  NFRAMRGGRMAEGTVYRSASPCNNEYGRAPYASSLAEKAGVQFILDQADSQEEIEGYYAN 102

Query: 85  -----SWHKEEEKAANDLGIQL-INFPLSATRELNDEQIKQLISILK---TAPKPLLIHC 135
                +WHK    A N   + + +N+        +D+  K+L+  L+   +   P LIHC
Sbjct: 103 ASFDMAWHKGLYDAGNVAALDMSVNYR-------SDKYAKKLVEGLREMISHDGPYLIHC 155

Query: 136 KSGADRTGLASAV 148
             G DRTG   A+
Sbjct: 156 TEGKDRTGFTCAL 168


>gi|116630301|ref|YP_815536.1| protein tyrosine/serine phosphatase [Lactobacillus gasseri ATCC
           33323]
 gi|282852940|ref|ZP_06262281.1| conserved hypothetical protein [Lactobacillus gasseri 224-1]
 gi|116095883|gb|ABJ61035.1| Protein tyrosine/serine phosphatase [Lactobacillus gasseri ATCC
           33323]
 gi|282556048|gb|EFB61669.1| conserved hypothetical protein [Lactobacillus gasseri 224-1]
          Length = 267

 Score = 37.0 bits (84), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 107 SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           S ++E + +  + L++I   T    ++ HC  G DRTGLA+ + LY++ 
Sbjct: 123 SVSQEYSQKAFRNLLNIFANTKDGAIIFHCSEGKDRTGLATVLILYLLG 171


>gi|189464962|ref|ZP_03013747.1| hypothetical protein BACINT_01306 [Bacteroides intestinalis DSM
           17393]
 gi|189437236|gb|EDV06221.1| hypothetical protein BACINT_01306 [Bacteroides intestinalis DSM
           17393]
          Length = 356

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 58/132 (43%), Gaps = 38/132 (28%)

Query: 52  IYRSAQPNG--TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
           +YRSAQ +    +     K  GIK+I++LR +     H   ++     G  +++ P+   
Sbjct: 136 LYRSAQIDSLECYSRRELKNIGIKTIVDLRSESELKGHTPLQE-----GFNVVHIPIKTG 190

Query: 110 ------RELNDEQIK------------------------QLISIL-KTAPKPLLIHCKSG 138
                 R + +++IK                        Q+  IL  +A  P++IHC SG
Sbjct: 191 DMEDILRGIQEQKIKSDTVYRMVERMNRELVMNYHHEYRQIFDILLDSANYPVVIHCSSG 250

Query: 139 ADRTGLASAVYL 150
             RTG+ASA+ L
Sbjct: 251 KGRTGIASALIL 262


>gi|156376370|ref|XP_001630334.1| predicted protein [Nematostella vectensis]
 gi|156217352|gb|EDO38271.1| predicted protein [Nematostella vectensis]
          Length = 329

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            +I Y KK + I +++ L  KL ++      +   D GI+  +         +D  +++ 
Sbjct: 195 AYIPYFKK-HNISTVVRLNKKLYDA------QRFTDHGIEHYDLFFIDGSVPSDMIVRRF 247

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I + A   + IHCK+G  RTG   A YL  + HY
Sbjct: 248 LTIAENAKGGIAIHCKAGLGRTGTLIACYL--MKHY 281


>gi|257876060|ref|ZP_05655713.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
 gi|257810226|gb|EEV39046.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
          Length = 238

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 111 ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           E   EQIKQ++  +  A   +L HC +G DRTG+ + + L
Sbjct: 111 EDRKEQIKQIMETMAAAEGCVLFHCAAGKDRTGVIAMLLL 150


>gi|118104173|ref|XP_425045.2| PREDICTED: similar to Cdc14B2 phosphatase [Gallus gallus]
          Length = 527

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 18/115 (15%)

Query: 49  PHEIYRSAQPNG-------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           PH   RS   NG        +  Y +K + + +I+ L  K+ ++      +   D G + 
Sbjct: 231 PHS--RSKIENGYPHHAPEAYFPYFRK-HKVTTIIRLNKKMYDA------RRFTDAGFEH 281

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            +   +     ND  +K  ++I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 282 FDLFFADGSIPNDTIVKAFLNICENAEGVVAVHCKAGLGRTG--TLIACYIMKHY 334


>gi|157105881|ref|XP_001649066.1| protein phosphatase [Aedes aegypti]
 gi|108879975|gb|EAT44200.1| protein phosphatase [Aedes aegypti]
          Length = 313

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+ EY +K Y + +I+ L  K+ ++            G    +         ND  +K+ 
Sbjct: 183 TYFEYFRK-YNVTTIIRLNVKIYDA------ARFTSAGFTHHDLFFVDGSTPNDAILKKF 235

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I + A   + +HCK+G  RTG     YL  + HY
Sbjct: 236 LTICEQADGAIAVHCKAGLGRTGTLIGAYL--IKHY 269


>gi|289643311|ref|ZP_06475435.1| protein tyrosine/serine phosphatase [Frankia symbiont of Datisca
           glomerata]
 gi|289506885|gb|EFD27860.1| protein tyrosine/serine phosphatase [Frankia symbiont of Datisca
           glomerata]
          Length = 251

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 48/117 (41%), Gaps = 28/117 (23%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF-------------PLSATREL 112
           L+  YG++++++LR +   +       AA  +    ++F             PL      
Sbjct: 49  LRNNYGLRTVIDLRAEAEIAREGRGPLAAEAVAYHNLSFLPGEFVMADDPRYPLIVADRA 108

Query: 113 NDEQIKQLISILKTAPK---------------PLLIHCKSGADRTGLASAVYLYIVA 154
           + ++++  +  L+ AP                P L HC +G DRTG+ +AV L I  
Sbjct: 109 SQDRVEHYLDYLRGAPDAVAGALRLLADPGRLPALFHCAAGKDRTGVLAAVVLDIAG 165


>gi|291291829|gb|ADD91787.1| cell division cycle 14-like protein B [Gallus gallus]
          Length = 460

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 18/115 (15%)

Query: 49  PHEIYRSAQPNG-------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           PH   RS   NG        +  Y +K + + +I+ L  K+ ++      +   D G + 
Sbjct: 231 PHS--RSKIENGYPHHAPEAYFPYFRK-HKVTTIIRLNKKMYDA------RRFTDAGFEH 281

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            +   +     ND  +K  ++I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 282 FDLFFADGSIPNDTIVKAFLNICENAEGVVAVHCKAGLGRTG--TLIACYIMKHY 334


>gi|289643011|ref|ZP_06475143.1| protein tyrosine/serine phosphatase [Frankia symbiont of Datisca
           glomerata]
 gi|289507142|gb|EFD28109.1| protein tyrosine/serine phosphatase [Frankia symbiont of Datisca
           glomerata]
          Length = 241

 Score = 37.0 bits (84), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (73%)

Query: 128 PKPLLIHCKSGADRTGLASAVYL 150
           P PLL+HC +G DRTGL  AV L
Sbjct: 130 PAPLLVHCAAGKDRTGLVVAVLL 152


>gi|116334223|ref|YP_795750.1| protein tyrosine/serine phosphatase [Lactobacillus brevis ATCC 367]
 gi|116099570|gb|ABJ64719.1| Protein tyrosine/serine phosphatase [Lactobacillus brevis ATCC 367]
          Length = 430

 Score = 37.0 bits (84), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           +Q +++L   P+  L HC SG DRTG+A+ + + I+ 
Sbjct: 198 RQFLNMLLDNPQATLYHCSSGKDRTGIATVLIMSILG 234


>gi|229827834|ref|ZP_04453903.1| hypothetical protein GCWU000182_03226 [Abiotrophia defectiva ATCC
           49176]
 gi|229788033|gb|EEP24147.1| hypothetical protein GCWU000182_03226 [Abiotrophia defectiva ATCC
           49176]
          Length = 717

 Score = 37.0 bits (84), Expect = 1.7,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 54/129 (41%), Gaps = 26/129 (20%)

Query: 43  NFHAVV-----PHEIYRSAQP------NGTFIEYLKKEYGIKSILNLRGK---------- 81
           NF +VV     P  +YR + P         +   L +  G+K++LNL             
Sbjct: 144 NFRSVVTTGIKPGVLYRGSSPINNEIGRAAYSNALAEAVGVKTVLNLADNAENIKKYVAA 203

Query: 82  --LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGA 139
                +++K   K  ++  ++L+N  +    +   +++ + +  +     P ++HC  G 
Sbjct: 204 EDFNSAYYK---KLVDNKSVKLLNMNVDIAGKDFSKKLAKGLKFMAGKKAPYMVHCTEGK 260

Query: 140 DRTGLASAV 148
           DR G  SAV
Sbjct: 261 DRAGFVSAV 269


>gi|145354251|ref|XP_001421404.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581641|gb|ABO99697.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 363

 Score = 37.0 bits (84), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-W-----HKEEEKAANDLGIQLINFPL 106
           YR  QP      +L +    K++++LRG   ++ W         +       + +++ P+
Sbjct: 175 YRGGQPTAEGRAWLVRN-NFKTVIDLRGSDRDNQWLQAFGGGSGQGTFGASALNIVHIPI 233

Query: 107 SATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVY 149
                  +E +K+ I  +     +P+L+HCK+G  RTG   A +
Sbjct: 234 PDMEPPTEEDVKRFIETVNDDKMRPILVHCKAGIGRTGSLVACW 277


>gi|118590340|ref|ZP_01547742.1| hypothetical protein SIAM614_02156 [Stappia aggregata IAM 12614]
 gi|118436803|gb|EAV43442.1| hypothetical protein SIAM614_02156 [Stappia aggregata IAM 12614]
          Length = 556

 Score = 37.0 bits (84), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           +E E AA  LG++    P+ A + + DE  ++   ++++ PKP+L +C++G     L S
Sbjct: 46  EEIEAAAQKLGLEARYLPIVAGK-VGDEDAEEFGRLMESLPKPILAYCRTGTRSATLWS 103


>gi|327270628|ref|XP_003220091.1| PREDICTED: dual specificity protein phosphatase CDC14A-like [Anolis
           carolinensis]
          Length = 621

 Score = 37.0 bits (84), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 9/95 (9%)

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
           +  Y +K + + +++ L  K+ E+      K   D G +  +         +D  ++Q +
Sbjct: 239 YFPYFRK-HNVTTVIRLNKKIYEA------KRFTDGGFEHYDLFFIDGSTPSDSILRQFL 291

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           SI + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 292 SICEEAEGAIAVHCKAGLGRTG--TLIACYIMKHY 324


>gi|300362896|ref|ZP_07059066.1| possible protein-tyrosine-phosphatase [Lactobacillus gasseri
           JV-V03]
 gi|300352946|gb|EFJ68824.1| possible protein-tyrosine-phosphatase [Lactobacillus gasseri
           JV-V03]
          Length = 267

 Score = 37.0 bits (84), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 107 SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           S ++E + +  + L++I   T    ++ HC  G DRTGLA+ + LY++ 
Sbjct: 123 SVSQEYSQKAFRSLLNIFANTKDGAIIFHCSEGKDRTGLATVLILYLLG 171


>gi|327194802|gb|EGE61640.1| hypothetical protein RHECNPAF_10550016 [Rhizobium etli CNPAF512]
          Length = 112

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 10/83 (12%)

Query: 68  KEYGIKSILNLRGKLPESWHKEE------EKAANDLGIQLINFPLSATRELNDEQIKQLI 121
           K  G KSI+  R   P+    ++      E  A++LG+++ + P+     + +E ++ ++
Sbjct: 25  KALGFKSIVCHR---PDHESPDQTSFSVIEARASELGLEITHVPVGPMG-VTEEAVQGMV 80

Query: 122 SILKTAPKPLLIHCKSGADRTGL 144
             L   P+P+L +C+SGA  T +
Sbjct: 81  DALDEFPRPMLGYCRSGARSTAI 103


>gi|319937651|ref|ZP_08012054.1| hypothetical protein HMPREF9488_02890 [Coprobacillus sp. 29_1]
 gi|319807086|gb|EFW03700.1| hypothetical protein HMPREF9488_02890 [Coprobacillus sp. 29_1]
          Length = 272

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%)

Query: 130 PLLIHCKSGADRTGLASAVYLYIV 153
           PLL HCK G DRTG A+ + L+I+
Sbjct: 157 PLLHHCKGGKDRTGFATIITLFIL 180


>gi|223648028|gb|ACN10772.1| Dual specificity protein phosphatase CDC14A [Salmo salar]
          Length = 542

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            +  Y +K + I +I+ L  K+ ++      K   D+G +  +         ND  +++ 
Sbjct: 229 AYFPYFRK-HNITTIVRLNKKMYDA------KRFTDMGFEHHDLFFVDGSTPNDSIVRKF 281

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I + A   + +HCK+G  RTG  + +  Y++ HY
Sbjct: 282 LNICENANGAIAVHCKAGLGRTG--TLIGCYMMKHY 315


>gi|240850952|ref|YP_002972352.1| hypothetical protein Bgr_14740 [Bartonella grahamii as4aup]
 gi|240268075|gb|ACS51663.1| hypothetical protein Bgr_14740 [Bartonella grahamii as4aup]
          Length = 109

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE----EKAANDLG 98
           N   + P +I+ SAQ +   I+ L +  G K+I+  R    E  H+ +    +  AN+ G
Sbjct: 2   NLQQIEP-DIFISAQISIENIKTLAQA-GFKTIICNRPDH-EELHQPDFSSIKTVANEYG 58

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGA 139
           I+  + P+S    +    ++ + +ILKTAP PLL +C  GA
Sbjct: 59  IKAYHIPISPPT-IEKSAVEAMQTILKTAPLPLLAYCHHGA 98


>gi|169335186|ref|ZP_02862379.1| hypothetical protein ANASTE_01594 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257924|gb|EDS71890.1| hypothetical protein ANASTE_01594 [Anaerofustis stercorihominis DSM
           17244]
          Length = 246

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 41/103 (39%), Gaps = 24/103 (23%)

Query: 70  YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND--------------- 114
           YG+K +L+LR    E    +  K  +  GI   N PLS    + D               
Sbjct: 61  YGVKDVLDLRS--SEEAELQPNKLKDVEGINYYNIPLSIVDMVADITKEDKNFNMPEGYI 118

Query: 115 ------EQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYL 150
                 E IK +I  I        L HC +G DRTGL +++ L
Sbjct: 119 KRIEHKEIIKGIIEYIADNLNGGFLFHCTAGKDRTGLVASILL 161


>gi|115524420|ref|YP_781331.1| protein tyrosine/serine phosphatase [Rhodopseudomonas palustris
           BisA53]
 gi|115518367|gb|ABJ06351.1| protein tyrosine/serine phosphatase [Rhodopseudomonas palustris
           BisA53]
          Length = 253

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           N +  +QL+  L     PL+IHC +G DRTG A A+ L
Sbjct: 125 NTDTFRQLMVHLLEDHAPLVIHCTAGKDRTGFACAMIL 162


>gi|320594044|gb|EFX06447.1| tyrosine phosphatase family protein [Grosmannia clavigera kw1407]
          Length = 343

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 52/114 (45%), Gaps = 6/114 (5%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK-LPESWHKEEEKAANDLGIQL 101
           NF  VV   +YRS+ P      YLK   G+K+I+ L  K   E + K    +AN++   +
Sbjct: 144 NFGQVVS-GLYRSSYPQPENYAYLKS-LGLKTIVTLVDKNFTEGYQKF--MSANNIQHHV 199

Query: 102 INFPLSATRELNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                +   E+    ++ ++  +L     PLLIHC  G  RTG   AV   I  
Sbjct: 200 FGMKGTKKEEIPLSTMEAILRLVLNRQNYPLLIHCNHGKHRTGCVVAVVRKICG 253


>gi|253999291|ref|YP_003051354.1| hypothetical protein Msip34_1582 [Methylovorus sp. SIP3-4]
 gi|253985970|gb|ACT50827.1| protein of unknown function DUF442 [Methylovorus sp. SIP3-4]
          Length = 146

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           AA   G+Q I FP+    ++  +Q+ +   ++  AP+P+L  C+SG      AS +YL  
Sbjct: 56  AAEAAGLQFIAFPV-IPNQITAQQVAEYKHLIAHAPRPILGFCRSG----NRASTLYLRA 110

Query: 153 VAHYPKEE 160
              YP+++
Sbjct: 111 KMLYPQDK 118


>gi|117621342|ref|YP_855023.1| protein tyrosine phosphatase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562749|gb|ABK39697.1| protein tyrosine phosphatase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 190

 Score = 37.0 bits (84), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 105 PLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           P +A      + +  LI +L+   K L+IHCK G+ RTGL +A  L  +   P++EA   
Sbjct: 108 PDAAFEAAWQQTLPDLIGLLRDG-KHLVIHCKGGSGRTGLVAAALLMSLGQ-PQQEA--- 162

Query: 165 LSMLYGHFP 173
           ++ +  H P
Sbjct: 163 MAAIRAHRP 171


>gi|149177621|ref|ZP_01856223.1| hypothetical protein PM8797T_00402 [Planctomyces maris DSM 8797]
 gi|148843601|gb|EDL57962.1| hypothetical protein PM8797T_00402 [Planctomyces maris DSM 8797]
          Length = 304

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 65/155 (41%), Gaps = 33/155 (21%)

Query: 18  ILLGVLVL-CAVSLGLYFLTIT-----------TFTQNFHAV----------VPHEIYRS 55
           +L+ +LVL C V  G+   T+            T    FH++          +  + Y  
Sbjct: 2   VLIRLLVLVCLVGTGILIETLAAQNEQTNSKTVTHAAQFHSLSIPGLDNVFQIDRQFYSG 61

Query: 56  AQPNG--TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELN 113
           + P+G  +F E   K+ GIK+I+++ G  P+  H      A   G++ I+ P+       
Sbjct: 62  SGPHGEQSFQEL--KKLGIKTIVSVDGTTPDLVH------ARKAGMKYIHIPIGYDGVSE 113

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           D  +     + +    P+ IHC  G  R   A+AV
Sbjct: 114 DAGLA-FARVARDLNGPVYIHCHHGKHRGPTAAAV 147


>gi|62202153|gb|AAH92774.1| Si:dkeyp-95d10.1 [Danio rerio]
          Length = 177

 Score = 37.0 bits (84), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 16/132 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKK--EYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  V P ++   A+P  T + + +   ++GIK +++L    P ++ K  E + + + I 
Sbjct: 28  NFSWVEPCKLAGLARP--TMVHHYRYLLDHGIKHLVSLLEIKPPNYEKCPELSLHQISI- 84

Query: 101 LINF-PLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            ++F P S +      QI Q +SI++ A    + + +HC  G  RTG   A YL    H 
Sbjct: 85  -VDFTPPSRS------QILQFLSIVEKANAKGEGVAVHCAHGHGRTGTMLACYLVKSRHL 137

Query: 157 PKEEAHRQLSML 168
             EEA +++  L
Sbjct: 138 SGEEAIKEIRRL 149


>gi|326924990|ref|XP_003208705.1| PREDICTED: LOW QUALITY PROTEIN: dual specificity protein
           phosphatase CDC14A-like [Meleagris gallopavo]
          Length = 601

 Score = 36.6 bits (83), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 9/95 (9%)

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
           +  Y +K + + SI+ L  K+ E+      K   D G +  +         +D  +++ +
Sbjct: 222 YFPYFRK-HNVTSIVRLNKKIYEA------KRFTDAGFEHYDLFFIDGSTPSDSIVQRFL 274

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 275 NICENANGAIAVHCKAGLGRTG--TLIACYIMKHY 307


>gi|255547596|ref|XP_002514855.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
 gi|223545906|gb|EEF47409.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
          Length = 200

 Score = 36.6 bits (83), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 62/152 (40%), Gaps = 26/152 (17%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP---ESWHKEEEKAANDLGI 99
           NF ++V   I+RSA P      +L         LNLR  +    E + +E  +      I
Sbjct: 20  NF-SMVEDGIFRSAFPQPANFSFLHS-------LNLRSVIYLCLEPYPEENMEFLRAHNI 71

Query: 100 QLINFPL----SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           QL  F +    S+     D  +  L  +L     P+LIHCK G  RTG     +      
Sbjct: 72  QLFQFGIEGKTSSVSIPKDAILGALKVLLDVRNHPILIHCKRGKHRTGTLVGCF------ 125

Query: 156 YPKEEAHRQLSML---YGHFPVLKTITMDITF 184
             ++  H  LS +   Y HF  +K+   D+ F
Sbjct: 126 --RKLQHWCLSSVFEEYQHFAGVKSRAADLKF 155


>gi|297288334|ref|XP_001083391.2| PREDICTED: dual specificity protein phosphatase CDC14C-like [Macaca
           mulatta]
          Length = 484

 Score = 36.6 bits (83), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 247 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFMDAGFDHHDLFFADGSTPTDAIVKKF 299

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +HCK+G  RTG  + +  YI+ H+
Sbjct: 300 LDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHF 333


>gi|88900443|ref|NP_001034709.1| hypothetical protein LOC323834 [Danio rerio]
 gi|56208091|emb|CAI21375.1| novel protein similar to vertebrate dual specificity phosphatase 23
           (DUSP23) [Danio rerio]
 gi|111309264|gb|AAI21762.1| Si:dkeyp-95d10.1 [Danio rerio]
          Length = 161

 Score = 36.6 bits (83), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 16/132 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKK--EYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  V P ++   A+P  T + + +   ++GIK +++L    P ++ K  E + + + I 
Sbjct: 12  NFSWVEPCKLAGLARP--TMVHHYRYLLDHGIKHLVSLLEIKPPNYEKCPELSLHQISI- 68

Query: 101 LINF-PLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            ++F P S +      QI Q +SI++ A    + + +HC  G  RTG   A YL    H 
Sbjct: 69  -VDFTPPSRS------QILQFLSIVEKANAKGEGVAVHCAHGHGRTGTMLACYLVKSRHL 121

Query: 157 PKEEAHRQLSML 168
             EEA +++  L
Sbjct: 122 SGEEAIKEIRRL 133


>gi|238793517|ref|ZP_04637141.1| Protein tyrosine/serine phosphatase [Yersinia intermedia ATCC
           29909]
 gi|238727107|gb|EEQ18637.1| Protein tyrosine/serine phosphatase [Yersinia intermedia ATCC
           29909]
          Length = 265

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 112 LNDEQIKQLISILKTAPKP------LLIHCKSGADRTGLASAVYLYIVA 154
            N++  KQL+ +L+    P      ++ HC  G DRTG+ SA+ L+ + 
Sbjct: 128 FNNQAYKQLVGLLQNCASPEHAAAGVVQHCAVGKDRTGIGSALVLFALG 176


>gi|319411970|emb|CBQ74013.1| related to SIW14-Tyrosine phosphatase involved in actin
           filamentorganization [Sporisorium reilianum]
          Length = 233

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-----RGKLPESWHKEEEKAANDL 97
           NF ++V   IYRS  PN    E+L++   +KS+L L     R  +  +W   +      L
Sbjct: 86  NF-SMVSRGIYRSGHPNERNFEFLRR-LNLKSVLYLGTEDYRANM-TAWTAAQHIRTFHL 142

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
            + +   P +   E +  Q  QLI  L+    P+LIHC  G  R G
Sbjct: 143 RLAINKEPTAEMDEADVVQALQLI--LRPENWPILIHCNKGKYRVG 186


>gi|21553927|gb|AAM63010.1| unknown [Arabidopsis thaliana]
          Length = 204

 Score = 36.6 bits (83), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 16/109 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL---PESWHKEEEKAANDLGI 99
           NF ++V   IYRS  P         + +G  S LNLR  +   PE + ++  K+     I
Sbjct: 19  NF-SMVEDGIYRSGFPE-------LENFGFLSTLNLRSIIYLCPEPYPEDNLKSLASNNI 70

Query: 100 QLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
           +L  F +    +       D  +  L  ++     P+LIHCK G  RTG
Sbjct: 71  KLFQFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTG 119


>gi|167623475|ref|YP_001673769.1| dual specificity protein phosphatase [Shewanella halifaxensis
           HAW-EB4]
 gi|167353497|gb|ABZ76110.1| dual specificity protein phosphatase [Shewanella halifaxensis
           HAW-EB4]
          Length = 156

 Score = 36.6 bits (83), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 20/122 (16%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLK-KEYGIKSILNLRGKLPESWHKEE--EKAANDLG 98
           Q+   +V  +I   + PN    + L+ K  GI +I+++        H E+  E      G
Sbjct: 2   QHLFWLVDGQIAGRSGPNKDPWDLLELKAAGIDAIISVN-------HGEDCIEAELTGAG 54

Query: 99  IQLINFPLSAT-----RELN--DEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAV 148
           +  +  P S        +L+   EQ+ + ++ ++      K +LIHC+SG DRTGL  A 
Sbjct: 55  LDYLCVPFSRNIPPKPEDLDYCVEQVPKALAFIRECEAQDKTVLIHCRSGKDRTGLIMAY 114

Query: 149 YL 150
           YL
Sbjct: 115 YL 116


>gi|110638764|ref|YP_678973.1| protein-tyrosine phosphatase [Cytophaga hutchinsonii ATCC 33406]
 gi|110281445|gb|ABG59631.1| protein-tyrosine phosphatase [Cytophaga hutchinsonii ATCC 33406]
          Length = 438

 Score = 36.6 bits (83), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           E+I   I+  +   K +LIHC  G  R+GL +A YL  +  YP ++A
Sbjct: 363 ERINAFINAQQKKHKKVLIHCVGGLGRSGLVAACYLKSLG-YPSDDA 408


>gi|41057446|ref|NP_957919.1| ORF010 EEV maturation protein [Bovine papular stomatitis virus]
 gi|41018762|gb|AAR98367.1| ORF010 EEV maturation protein [Bovine papular stomatitis virus]
          Length = 643

 Score = 36.6 bits (83), Expect = 2.2,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 44/105 (41%), Gaps = 15/105 (14%)

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K Y I+ I  L       W + EE     +  Q+     +ATRELN  Q   L+S + + 
Sbjct: 516 KGYSIRVIAALE------WGRSEEVLRTGIEAQM-----AATRELNIPQTSNLMSRIASM 564

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF 172
           P PL       +  +G +SAV     A Y +   H  +  +  HF
Sbjct: 565 PLPL----DPDSSPSGRSSAVVRAFAASYCRSTIHSLIERVDSHF 605


>gi|328769227|gb|EGF79271.1| hypothetical protein BATDEDRAFT_6727 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 154

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 9/107 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE----SWHKEEEKAANDLG 98
           + + +V  ++YRS+          +    +K+IL+L  + P     +W ++       LG
Sbjct: 6   DVYGIVEKKVYRSSSLQPASYPLFRH---VKTILSLSPEAPTKSLLNWIEDNRMTLIHLG 62

Query: 99  IQ-LINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTG 143
            Q LI    ++ R +++E IK+ + ++  A K PLLI C SG   TG
Sbjct: 63  YQQLIKPNTNSWRPVSEEMIKEGLELILNADKHPLLIMCTSGVQETG 109


>gi|330797292|ref|XP_003286695.1| hypothetical protein DICPUDRAFT_91774 [Dictyostelium purpureum]
 gi|325083293|gb|EGC36749.1| hypothetical protein DICPUDRAFT_91774 [Dictyostelium purpureum]
          Length = 496

 Score = 36.6 bits (83), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 14/78 (17%)

Query: 95  NDLGI-QLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYL-- 150
           NDLGI ++    L  T+E    +I  +  ILK     P++ +C  G DRTG+ +A+ L  
Sbjct: 291 NDLGIIEMYKLTLIYTKE----EILTIFRILKNPDNYPIMYYCSLGKDRTGMVTALLLSV 346

Query: 151 ------YIVAHYPKEEAH 162
                 YIV  Y K E +
Sbjct: 347 LGVPRDYIVEDYAKSEVN 364


>gi|317106685|dbj|BAJ53187.1| JMS09K11.5 [Jatropha curcas]
          Length = 1017

 Score = 36.6 bits (83), Expect = 2.4,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 69  EYGIKSILNLRGKL-PESWHKEEEKAANDLG-IQLINFPLSATRELNDEQIKQLISILK- 125
           E G K+I++LR ++  +++++E   AA   G ++LI  P+      + E +++  S++  
Sbjct: 292 EKGFKTIIDLRAEIIKDNFYQEAVDAAILSGKVELIKIPVEVMMAPSVEHVEKFASLVSD 351

Query: 126 TAPKPLLIHCKSGADRT 142
            + KP+ +H K GA RT
Sbjct: 352 CSKKPIYLHSKEGAWRT 368


>gi|190892617|ref|YP_001979159.1| hypothetical protein RHECIAT_CH0003032 [Rhizobium etli CIAT 652]
 gi|190697896|gb|ACE91981.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 112

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 10/83 (12%)

Query: 68  KEYGIKSILNLRGKLPESWHKEE------EKAANDLGIQLINFPLSATRELNDEQIKQLI 121
           K  G KSI+  R   P+    ++      E  A +LG+++ + P+     + +E ++ ++
Sbjct: 25  KALGFKSIVCHR---PDHESPDQTSFSVIEARARELGLEITHVPVGPMG-VTEEAVQGMV 80

Query: 122 SILKTAPKPLLIHCKSGADRTGL 144
             L   P+P+L +C+SGA  T +
Sbjct: 81  DALDEFPRPMLGYCRSGARSTAI 103


>gi|295148226|ref|NP_001171207.1| CDC14 cell division cycle 14 homolog A [Gallus gallus]
 gi|291291831|gb|ADD91788.1| cell division cycle 14-like protein A [Gallus gallus]
          Length = 603

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 9/95 (9%)

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
           +  Y +K + I SI+ L  K        E K   D G +  +         +D  +++ +
Sbjct: 229 YFPYFRK-HNITSIIRLNKK------NYEAKRFTDAGFEHYDLFFIDGSTPSDSIVQRFL 281

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 282 NICENANGAIAVHCKAGLGRTG--TLIACYIMKHY 314


>gi|224088701|ref|XP_002191306.1| PREDICTED: similar to CDC14 homolog B [Taeniopygia guttata]
          Length = 566

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 8/89 (8%)

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K+  + +I+ L  KL ++      K   D G +  +   +     +D  +K  ++I + A
Sbjct: 335 KQNKVTTIIRLNKKLYDA------KRFTDAGFEHFDLFFADGSTPSDTIVKTFLNICENA 388

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              + +HCK+G  RTG  + +  YI+ HY
Sbjct: 389 EGVIAVHCKAGLGRTG--TLIACYIMKHY 415


>gi|255721925|ref|XP_002545897.1| hypothetical protein CTRG_00678 [Candida tropicalis MYA-3404]
 gi|240136386|gb|EER35939.1| hypothetical protein CTRG_00678 [Candida tropicalis MYA-3404]
          Length = 284

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 75/160 (46%), Gaps = 30/160 (18%)

Query: 39  TFTQNFHAVVPHEIYRSA--QPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T  +NF  V+ ++IYRS+  QPN  TF     K+  +KSIL L   +PE +   +++   
Sbjct: 120 TPPENFAPVI-NQIYRSSFPQPNNFTF----LKKLKLKSILCL---IPEDYPHLQQEFIK 171

Query: 96  DLGIQLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTG------- 143
           +  I+L    +S  +E    ++ + I + + I L    +P+LIHC  G  RTG       
Sbjct: 172 NENIKLFQLGMSGNKEPFVKISSDLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIR 231

Query: 144 -LASAVYLYIVAHY-----PKEEA-HRQLSMLYGHFPVLK 176
            L +  +  I   Y     PKE    +Q   LY    +LK
Sbjct: 232 RLQNWSFTLICDEYRKFAAPKERPMDQQFIELYDDTEILK 271


>gi|91087805|ref|XP_967596.1| PREDICTED: similar to CDC14 cell division cycle 14 homolog A (S.
           cerevisiae), a [Tribolium castaneum]
 gi|270009373|gb|EFA05821.1| hypothetical protein TcasGA2_TC008603 [Tribolium castaneum]
          Length = 425

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
           G ++EY   ++ +K+++ L  KL +S           +GI+  +         + + +  
Sbjct: 206 GFYLEYFL-QHDVKTVIRLNDKLYDS------SVFTRMGIEHHDLFFDDGSVPSMDILLS 258

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            + I +TAP  + +HCK+G  RTG     YL  + HY
Sbjct: 259 FLRITETAPAAIAVHCKAGLGRTGTLIGAYL--MKHY 293


>gi|194765665|ref|XP_001964947.1| GF22838 [Drosophila ananassae]
 gi|190617557|gb|EDV33081.1| GF22838 [Drosophila ananassae]
          Length = 1052

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDAILKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|240995040|ref|XP_002404568.1| dual specificity protein phosphatase CDC-14 alpha, putative [Ixodes
           scapularis]
 gi|215491590|gb|EEC01231.1| dual specificity protein phosphatase CDC-14 alpha, putative [Ixodes
           scapularis]
          Length = 583

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +++ I I +  P  L +HCK+G  RTG  + +  YI+ HY
Sbjct: 259 SDAIMREFIEISENTPGALAVHCKAGLGRTG--TLIACYIMKHY 300


>gi|320528215|ref|ZP_08029379.1| conserved domain protein [Solobacterium moorei F0204]
 gi|320131388|gb|EFW23954.1| conserved domain protein [Solobacterium moorei F0204]
          Length = 262

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           E IKQ I        PLL HC +G DRTG A AV LY++    KE+
Sbjct: 138 EMIKQNIEF------PLLFHCATGKDRTG-AIAVLLYLLLGVSKED 176


>gi|299769695|ref|YP_003731721.1| hypothetical protein AOLE_07275 [Acinetobacter sp. DR1]
 gi|298699783|gb|ADI90348.1| hypothetical protein AOLE_07275 [Acinetobacter sp. DR1]
          Length = 174

 Score = 36.2 bits (82), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 54/106 (50%), Gaps = 5/106 (4%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
           +++   ++ SAQP+   ++ L KEYG  +++NL      ++ + E++   DLG+  I+ P
Sbjct: 15  SIIHEHLFSSAQPSAEQLK-LIKEYGCSTVINLALSNAPNYIENEDRICLDLGLNYIHIP 73

Query: 106 LSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVY 149
           +      + EQ   ++ ++      + + IHC S  DR+     VY
Sbjct: 74  IDWETP-SAEQCLLVLDLIDHLVQNEIVWIHC-SKNDRSSCLMYVY 117


>gi|157961287|ref|YP_001501321.1| dual specificity protein phosphatase [Shewanella pealeana ATCC
           700345]
 gi|157846287|gb|ABV86786.1| dual specificity protein phosphatase [Shewanella pealeana ATCC
           700345]
          Length = 156

 Score = 36.2 bits (82), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 115 EQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYL 150
           EQ+ + ++ ++      K +LIHC+SG DRTGL  A YL
Sbjct: 78  EQVPKALAFIRECEAQDKTVLIHCRSGKDRTGLIMAYYL 116


>gi|328772667|gb|EGF82705.1| hypothetical protein BATDEDRAFT_22794 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 675

 Score = 36.2 bits (82), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           SA      I Y+K E  IK+I+ L  K   ++ K +   A    I+L  FP   T    +
Sbjct: 273 SAYSMDNLIRYMK-EKNIKTIIRLNNK---TYDKRKFVLAGIEHIELY-FPDGTTPP--E 325

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             +K+ + I +T   P+ +HCK+G  RTG  S +  +I+ HY
Sbjct: 326 GILKRFLEICETREGPIAVHCKAGLGRTG--SLIASFIMKHY 365


>gi|113969712|ref|YP_733505.1| dual specificity protein phosphatase [Shewanella sp. MR-4]
 gi|113884396|gb|ABI38448.1| dual specificity protein phosphatase [Shewanella sp. MR-4]
          Length = 156

 Score = 36.2 bits (82), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYP 157
           P+LIHC+SG DRTGL  A YL      P
Sbjct: 96  PVLIHCRSGKDRTGLIMAYYLMANGAAP 123


>gi|269216650|ref|ZP_06160504.1| putative protein tyrosine phosphatase [Slackia exigua ATCC 700122]
 gi|269129884|gb|EEZ60967.1| putative protein tyrosine phosphatase [Slackia exigua ATCC 700122]
          Length = 344

 Score = 36.2 bits (82), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 130 PLLIHCKSGADRTGLASAVYLYIVA 154
           P L+HC +G DRTG+ SAV LY+  
Sbjct: 230 PALVHCVNGKDRTGVLSAVALYVAG 254


>gi|114046941|ref|YP_737491.1| dual specificity protein phosphatase [Shewanella sp. MR-7]
 gi|113888383|gb|ABI42434.1| dual specificity protein phosphatase [Shewanella sp. MR-7]
          Length = 156

 Score = 36.2 bits (82), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYP 157
           P+LIHC+SG DRTGL  A YL      P
Sbjct: 96  PVLIHCRSGKDRTGLIMAYYLMANGAAP 123


>gi|302336215|ref|YP_003801422.1| protein tyrosine/serine phosphatase [Olsenella uli DSM 7084]
 gi|301320055|gb|ADK68542.1| protein tyrosine/serine phosphatase [Olsenella uli DSM 7084]
          Length = 259

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 8/93 (8%)

Query: 85  SWHKEEEKAANDLGIQLINFPLSATREL-NDEQIKQLISILKTAPKP---LLIHCKSGAD 140
           + H  + KAA     +L  F     R L N + ++++ +   TA +P   ++ HC +G D
Sbjct: 109 NLHDPDLKAAQTGDEELSYFARGYLRILANQDAVRRIFTFFATA-RPTDCVIFHCAAGMD 167

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFP 173
           RTG+ S + L +      +E H      Y  FP
Sbjct: 168 RTGIVSMLLLALAG---ADEDHVAADYAYSFFP 197


>gi|327350326|gb|EGE79183.1| tyrosine phosphatase [Ajellomyces dermatitidis ATCC 18188]
          Length = 255

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 10/113 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV   +YRS+ P    ++ + +   +K+I+ L   + E W ++  +   + GI+ 
Sbjct: 46  ENFAEVV-KGVYRSSFPLPVHLDSISR-LNLKTIITL---VDEEWSRDYGEFIQENGIKS 100

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
              P+ A +        +  I+ L+ IL     P+LIHC  G  RTG   A +
Sbjct: 101 YVIPILANKNPLVFTPYETVIEVLMLILNPMNHPVLIHCNKGKHRTGCVIACF 153


>gi|166228733|sp|Q9UUF3|YNF3_SCHPO RecName: Full=Probable tyrosine-protein phosphatase C17A3.03c
 gi|2257529|dbj|BAA21423.1| HYPOTHETICAL 32.8KD PROTEIN IN NCE3-HHT2 INTERGENIC REGION
           [Schizosaccharomyces pombe]
          Length = 295

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 71/176 (40%), Gaps = 44/176 (25%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK-------------------- 81
            NF  V P  IYRSA P  +   +L+  + I++I++LR +                    
Sbjct: 92  DNFGVVYPGIIYRSACPRASNFNFLESLH-IRTIISLRQEEYSEEDLHYFTKHHINYYHI 150

Query: 82  -LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGAD 140
            +P S H++     ND      N  +S   +++D   K L  +L     P+L+HC  G  
Sbjct: 151 AMPGSKHRK-----NDCISSSSNPDIS---DVDDLVRKTLQLLLNKENWPVLLHCSRGKH 202

Query: 141 RTGL-------------ASAVYLYIVAHYPKE-EAHRQLSMLYGHFPVLKTITMDI 182
           RTG+              + +  YI   +PKE E   +    +   P LK+   D+
Sbjct: 203 RTGIVIGCLRALMNWPVGNRLQEYISFSHPKEREVDEEYIQNFSSDPSLKSSLNDL 258


>gi|195471417|ref|XP_002088001.1| GE18332 [Drosophila yakuba]
 gi|194174102|gb|EDW87713.1| GE18332 [Drosophila yakuba]
          Length = 1054

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDAIMKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|195385928|ref|XP_002051656.1| GJ16755 [Drosophila virilis]
 gi|194148113|gb|EDW63811.1| GJ16755 [Drosophila virilis]
          Length = 709

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 262 DAILKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|91205941|ref|YP_538296.1| hypothetical protein RBE_1126 [Rickettsia bellii RML369-C]
 gi|157826700|ref|YP_001495764.1| hypothetical protein A1I_01685 [Rickettsia bellii OSU 85-389]
 gi|91069485|gb|ABE05207.1| unknown [Rickettsia bellii RML369-C]
 gi|157802004|gb|ABV78727.1| hypothetical protein A1I_01685 [Rickettsia bellii OSU 85-389]
          Length = 442

 Score = 36.2 bits (82), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 11/127 (8%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           R+N+LI+ I   L + +L ++    YF    T  QNF  ++  EIY   + N   I   K
Sbjct: 178 RRNMLIYSISSFLTLSILVSI----YFKIYNTIQQNFR-ILHQEIYEETEINTALINNNK 232

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAA---NDLGIQLINFPLSATR-ELNDEQIKQLISI 123
            +Y ++ +     KL E + K+E       ND   +   FP++ T   L    I+ LI +
Sbjct: 233 ADYDLRKL--FIKKLTEIYLKQELGDTYNPNDFPFKNQLFPINLTDLSLTKINIENLIKL 290

Query: 124 LKTAPKP 130
           L+    P
Sbjct: 291 LQGYFAP 297


>gi|310793987|gb|EFQ29448.1| tyrosine phosphatase [Glomerella graminicola M1.001]
          Length = 301

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 114 DEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           ++  + ++S L T   P P+LIHC +G DRTG+  A+ L +     +  AH
Sbjct: 150 NDPFRTILSHLATPNPPSPMLIHCTAGKDRTGVICAIILSLCGVADEVVAH 200


>gi|281364580|ref|NP_001162905.1| cdc14, isoform C [Drosophila melanogaster]
 gi|272406935|gb|ACZ94196.1| cdc14, isoform C [Drosophila melanogaster]
          Length = 700

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDAIMKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|120435701|ref|YP_861387.1| hypothetical protein GFO_1346 [Gramella forsetii KT0803]
 gi|117577851|emb|CAL66320.1| conserved hypothetical protein [Gramella forsetii KT0803]
          Length = 148

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 6/97 (6%)

Query: 71  GIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           G KS++NL+    E   S  KE+E  A  L ++  +  +S    L++  +      L++ 
Sbjct: 31  GFKSVINLQTDEEEQNVSQEKEKE-LAKKLNLEYKHIGISKDN-LSEAIVNNFRQELESL 88

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           PKP+L+HCKSG  R+G    +++        EE  +Q
Sbjct: 89  PKPILVHCKSGK-RSGAFVMMHIGCQKDMSGEEVIKQ 124


>gi|257065399|ref|YP_003145071.1| protein tyrosine/serine phosphatase [Slackia heliotrinireducens DSM
           20476]
 gi|256793052|gb|ACV23722.1| protein tyrosine/serine phosphatase [Slackia heliotrinireducens DSM
           20476]
          Length = 269

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 24/33 (72%)

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           ++L + +++A  PLL HC +G DRTG+A+ + L
Sbjct: 143 RRLFAEIESANVPLLFHCTAGKDRTGIAAMLIL 175


>gi|281364578|ref|NP_001162904.1| cdc14, isoform B [Drosophila melanogaster]
 gi|54650886|gb|AAV37021.1| GH01148p [Drosophila melanogaster]
 gi|272406934|gb|ACZ94195.1| cdc14, isoform B [Drosophila melanogaster]
          Length = 693

 Score = 36.2 bits (82), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDAIMKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|24582611|ref|NP_609153.1| cdc14, isoform A [Drosophila melanogaster]
 gi|22945904|gb|AAF52562.2| cdc14, isoform A [Drosophila melanogaster]
          Length = 1052

 Score = 36.2 bits (82), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDAIMKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|255558574|ref|XP_002520312.1| poly(p)/ATP NAD kinase, putative [Ricinus communis]
 gi|223540531|gb|EEF42098.1| poly(p)/ATP NAD kinase, putative [Ricinus communis]
          Length = 1003

 Score = 36.2 bits (82), Expect = 3.0,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 69  EYGIKSILNLRGK-LPESWHKEEEKAANDLG-IQLINFPLSATRELNDEQIKQLISILK- 125
           E G K+I++LR + + +++++E    A   G ++LI  P+ A    + +Q+ +  S++  
Sbjct: 279 EKGFKTIIDLRAETIKDNFYQEAVDVAILSGKVELIKIPVEARTAPSVDQVVKFASLVSD 338

Query: 126 TAPKPLLIHCKSGADRT 142
           +  KP+ +H K GA RT
Sbjct: 339 STKKPIYLHSKEGAWRT 355


>gi|218661441|ref|ZP_03517371.1| hypothetical protein RetlI_18865 [Rhizobium etli IE4771]
          Length = 103

 Score = 36.2 bits (82), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
           E  A +LG+++ + P+     + +E ++ ++  L   P+P+L +C+SGA  T +
Sbjct: 51  EARAKELGLEITHVPVGPMG-VTEEAVQGMVDALDEFPRPMLGYCRSGARSTAI 103


>gi|195339011|ref|XP_002036115.1| GM13298 [Drosophila sechellia]
 gi|194129995|gb|EDW52038.1| GM13298 [Drosophila sechellia]
          Length = 985

 Score = 36.2 bits (82), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDAIMKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|222086476|ref|YP_002545010.1| hypothetical protein Arad_3037 [Agrobacterium radiobacter K84]
 gi|221723924|gb|ACM27080.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 112

 Score = 36.2 bits (82), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
           E  A +LG+++ + P+     + +E ++ ++  L   P+P+L +C+SGA  T +
Sbjct: 51  EARAKELGLEITHVPVGPMG-VTEEAVQGMVDALDEFPRPMLGYCRSGARSTAI 103


>gi|195577383|ref|XP_002078550.1| GD22466 [Drosophila simulans]
 gi|194190559|gb|EDX04135.1| GD22466 [Drosophila simulans]
          Length = 1039

 Score = 36.2 bits (82), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDAIMKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|19112377|ref|NP_595585.1| phosphoprotein phosphatase (predicted) [Schizosaccharomyces pombe
           972h-]
 gi|5679722|emb|CAB51762.1| phosphoprotein phosphatase (predicted) [Schizosaccharomyces pombe]
          Length = 263

 Score = 36.2 bits (82), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 77/197 (39%), Gaps = 44/197 (22%)

Query: 21  GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG 80
           G+ V+   +    F        NF  V P  IYRSA P  +   +L+  + I++I++LR 
Sbjct: 39  GIKVVDTSNDASTFSNSPLVPDNFGVVYPGIIYRSACPRASNFNFLESLH-IRTIISLRQ 97

Query: 81  K---------------------LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
           +                     +P S H++     ND      N  +S   +++D   K 
Sbjct: 98  EEYSEEDLHYFTKHHINYYHIAMPGSKHRK-----NDCISSSSNPDIS---DVDDLVRKT 149

Query: 120 LISILKTAPKPLLIHCKSGADRTGL-------------ASAVYLYIVAHYPKE-EAHRQL 165
           L  +L     P+L+HC  G  RTG+              + +  YI   +PKE E   + 
Sbjct: 150 LQLLLNKENWPVLLHCSRGKHRTGIVIGCLRALMNWPVGNRLQEYISFSHPKEREVDEEY 209

Query: 166 SMLYGHFPVLKTITMDI 182
              +   P LK+   D+
Sbjct: 210 IQNFSSDPSLKSSLNDL 226


>gi|224536830|ref|ZP_03677369.1| hypothetical protein BACCELL_01706 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224521552|gb|EEF90657.1| hypothetical protein BACCELL_01706 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 392

 Score = 35.8 bits (81), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 57/130 (43%), Gaps = 34/130 (26%)

Query: 52  IYRSAQPNG--TFIEYLKKEYGIKSILNLRGKLPESWHK--------------------- 88
           +YRSAQ +    +     K  GIK+I++LR +     H                      
Sbjct: 173 LYRSAQIDSLECYSRRELKNIGIKTIIDLRSESELKGHTPLQQGFNVIHVPIKTGDMEDI 232

Query: 89  ----EEEKAANDLGIQLINFPLSATREL---NDEQIKQLISIL-KTAPKPLLIHCKSGAD 140
               +E+K  +D   +++       REL     ++ +Q+  IL  +   P++IHC SG  
Sbjct: 233 LKGIQEQKIKSDTVYRMVE---RMNRELVMHYHKEYRQIFDILLNSTNYPVVIHCSSGKG 289

Query: 141 RTGLASAVYL 150
           RTG+ASA+ L
Sbjct: 290 RTGIASALIL 299


>gi|255034453|ref|YP_003085074.1| protein tyrosine/serine phosphatase [Dyadobacter fermentans DSM
           18053]
 gi|254947209|gb|ACT91909.1| protein tyrosine/serine phosphatase [Dyadobacter fermentans DSM
           18053]
          Length = 316

 Score = 35.8 bits (81), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +K +++ +  + +P+L HC +G DRTG+ SA+ L ++
Sbjct: 187 VKDILNQILRSEQPVLYHCSAGKDRTGIISAIILSVL 223


>gi|302500224|ref|XP_003012106.1| tyrosine phosphatase family protein [Arthroderma benhamiae CBS
           112371]
 gi|291175662|gb|EFE31466.1| tyrosine phosphatase family protein [Arthroderma benhamiae CBS
           112371]
          Length = 366

 Score = 35.8 bits (81), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 10/113 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E        GI  
Sbjct: 156 NNFAEVV-KGIYRSSFPLPVHLSSLA-QLNLKTIVTL---VDEEWSPEYSAFVRGNGITS 210

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
              P+ A ++ N        ++ L  +L T   P+++HC  G  RTG   A +
Sbjct: 211 RIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACF 263


>gi|238853723|ref|ZP_04644090.1| protein tyrosine/serine phosphatase [Lactobacillus gasseri 202-4]
 gi|238833659|gb|EEQ25929.1| protein tyrosine/serine phosphatase [Lactobacillus gasseri 202-4]
          Length = 267

 Score = 35.8 bits (81), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 107 SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           S ++E + +  + L++I   T    ++ HC  G DRTG+A+ + LY++ 
Sbjct: 123 SVSQEYSQKAFRSLLNIFANTKDGAIIFHCSEGKDRTGIATVLILYLLG 171


>gi|298706626|emb|CBJ29564.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 731

 Score = 35.8 bits (81), Expect = 3.4,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 13/84 (15%)

Query: 82  LPESWHKEEEKAANDLGIQLINFP----LSATRELNDEQIKQLISILKTAPKPLLIHCKS 137
           LPE++ +E        GI + NF      + +  L  + I+  +S L+T  K + +HC +
Sbjct: 298 LPETFMRE--------GISVYNFSWEDMTTPSMALLSDIIRVALSCLRTGGK-IAVHCHA 348

Query: 138 GADRTGLASAVYLYIVAHYPKEEA 161
           G  RTGL  A  L ++ + P ++A
Sbjct: 349 GYGRTGLVIASILVMMNNLPPQQA 372


>gi|224057310|ref|XP_002187902.1| PREDICTED: similar to CDC14A [Taeniopygia guttata]
          Length = 623

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            +  Y KK + + SI+ L  K+ E+      K   + G +  +         +D  +++ 
Sbjct: 229 AYFPYFKK-HNVTSIIRLNKKIYEA------KRFTEAGFEHYDLFFIDGSTPSDSIVQRF 281

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 282 LNICENADGAIAVHCKAGLGRTG--TLIACYIMKHY 315


>gi|212695657|ref|ZP_03303785.1| hypothetical protein ANHYDRO_00174 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212677330|gb|EEB36937.1| hypothetical protein ANHYDRO_00174 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 240

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           +K+++ I+  A   +L HC+ G DRTG+ S + L
Sbjct: 126 VKEILEIMADADGRVLYHCQEGKDRTGIISMILL 159


>gi|195118469|ref|XP_002003759.1| GI18084 [Drosophila mojavensis]
 gi|193914334|gb|EDW13201.1| GI18084 [Drosophila mojavensis]
          Length = 1117

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDTILKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|317146237|ref|XP_001821385.2| tyrosine phosphatase family protein [Aspergillus oryzae RIB40]
          Length = 242

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 29/170 (17%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   IYRSA P+   +  L+   G+K+I+ L   + E +         + GI   
Sbjct: 49  NFGEVV-EGIYRSAFPSPWNLPALEN-LGLKTIITL---VEEPYSVSHMSFLRENGIAHF 103

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYL------- 150
              + A ++  ++    +I+     +L  A  P+LIHC  G  RTG   A +        
Sbjct: 104 RIIVQANKDPEEKTPDHVINGILEILLNKANHPILIHCNKGKHRTGCVVACFRKVQGWNL 163

Query: 151 ------YIVAHYPKEEAHRQLSMLYGHFPVLKTITMD-ITFEKITQLYPN 193
                 Y+   +PK  A  +     G F   K   +D +  E   +LYPN
Sbjct: 164 RDVLDEYLSYSWPKSRALDE--RFIGAFDATK---LDQVAKESGAKLYPN 208


>gi|71018997|ref|XP_759729.1| hypothetical protein UM03582.1 [Ustilago maydis 521]
 gi|46099240|gb|EAK84473.1| hypothetical protein UM03582.1 [Ustilago maydis 521]
          Length = 632

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 56/113 (49%), Gaps = 12/113 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-----RGKLPESWHKEEEKAANDL 97
           NF A+V   IYRS  PN    E+L++   +K++L L     R  +  +W   +    + L
Sbjct: 401 NF-AMVSRGIYRSGHPNERNFEFLRR-LSLKTVLYLGTEDYRSNM-TNWTASQNITTHHL 457

Query: 98  GIQLINFPLSATRELND-EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
            + +   P   T E++  + +K L  ILK    P+LIHC  G  R+   ++++
Sbjct: 458 RLAINKEP---TAEMDHADVVKALQLILKPENWPILIHCNKGKYRSWSHTSIF 507


>gi|328885129|emb|CCA58368.1| conventional protein tyrosine phosphatase [Streptomyces venezuelae
           ATCC 10712]
          Length = 252

 Score = 35.8 bits (81), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 21/96 (21%)

Query: 68  KEYGIKSILNLR--------GKLPE----SWH------KEEEKAANDLGIQLINFPLSAT 109
           +  G+ ++++LR        G+LPE    SWH      +  ++ A D  +    +     
Sbjct: 53  RSLGVATVIDLRYPWEIAAKGRLPETEDVSWHNLSVEHRPYDQEAIDPALDPWRYLADRF 112

Query: 110 RELNDE---QIKQLISILKTAPKPLLIHCKSGADRT 142
            E+ ++   +++  + ++  A  PL+ HC SG DRT
Sbjct: 113 AEVAEDGAVELRTALEVIAAADGPLVFHCASGKDRT 148


>gi|313112505|ref|ZP_07798175.1| LysR substrate binding domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310625169|gb|EFQ08454.1| LysR substrate binding domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 588

 Score = 35.8 bits (81), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
             ++  K+L   L+    P+L HC +G DRTG+A+ + L
Sbjct: 455 FGNKAFKELFRALEAGETPILFHCSAGKDRTGVAAMLIL 493


>gi|71019627|ref|XP_760044.1| hypothetical protein UM03897.1 [Ustilago maydis 521]
 gi|74701239|sp|Q4P7L6|OCA1_USTMA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|46099837|gb|EAK85070.1| hypothetical protein UM03897.1 [Ustilago maydis 521]
          Length = 158

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 53/110 (48%), Gaps = 9/110 (8%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE----SWHKEEEKAANDLGIQ 100
           + +V    YRS QP+     +L+K  G+KS++ L  + PE     +  ++    + LG+ 
Sbjct: 8   YGMVEENFYRSGQPDQLNFPFLEK-LGLKSVIWLAPEEPEPGFLDFCVDQNIELHHLGVL 66

Query: 101 LINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVY 149
              +  +A   + +E + Q + +L + A  P+L+ C  G  RTG     +
Sbjct: 67  ---YSTNAWDPITEEVVLQALHLLVQPATYPVLVMCNLGRHRTGTVVGCF 113


>gi|254489337|ref|ZP_05102540.1| conserved hypothetical protein TIGR01244 [Roseobacter sp. GAI101]
 gi|214041844|gb|EEB82484.1| conserved hypothetical protein TIGR01244 [Roseobacter sp. GAI101]
          Length = 143

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query: 66  LKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           L ++ GI+SI+  R    ++     ++    A   GI++ + P+S     NDE + +  +
Sbjct: 23  LLRDKGIRSIICNRPDGEDAGQPRFQDLSNKAQKQGIEMRHIPVSGGI-FNDESVAEFSN 81

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAV 148
            L   PKP+L +C     RTG+ SA 
Sbjct: 82  ALNILPKPILAYC-----RTGMRSAA 102


>gi|46487431|gb|AAS99113.1| PTP/DSP-like [Dictyostelium discoideum]
          Length = 590

 Score = 35.8 bits (81), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 14/78 (17%)

Query: 95  NDLGI-QLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYL-- 150
           NDLGI ++    L  T+E    +I  +  ILK     P++ +C  G DRTG+ SA+ L  
Sbjct: 384 NDLGIIEMYKLTLIYTKE----EILTIFRILKNPDNYPIMYYCSLGKDRTGMVSALLLSA 439

Query: 151 ------YIVAHYPKEEAH 162
                  ++  Y K EA+
Sbjct: 440 LGVSREVVIDDYSKSEAN 457


>gi|254285028|ref|ZP_04959994.1| dual specificity protein phosphatase [Vibrio cholerae AM-19226]
 gi|150425031|gb|EDN16808.1| dual specificity protein phosphatase [Vibrio cholerae AM-19226]
          Length = 162

 Score = 35.8 bits (81), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           +++HCKSG DRTGLA A Y      +  EE+
Sbjct: 101 VVVHCKSGKDRTGLALAAYFLKSKGFGVEES 131


>gi|66809279|ref|XP_638362.1| hypothetical protein DDB_G0285191 [Dictyostelium discoideum AX4]
 gi|60466805|gb|EAL64852.1| hypothetical protein DDB_G0285191 [Dictyostelium discoideum AX4]
          Length = 594

 Score = 35.8 bits (81), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 14/78 (17%)

Query: 95  NDLGI-QLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYL-- 150
           NDLGI ++    L  T+E    +I  +  ILK     P++ +C  G DRTG+ SA+ L  
Sbjct: 388 NDLGIIEMYKLTLIYTKE----EILTIFRILKNPDNYPIMYYCSLGKDRTGMVSALLLSA 443

Query: 151 ------YIVAHYPKEEAH 162
                  ++  Y K EA+
Sbjct: 444 LGVSREVVIDDYSKSEAN 461


>gi|319936207|ref|ZP_08010627.1| hypothetical protein HMPREF9488_01459 [Coprobacillus sp. 29_1]
 gi|319808781|gb|EFW05314.1| hypothetical protein HMPREF9488_01459 [Coprobacillus sp. 29_1]
          Length = 245

 Score = 35.8 bits (81), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 60/146 (41%), Gaps = 30/146 (20%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK--KEYGIKSILNLRGKLPESW 86
            LG Y     T+T++      H+  R++ P       ++  K+YG+K++++LR    +  
Sbjct: 21  DLGGYETQAGTYTKS------HKYIRASSPANASKADIQALKDYGVKAVIDLRSDFEKEQ 74

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQ----------LISILKTAPKPL----- 131
                    D+    +N   S    +  E++KQ          ++  +K   K L     
Sbjct: 75  QVNPFVDDQDIDFYEVNLFDSTKASIVPEEVKQYKDLGGVYIYMLEGMKNKFKDLFDIFL 134

Query: 132 -------LIHCKSGADRTGLASAVYL 150
                  + HC +G DRTG+ +A+ L
Sbjct: 135 KYPYDGVMFHCSAGKDRTGITAALLL 160


>gi|302784156|ref|XP_002973850.1| hypothetical protein SELMODRAFT_34445 [Selaginella moellendorffii]
 gi|300158182|gb|EFJ24805.1| hypothetical protein SELMODRAFT_34445 [Selaginella moellendorffii]
          Length = 255

 Score = 35.8 bits (81), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 59/146 (40%), Gaps = 10/146 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW----------HKEEEK 92
           N++ V+P+ I  S   N   ++ LKK+  + ++ NL+     ++          H +E  
Sbjct: 10  NYNRVLPNLIVGSCLQNPADVDRLKKDENVTTVCNLQQDPDMAYFNVDISEIRDHAKEVG 69

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
             N L + + +    A R      I  L   LK     L +HC +G  R    +  Y++ 
Sbjct: 70  DFNHLRLPIRDMDGFALRMRLPSVIASLYQELKDREGTLYVHCTAGLGRAPAVALGYMFW 129

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTI 178
           V  Y   EA+  L       P ++ I
Sbjct: 130 VLGYDLHEAYLLLQSKRKCVPSMENI 155


>gi|325003092|ref|ZP_08124204.1| putative tyrosine specific protein phosphatase [Pseudonocardia sp.
           P1]
          Length = 249

 Score = 35.8 bits (81), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRT 142
           ++ +++ I+  AP P+L+HC +G DRT
Sbjct: 124 ELARIVRIVADAPAPVLVHCAAGKDRT 150


>gi|149927290|ref|ZP_01915546.1| hypothetical protein LMED105_09950 [Limnobacter sp. MED105]
 gi|149824004|gb|EDM83227.1| hypothetical protein LMED105_09950 [Limnobacter sp. MED105]
          Length = 141

 Score = 35.8 bits (81), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 48/90 (53%), Gaps = 11/90 (12%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE------EKAANDLGIQLINFPLSA 108
           SAQ +   +++L+   G+KS++  R   P+  H E+       + A++LG+     P   
Sbjct: 18  SAQISKDELKHLQA-LGVKSVICFR---PDGEHPEQPEFDDLSREASELGLVCYYLPYDV 73

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSG 138
             +++ E ++Q+  I++ APKP    CK+G
Sbjct: 74  A-QVSSELMQQMHRIIEEAPKPAHAFCKTG 102


>gi|34811075|pdb|1OHE|A Chain A, Structure Of Cdc14b Phosphatase With A Peptide Ligand
          Length = 348

 Score = 35.8 bits (81), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T+I+Y K  + + +I+ L  ++ ++      K   D G    +   +      D  +K+ 
Sbjct: 209 TYIQYFKN-HNVTTIIRLNKRMYDA------KRFTDAGFDHHDLFFADGSTPTDAIVKEF 261

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + I + A   + +H K+G  RTG  + +  YI+ HY
Sbjct: 262 LDICENAEGAIAVHSKAGLGRTG--TLIACYIMKHY 295


>gi|227356977|ref|ZP_03841349.1| protein tyrosine/serine phosphatase [Proteus mirabilis ATCC 29906]
 gi|227162855|gb|EEI47814.1| protein tyrosine/serine phosphatase [Proteus mirabilis ATCC 29906]
          Length = 265

 Score = 35.4 bits (80), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 112 LNDEQIKQLISILKTAPKPLLI-HCKSGADRTGLASAVYLYIVA 154
           +N+   KQL ++LK   K  +I HC  G DRTG+ SA+ L+ + 
Sbjct: 133 INNPAYKQLATLLKQPEKGGVIQHCAVGKDRTGVGSALVLFALG 176


>gi|212637550|ref|YP_002314075.1| Toxin secretion ABC transporter ATP-binding subunit/permease
           [Shewanella piezotolerans WP3]
 gi|212559034|gb|ACJ31488.1| Toxin secretion ABC transporter, ATP-binding subunit/permease
           protein, putative [Shewanella piezotolerans WP3]
          Length = 711

 Score = 35.4 bits (80), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 4/97 (4%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
            +IFY    L  +VL AV+L  Y +      Q + A+   EI   A+ N  F+E ++   
Sbjct: 305 FMIFYYSPKLSAIVLIAVAL--YAIIRIAMYQPYRAISEQEIIARAEENSNFMESVRAIQ 362

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
            IK +     K    W      A N   I+L NF +S
Sbjct: 363 TIK-LFGSEAKREGQWQNRYAAAINQ-NIRLGNFTIS 397


>gi|79387510|ref|NP_186929.2| phosphatase/ phosphoprotein phosphatase/ protein tyrosine
           phosphatase [Arabidopsis thaliana]
 gi|51969092|dbj|BAD43238.1| unknown protein [Arabidopsis thaliana]
 gi|332640340|gb|AEE73861.1| tyrosine specific protein phosphatase-like protein [Arabidopsis
           thaliana]
          Length = 203

 Score = 35.4 bits (80), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   IYRS  P      +LK    ++SI+ L    PE + +E  K      I+L 
Sbjct: 20  NF-SMVEDGIYRSGFPRPENFSFLKT-LNLRSIIYL---CPEPYPEENLKFLEANNIKLY 74

Query: 103 NFPLSA-----TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
            F +       T    D  +  L  ++     P+LIHCK G  RTG
Sbjct: 75  QFGIEGKTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTG 120


>gi|126333895|ref|XP_001362632.1| PREDICTED: similar to hCG32512, [Monodelphis domestica]
          Length = 490

 Score = 35.4 bits (80), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ ++I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 292 SDAIVKEFLNICENAEGVVAVHCKAGLGRTG--TLIACYIIKHY 333


>gi|242022864|ref|XP_002431858.1| dual specificity protein phosphatase CDC14, putative [Pediculus
           humanus corporis]
 gi|212517190|gb|EEB19120.1| dual specificity protein phosphatase CDC14, putative [Pediculus
           humanus corporis]
          Length = 865

 Score = 35.4 bits (80), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +K  + I ++AP  + +HCK+G  RTG  S +  Y++ HY
Sbjct: 292 LKTFLKIAESAPGAIAVHCKAGLGRTG--SLIGAYLLKHY 329


>gi|197287338|ref|YP_002153210.1| hypothetical protein PMI3533 [Proteus mirabilis HI4320]
 gi|194684825|emb|CAR46918.1| conserved hypothetical protein [Proteus mirabilis HI4320]
          Length = 260

 Score = 35.4 bits (80), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 112 LNDEQIKQLISILKTAPKPLLI-HCKSGADRTGLASAVYLYIVA 154
           +N+   KQL ++LK   K  +I HC  G DRTG+ SA+ L+ + 
Sbjct: 128 INNPAYKQLATLLKQPEKGGVIQHCAVGKDRTGVGSALVLFALG 171


>gi|83646875|ref|YP_435310.1| hypothetical protein HCH_04178 [Hahella chejuensis KCTC 2396]
 gi|83634918|gb|ABC30885.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 153

 Score = 35.4 bits (80), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIV 153
           ++ G+QL + P++  ++L +   + L  IL  A   P+L+HC S ++R G   A+  + V
Sbjct: 59  DNQGLQLFSIPVAGPQDLTEANARALADILNEAENCPVLVHCMS-SNRVGALLALKAFFV 117

Query: 154 AHYPKEEA 161
                EEA
Sbjct: 118 DGASLEEA 125


>gi|254520778|ref|ZP_05132834.1| exported protein [Clostridium sp. 7_2_43FAA]
 gi|226914527|gb|EEH99728.1| exported protein [Clostridium sp. 7_2_43FAA]
          Length = 701

 Score = 35.4 bits (80), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 3/63 (4%)

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP--LLIHCKSGA 139
           +PES   EEE  A   G+Q I  P++      D+ +K  I  +   P    L  HCK G 
Sbjct: 160 IPESVQNEEE-LAKSKGMQYIRIPVTDGNLPTDDMVKYFIDFVSKLPNDTWLHFHCKEGI 218

Query: 140 DRT 142
            RT
Sbjct: 219 GRT 221


>gi|332853862|ref|ZP_08435021.1| TIGR01244 family protein [Acinetobacter baumannii 6013150]
 gi|332865972|ref|ZP_08436740.1| TIGR01244 family protein [Acinetobacter baumannii 6013113]
 gi|332728343|gb|EGJ59722.1| TIGR01244 family protein [Acinetobacter baumannii 6013150]
 gi|332734902|gb|EGJ65989.1| TIGR01244 family protein [Acinetobacter baumannii 6013113]
          Length = 551

 Score = 35.4 bits (80), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           E E++A   G+ +I  P+++ + + D+Q+ +   + + A KP+L +C+SG
Sbjct: 49  EIEESAQQYGLNVIYQPVTSGK-ITDQQVNEFKQLYQNAQKPILAYCRSG 97


>gi|162453365|ref|YP_001615732.1| putative protein tyrosine/serine phosphatase [Sorangium cellulosum
           'So ce 56']
 gi|161163947|emb|CAN95252.1| putative Protein tyrosine/serine phosphatase [Sorangium cellulosum
           'So ce 56']
          Length = 346

 Score = 35.4 bits (80), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 49/109 (44%), Gaps = 8/109 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  V+P E+   A P+         E G +S+++L  + P          A    +  
Sbjct: 5   ENFSFVIPGELAGMAYPHAPQAVEELAELGFRSLVSLSRRAPPP--------ATVGPLIH 56

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           ++ PL+    +    + + ++ L  AP+P+ +H + G  RTG+  A  L
Sbjct: 57  LHCPLADFTRIPSVDLLRAVAFLGRAPRPIAVHGEGGVGRTGVVLACRL 105


>gi|81097645|gb|AAI09415.1| Si:dkeyp-95d10.1 protein [Danio rerio]
          Length = 181

 Score = 35.4 bits (80), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 16/132 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKK--EYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  V P ++   A+P  T + + +   ++GIK +++L    P ++ K  E + + + I 
Sbjct: 32  NFSWVEPCKLAGLARP--TMVHHYRYLLDHGIKHLVSLLEIKPPNYEKCPELSLHQISI- 88

Query: 101 LINF-PLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            ++F P S +      QI + +SI++ A    + + +HC  G  RTG   A YL    H 
Sbjct: 89  -VDFTPPSRS------QILRFLSIVEKANAKGEGVAVHCAHGHGRTGTMLACYLVKSRHL 141

Query: 157 PKEEAHRQLSML 168
             EEA +++  L
Sbjct: 142 SGEEAIKEIRRL 153


>gi|26988654|ref|NP_744079.1| phosphatase family protein, putative [Pseudomonas putida KT2440]
 gi|24983437|gb|AAN67543.1|AE016383_5 phosphatase family protein, putative [Pseudomonas putida KT2440]
          Length = 167

 Score = 35.4 bits (80), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 93  AANDLGIQLINFPLSATR------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           AA   G++    P+   +      E    +I+  +  L  + K L IHCK G+ RTGL +
Sbjct: 67  AAKQHGLEWFQLPIEDDQAPDQNFEARLGEIRHQLDALLASNKALAIHCKGGSGRTGLFA 126

Query: 147 AVYLYIVAHYPKEEA 161
           A  L I +  P+ EA
Sbjct: 127 A-RLLIESGMPRREA 140


>gi|127512384|ref|YP_001093581.1| dual specificity protein phosphatase [Shewanella loihica PV-4]
 gi|126637679|gb|ABO23322.1| dual specificity protein phosphatase [Shewanella loihica PV-4]
          Length = 156

 Score = 35.4 bits (80), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 17/21 (80%)

Query: 130 PLLIHCKSGADRTGLASAVYL 150
           P++IHC+SG DRTGL  A YL
Sbjct: 96  PVMIHCRSGKDRTGLLMAYYL 116


>gi|295426141|ref|ZP_06818808.1| protein-tyrosine phosphatase [Lactobacillus amylolyticus DSM 11664]
 gi|295064177|gb|EFG55118.1| protein-tyrosine phosphatase [Lactobacillus amylolyticus DSM 11664]
          Length = 265

 Score = 35.4 bits (80), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 117 IKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVA 154
           I+Q++ +L   P   +L HC  G DRTG+ + + LY++ 
Sbjct: 136 IRQILELLVNTPDGAVLFHCSEGKDRTGIIAVIILYLLG 174


>gi|295103809|emb|CBL01353.1| Transcriptional regulator [Faecalibacterium prausnitzii SL3/3]
          Length = 585

 Score = 35.4 bits (80), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            ++  K+L   L+    P+L HC +G DRTG+A+ + L
Sbjct: 453 GNKAFKELFRALEAGETPILFHCTAGKDRTGVAAMLIL 490


>gi|160943576|ref|ZP_02090809.1| hypothetical protein FAEPRAM212_01069 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445255|gb|EDP22258.1| hypothetical protein FAEPRAM212_01069 [Faecalibacterium prausnitzii
           M21/2]
          Length = 585

 Score = 35.4 bits (80), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            ++  K+L   L+    P+L HC +G DRTG+A+ + L
Sbjct: 453 GNKAFKELFRALEAGETPILFHCTAGKDRTGVAAMLIL 490


>gi|83954875|ref|ZP_00963553.1| hypothetical protein NAS141_00350 [Sulfitobacter sp. NAS-14.1]
 gi|83840601|gb|EAP79773.1| hypothetical protein NAS141_00350 [Sulfitobacter sp. NAS-14.1]
          Length = 560

 Score = 35.4 bits (80), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           +E +KAA + G++    P+ + + + D+ +++  + LK  P+P+L +C++G     L S
Sbjct: 48  EEIQKAAREAGLEAAYVPVQSGK-VTDKNVEEFGAALKELPRPVLAYCRTGTRSATLWS 105


>gi|310794979|gb|EFQ30440.1| hypothetical protein GLRG_05584 [Glomerella graminicola M1.001]
          Length = 308

 Score = 35.4 bits (80), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 12/61 (19%)

Query: 107 SATRELND-EQIKQLISILKTAP----KPLLIHCKSGADRTGLASAVYL-------YIVA 154
           SAT   N+ E ++Q++      P    +P+LIHC  G DRTG+  A+ L        IVA
Sbjct: 141 SATSHENEFEPLRQILRYFSETPATQLRPILIHCSLGKDRTGVICALILSLCGVDDSIVA 200

Query: 155 H 155
           H
Sbjct: 201 H 201


>gi|294463799|gb|ADE77424.1| unknown [Picea sitchensis]
          Length = 287

 Score = 35.4 bits (80), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 14/120 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEE---KAANDLG 98
           N+  + P+ I  S   N   I+ LK+E G+ +ILNL + K  E W  +     K   +LG
Sbjct: 100 NYTRITPNLIVGSQPQNAEDIDRLKEEEGVTAILNLQQDKDIEYWGIDLGSIVKRCQELG 159

Query: 99  IQLINFPLSATRELNDEQIK----QLISILKTA---PKPLLIHCKSGADRTGLASAVYLY 151
           I+ +  P    R+ + + ++    + +S L  A      + +HC +G  R    +  YL+
Sbjct: 160 IRHMRRP---ARDFDPDSLRKELPKAVSSLDWAISKGGTVYVHCTAGLGRAPAVAIAYLF 216


>gi|330793689|ref|XP_003284915.1| hypothetical protein DICPUDRAFT_86492 [Dictyostelium purpureum]
 gi|325085131|gb|EGC38544.1| hypothetical protein DICPUDRAFT_86492 [Dictyostelium purpureum]
          Length = 226

 Score = 35.4 bits (80), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 51/121 (42%), Gaps = 8/121 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +   +Y  A P    IE L  +Y I S++NL  +     +    +     GI  +  P+ 
Sbjct: 84  IDDNVYLGAMPMSYNIEMLVSKYQINSVVNLCDE-----YNGPIQQYTRYGITQLYIPVV 138

Query: 108 ATRELNDEQIKQLISILKT---APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
              E   ++IK  I  ++    +   + IHCK+G  R+G  +  +L        E+A + 
Sbjct: 139 DHYEPTVQEIKSSIDFIQRQVESGNRVFIHCKAGRGRSGAIAICWLAHSKRISIEQAQKM 198

Query: 165 L 165
           L
Sbjct: 199 L 199


>gi|6728982|gb|AAF26980.1|AC018363_25 unknown protein [Arabidopsis thaliana]
 gi|34365627|gb|AAQ65125.1| At3g02800 [Arabidopsis thaliana]
          Length = 199

 Score = 35.4 bits (80), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF ++V   IYRS  P      +LK    ++SI+ L    PE + +E  K      I+L 
Sbjct: 16  NF-SMVEDGIYRSGFPRPENFSFLKT-LNLRSIIYL---CPEPYPEENLKFLEANNIKLY 70

Query: 103 NFPLSA-----TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
            F +       T    D  +  L  ++     P+LIHCK G  RTG
Sbjct: 71  QFGIEGKTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTG 116


>gi|327542791|gb|EGF29253.1| methylglyoxal synthase [Rhodopirellula baltica WH47]
          Length = 219

 Score = 35.4 bits (80), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           ++++L   +   PKP+LIHC  G  RTGL ++  L +  
Sbjct: 148 ELRELAIQINDMPKPVLIHCAQGHGRTGLVASAVLIVTG 186


>gi|294140318|ref|YP_003556296.1| tyrosine-specific protein phosphatase [Shewanella violacea DSS12]
 gi|293326787|dbj|BAJ01518.1| tyrosine-specific protein phosphatase, putative [Shewanella
           violacea DSS12]
          Length = 156

 Score = 35.4 bits (80), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 115 EQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYL 150
           EQ+ + ++ ++   +   P+LIHC+SG DRT L  A YL
Sbjct: 78  EQLPKALTFIRDCEEKNLPVLIHCRSGKDRTALIMAYYL 116


>gi|119593366|gb|EAW72960.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae), isoform
           CRA_e [Homo sapiens]
          Length = 284

 Score = 35.4 bits (80), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            +  Y KK + + +++ L  K+ E+      K   D G +  +         +D  +++ 
Sbjct: 112 AYFPYFKK-HNVTAVVRLNKKIYEA------KRFTDAGFEHYDLFFIDGSTPSDNIVRRF 164

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I +     + +HCK+G  RTG  + +  Y++ HY
Sbjct: 165 LNICENTEGAIAVHCKAGLGRTG--TLIACYVMKHY 198


>gi|226954093|ref|ZP_03824557.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
 gi|226835134|gb|EEH67517.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
          Length = 181

 Score = 35.0 bits (79), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 56/108 (51%), Gaps = 7/108 (6%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
           ++V   ++ SAQP+   ++ L KEYG  +++NL     E+   ++++   DLG+  I+ P
Sbjct: 22  SLVHEHLFTSAQPSTEELQ-LIKEYGCSTVINLATSKSENHLVKQDQICLDLGLNYIHIP 80

Query: 106 LSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLY 151
           +      + EQ   ++ ++      + + +HC   A    ++S +YLY
Sbjct: 81  IDWDVPCS-EQCLLVLDLIDHLVQNEVVWLHC---AKNMRVSSLMYLY 124


>gi|193077337|gb|ABO12136.2| hypothetical protein A1S_1709 [Acinetobacter baumannii ATCC 17978]
          Length = 551

 Score = 35.0 bits (79), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           E E+AA   G+ +I  P+ + + + D+Q+ +   + + A KP+L +C+SG        A+
Sbjct: 49  EIEEAAQQYGLNVIYQPVISGK-ITDQQVTEFKQLYQNAQKPVLAYCRSG------MRAI 101

Query: 149 YLYIVAHYPKEEA 161
            L+ +A    ++A
Sbjct: 102 SLWALAEVAPQDA 114


>gi|289643578|ref|ZP_06475693.1| protein tyrosine/serine phosphatase [Frankia symbiont of Datisca
           glomerata]
 gi|289506584|gb|EFD27568.1| protein tyrosine/serine phosphatase [Frankia symbiont of Datisca
           glomerata]
          Length = 242

 Score = 35.0 bits (79), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQL---ISILKTAPKPLLIHCKSGADRTG 143
           H+   +A  D  ++   F      E+  + IK+L   ++++  +  PL+ HC SG DRTG
Sbjct: 87  HQPYNQAGLDSDVEPARFLADRYTEIAHDGIKELRRALNVIADSTTPLVFHCHSGKDRTG 146


>gi|169796016|ref|YP_001713809.1| putative NAD(FAD)-dependent dehydrogenase [Acinetobacter baumannii
           AYE]
 gi|213157250|ref|YP_002319295.1| oxidoreductase [Acinetobacter baumannii AB0057]
 gi|215483473|ref|YP_002325690.1| hypothetical protein ABBFA_001787 [Acinetobacter baumannii
           AB307-0294]
 gi|301344726|ref|ZP_07225467.1| hypothetical protein AbauAB0_00755 [Acinetobacter baumannii AB056]
 gi|301510297|ref|ZP_07235534.1| hypothetical protein AbauAB05_01939 [Acinetobacter baumannii AB058]
 gi|301596398|ref|ZP_07241406.1| hypothetical protein AbauAB059_11305 [Acinetobacter baumannii
           AB059]
 gi|169148943|emb|CAM86818.1| conserved hypothetical protein; putative NAD(FAD)-dependent
           dehydrogenase [Acinetobacter baumannii AYE]
 gi|213056410|gb|ACJ41312.1| oxidoreductase [Acinetobacter baumannii AB0057]
 gi|213989009|gb|ACJ59308.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
          Length = 551

 Score = 35.0 bits (79), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
           E E+AA   G+ +I  P+ + + + D+Q+ +   + + A KP+L +C+SG        A+
Sbjct: 49  EIEEAAQQYGLNVIYQPVISGK-ITDQQVTEFKQLYQNAQKPVLAYCRSG------MRAI 101

Query: 149 YLYIVAHYPKEEA 161
            L+ +A    ++A
Sbjct: 102 SLWALAEVAPQDA 114


>gi|291326732|ref|ZP_06125620.2| tyrosine specific protein phosphatase [Providencia rettgeri DSM
           1131]
 gi|291313049|gb|EFE53502.1| tyrosine specific protein phosphatase [Providencia rettgeri DSM
           1131]
          Length = 270

 Score = 35.0 bits (79), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLI-HCKSGADRTGLASAVYLYIVA 154
           Q   F L     LN+    QL+++LK   K  ++ HC  G DRTG+ SA+ L+ + 
Sbjct: 126 QAFMFRLYELLPLNNPAYYQLVNLLKQPEKGGIVQHCAVGKDRTGVGSALVLFALG 181


>gi|300794713|ref|NP_001180167.1| dual specificity protein phosphatase CDC14B [Bos taurus]
          Length = 498

 Score = 35.0 bits (79), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           D  +K+ + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 293 DAIVKEFLDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 333


>gi|322488131|emb|CBZ23377.1| dual specificity phosphatase-like protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 627

 Score = 35.0 bits (79), Expect = 5.7,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAA--NDLGIQLINFPLSATRELNDEQIK--QLI 121
           L K + I+ +LN+  +L  +   EE+  A  ND+  + I    S T+++++  IK  + I
Sbjct: 63  LLKAHNIRYVLNVAKELIPT---EEKMIAQNNDIVSEWIPMSDSHTQDVSEHLIKAFRFI 119

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
              ++    +L+HC+ G  R+      YL    H   EEA
Sbjct: 120 ERARSEHSRVLVHCRRGISRSAAIIVAYLMASEHRSYEEA 159


>gi|297478144|ref|XP_002689878.1| PREDICTED: CDC14 cell division cycle 14 homolog B (S. cerevisiae)
           [Bos taurus]
 gi|296484491|gb|DAA26606.1| CDC14 cell division cycle 14 homolog B [Bos taurus]
          Length = 501

 Score = 35.0 bits (79), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           D  +K+ + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 296 DAIVKEFLDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 336


>gi|114557963|ref|XP_001134788.1| PREDICTED: CDC14 homolog A isoform 1 [Pan troglodytes]
          Length = 383

 Score = 35.0 bits (79), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            +  Y KK + + +++ L  K+ E+      K   D G +  +         +D  +++ 
Sbjct: 211 AYFPYFKK-HNVTAVVRLNKKIYEA------KRFTDAGFEHYDLFFIDGSTPSDNIVRRF 263

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I +     + +HCK+G  RTG  + +  Y++ HY
Sbjct: 264 LNICENTEGAIAVHCKAGLGRTG--TLIACYVMKHY 297


>gi|281344907|gb|EFB20491.1| hypothetical protein PANDA_018800 [Ailuropoda melanoleuca]
          Length = 435

 Score = 35.0 bits (79), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           D  +K+ + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 242 DAIVKEFLDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 282


>gi|301786697|ref|XP_002928762.1| PREDICTED: dual specificity protein phosphatase CDC14B-like
           [Ailuropoda melanoleuca]
          Length = 461

 Score = 35.0 bits (79), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           D  +K+ + I + A   + +HCK+G  RTG  + +  YI+ HY
Sbjct: 256 DAIVKEFLDICENAEGAIAVHCKAGLGRTG--TLIACYIMKHY 296


>gi|15004718|ref|NP_149178.1| protein tyrosine phosphatase II superfamily protein [Clostridium
           acetobutylicum ATCC 824]
 gi|14994330|gb|AAK76760.1|AE001438_13 Protein tyrosine phosphatase II superfamily protein [Clostridium
           acetobutylicum ATCC 824]
 gi|325511161|gb|ADZ22796.1| Protein tyrosine phosphatase II superfamily protein [Clostridium
           acetobutylicum EA 2018]
          Length = 319

 Score = 35.0 bits (79), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP--LLIHCKSGADRTGLASA 147
           EE+ A  LGI      +   +  +D QI   +S +K  PK   L  HC+ G  RT    A
Sbjct: 181 EEQLAKALGINYSRITVPDHKTPDDAQINSFVSFVKNLPKGTWLHFHCRGGKGRTTTFMA 240

Query: 148 VYLYIV 153
           +Y  ++
Sbjct: 241 MYDMMI 246


>gi|330803113|ref|XP_003289554.1| hypothetical protein DICPUDRAFT_35957 [Dictyostelium purpureum]
 gi|325080360|gb|EGC33919.1| hypothetical protein DICPUDRAFT_35957 [Dictyostelium purpureum]
          Length = 168

 Score = 35.0 bits (79), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 56/103 (54%), Gaps = 10/103 (9%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLGIQLINF 104
           A+V   +YR + P      +LK+ + +K+I++L  K P +S++   E+     G    +F
Sbjct: 15  AIVEEGLYRGSYPTDRNFRFLKR-FKLKTIVSLTPKPPTKSFYTFCER----YGTTGKHF 69

Query: 105 PLSATRE---LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTG 143
            +S  ++   L+  Q+ QL+ ++ + +  P+ +HC  GA+ TG
Sbjct: 70  TVSKFKDDVTLSASQVVQLLELMIEPSNLPMYVHCLDGANVTG 112


>gi|295102815|emb|CBL00360.1| Transcriptional regulator [Faecalibacterium prausnitzii L2-6]
          Length = 586

 Score = 35.0 bits (79), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           K+L   L+    P+L HC +G DRTG+A+ + L
Sbjct: 459 KELFRALEAGETPVLFHCSAGKDRTGVAAILIL 491


>gi|170044330|ref|XP_001849805.1| phosphatase [Culex quinquefasciatus]
 gi|167867522|gb|EDS30905.1| phosphatase [Culex quinquefasciatus]
          Length = 746

 Score = 35.0 bits (79), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ND  +K+ ++I + A   + +HCK+G  RTG  + +  Y++ HY
Sbjct: 259 NDAILKKFLTICEQADGGIAVHCKAGLGRTG--TLIGAYLIKHY 300


>gi|298530788|ref|ZP_07018190.1| dual specificity protein phosphatase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510162|gb|EFI34066.1| dual specificity protein phosphatase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 352

 Score = 35.0 bits (79), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 8/86 (9%)

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K+ GI +ILNL  + P+    E E+ A   G  +   P+      + E +   +  +  +
Sbjct: 39  KQAGIDAILNLCAEFPDL--PEIERRA---GFDVYYLPVEDEETPDMETMDNALEWMDES 93

Query: 128 ---PKPLLIHCKSGADRTGLASAVYL 150
               K +L+HC+ G  RTG  +A YL
Sbjct: 94  IYLGKKVLVHCRHGIGRTGTLTAAYL 119


>gi|15451933|ref|NP_201570.1| dual specificity protein phosphatase CDC14A isoform 3 [Homo
           sapiens]
 gi|3136330|gb|AAC16660.1| Cdc14A3 phosphatase [Homo sapiens]
 gi|55665696|emb|CAH70068.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|62739607|gb|AAH93916.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|62740039|gb|AAH93918.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|119593362|gb|EAW72956.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae), isoform
           CRA_a [Homo sapiens]
          Length = 383

 Score = 35.0 bits (79), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            +  Y KK + + +++ L  K+ E+      K   D G +  +         +D  +++ 
Sbjct: 211 AYFPYFKK-HNVTAVVRLNKKIYEA------KRFTDAGFEHYDLFFIDGSTPSDNIVRRF 263

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I +     + +HCK+G  RTG  + +  Y++ HY
Sbjct: 264 LNICENTEGAIAVHCKAGLGRTG--TLIACYVMKHY 297


>gi|262279369|ref|ZP_06057154.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259720|gb|EEY78453.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 173

 Score = 35.0 bits (79), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLK--KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           +V+   ++ SAQP+   IE LK  KEYG  +++NL      +  + E++   DLG+  I+
Sbjct: 15  SVIHEHLFSSAQPS---IEQLKLIKEYGCSTVINLALSNAPNHIENEDRICLDLGLNYIH 71

Query: 104 FPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVY 149
            P+      + EQ   ++ ++      + + IHC    DR+     VY
Sbjct: 72  IPIDWETP-SAEQCLLVLDLIDHLVQNEIVWIHCTKN-DRSSCLMYVY 117


>gi|195434338|ref|XP_002065160.1| GK15301 [Drosophila willistoni]
 gi|194161245|gb|EDW76146.1| GK15301 [Drosophila willistoni]
          Length = 1109

 Score = 35.0 bits (79), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  Y++ HY
Sbjct: 261 SDAILKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYMMKHY 302


>gi|257440226|ref|ZP_05615981.1| putative protein-tyrosine phosphatase [Faecalibacterium prausnitzii
           A2-165]
 gi|257197260|gb|EEU95544.1| putative protein-tyrosine phosphatase [Faecalibacterium prausnitzii
           A2-165]
          Length = 586

 Score = 35.0 bits (79), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           K+L   L+    P+L HC  G DRTG+A+ + L
Sbjct: 459 KELFRALEAGETPILFHCSGGKDRTGVAAMLIL 491


>gi|195034156|ref|XP_001988836.1| GH11379 [Drosophila grimshawi]
 gi|193904836|gb|EDW03703.1| GH11379 [Drosophila grimshawi]
          Length = 1099

 Score = 35.0 bits (79), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  Y++ HY
Sbjct: 262 SDAILKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYMMKHY 303


>gi|149025787|gb|EDL82030.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) (predicted),
           isoform CRA_c [Rattus norvegicus]
          Length = 357

 Score = 35.0 bits (79), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            +  Y KK   + +I+ L  K+ E+      K   D G +  +         +D  +++ 
Sbjct: 180 AYFPYFKKN-NVTTIVRLNKKIYEA------KRFTDAGFEHYDLFFIDGSTPSDNIVRRF 232

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           ++I +     + +HCK+G  RTG  + +  Y++ HY
Sbjct: 233 LNICENTEGAIAVHCKAGLGRTG--TLIACYVMKHY 266


>gi|302413737|ref|XP_003004701.1| tyrosine-protein phosphatase SIW14 [Verticillium albo-atrum
           VaMs.102]
 gi|261357277|gb|EEY19705.1| tyrosine-protein phosphatase SIW14 [Verticillium albo-atrum
           VaMs.102]
          Length = 362

 Score = 35.0 bits (79), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 53/115 (46%), Gaps = 19/115 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEEKAANDL---- 97
           NF  VVP  +YRS+ P      ++K   G+++I+ L R   P+ ++     A+N +    
Sbjct: 126 NFGIVVP-GVYRSSYPKPEDFGFVKN-LGLRTIVTLGRRDEPDEFYANF-LASNSIRHHI 182

Query: 98  ----GIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
               G +  + PL   R++       L  +L     PL+IHC  G  RTG   AV
Sbjct: 183 IEMKGTKKQSIPLMTMRDI-------LRIVLDKQQYPLMIHCNHGKHRTGCVVAV 230


>gi|198473863|ref|XP_001356478.2| GA20127 [Drosophila pseudoobscura pseudoobscura]
 gi|198138141|gb|EAL33542.2| GA20127 [Drosophila pseudoobscura pseudoobscura]
          Length = 1067

 Score = 34.7 bits (78), Expect = 7.2,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  Y++ HY
Sbjct: 262 SDAIMKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYMMKHY 303


>gi|195147338|ref|XP_002014637.1| GL18848 [Drosophila persimilis]
 gi|194106590|gb|EDW28633.1| GL18848 [Drosophila persimilis]
          Length = 1091

 Score = 34.7 bits (78), Expect = 7.2,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ +SI +T    + +HCK+G  RTG  S +  Y++ HY
Sbjct: 262 SDAIMKKFLSICETTKGAIAVHCKAGLGRTG--SLIGAYMMKHY 303


>gi|328870334|gb|EGG18709.1| putative tyrosine phosphatase family protein [Dictyostelium
           fasciculatum]
          Length = 164

 Score = 34.7 bits (78), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 8/105 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE----SWHKEEEKAANDLG 98
           NF  +V  ++YRS QPN     +L+K   +K I+ L  + P     ++  +++     LG
Sbjct: 9   NF-GMVADDLYRSGQPNELNFPFLEK-LQLKKIIFLAPEDPSQQFVNFCDDQDIELIHLG 66

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
           I  +  P +   E  D  I  L  IL     PL I C  G  RTG
Sbjct: 67  IDTMTNPWNPISE--DVVISALKIILNPDNYPLAIMCNLGRHRTG 109


>gi|239610794|gb|EEQ87781.1| tyrosine phosphatase [Ajellomyces dermatitidis ER-3]
          Length = 255

 Score = 34.7 bits (78), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 10/113 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VV   +YRS+ P    ++ + +   +K+I+ L   + E W  +  +   + GI+ 
Sbjct: 46  ENFAEVV-KGVYRSSFPLPVHLDSISR-LNLKTIITL---VDEEWSHDYGEFIQENGIKS 100

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
              P+ A +        +  I+ L+ IL     P+LIHC  G  RTG   A +
Sbjct: 101 YVIPILANKNPLVFTPYETVIEVLMLILNPMNHPVLIHCNKGKHRTGCVIACF 153


>gi|309364547|emb|CAP24807.2| hypothetical protein CBG_04012 [Caenorhabditis briggsae AF16]
          Length = 571

 Score = 34.7 bits (78), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 26/35 (74%), Gaps = 2/35 (5%)

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +L+++ + +PKP+++HC +G  RTG  + V ++I+
Sbjct: 453 RLLNLYRASPKPIIVHCSAGVGRTG--TLVLIFII 485


>gi|238880096|gb|EEQ43734.1| tyrosine-protein phosphatase SIW14 [Candida albicans WO-1]
          Length = 277

 Score = 34.7 bits (78), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  
Sbjct: 113 TPPENFAPVI-NKIYRSSFPQPNNFAFLKKL-KLKSILCL---IPEDYPHLQQEFIKNEN 167

Query: 99  IQLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAV 148
           I+L    +S  +E    ++ + I + + I L    +P+LIHC  G  RTG    V
Sbjct: 168 IKLFQLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGV 222


>gi|68490198|ref|XP_711079.1| hypothetical protein CaO19.1850 [Candida albicans SC5314]
 gi|68490289|ref|XP_711035.1| hypothetical protein CaO19.9408 [Candida albicans SC5314]
 gi|46432307|gb|EAK91796.1| hypothetical protein CaO19.9408 [Candida albicans SC5314]
 gi|46432354|gb|EAK91840.1| hypothetical protein CaO19.1850 [Candida albicans SC5314]
          Length = 281

 Score = 34.7 bits (78), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  
Sbjct: 117 TPPENFAPVI-NKIYRSSFPQPNNFAFLKKL-KLKSILCL---IPEDYPHLQQEFIKNEN 171

Query: 99  IQLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAV 148
           I+L    +S  +E    ++ + I + + I L    +P+LIHC  G  RTG    V
Sbjct: 172 IKLFQLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGV 226


>gi|241958954|ref|XP_002422196.1| tyrosine-protein phosphatase, putative [Candida dubliniensis CD36]
 gi|223645541|emb|CAX40200.1| tyrosine-protein phosphatase, putative [Candida dubliniensis CD36]
          Length = 280

 Score = 34.7 bits (78), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  
Sbjct: 116 TPPENFAPVI-NKIYRSSFPQPNNFAFLKK-LKLKSILCL---IPEDYPHLQQEFIKNEN 170

Query: 99  IQLINFPLSATRE----LNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAV 148
           I+L    +S  +E    ++ + I + + I L    +P+LIHC  G  RTG    V
Sbjct: 171 IKLFQLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGV 225


>gi|149178973|ref|ZP_01857548.1| hypothetical protein PM8797T_10484 [Planctomyces maris DSM 8797]
 gi|148842172|gb|EDL56560.1| hypothetical protein PM8797T_10484 [Planctomyces maris DSM 8797]
          Length = 149

 Score = 34.7 bits (78), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 6/96 (6%)

Query: 51  EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLS 107
           E+    QPN   I Y   + G K+I+N R    +      + EE+      ++ ++ P+S
Sbjct: 10  EVTVGPQPNHKEI-YEFGKNGFKTIVNFRAPHEKDQPINPQAEEQIVKGADMEYLHIPVS 68

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
               L++  + Q     +  PKP+  HCKSG  R G
Sbjct: 69  MNS-LDESLVDQFREQYEALPKPIFAHCKSGK-RAG 102


>gi|322496415|emb|CBZ31485.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 668

 Score = 34.7 bits (78), Expect = 7.8,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 2/98 (2%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK--QLISI 123
           L K + I+ +LN+  +L  +   +     ND+  + I    S T+++++  IK  + I  
Sbjct: 95  LLKAHNIRYVLNVAKELIPTEEAKMIAQNNDIVSEWIPMSDSHTQDVSEHLIKAFRFIER 154

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            ++    +L+HC+ G  R+      YL    H   E+A
Sbjct: 155 ARSEHSRVLVHCRRGISRSAAIIVAYLMASEHRSYEDA 192


>gi|321398911|emb|CAM65341.2| dual specificity phosphatase-like protein [Leishmania infantum
           JPCM5]
          Length = 671

 Score = 34.7 bits (78), Expect = 7.8,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 2/98 (2%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK--QLISI 123
           L K + I+ +LN+  +L  +   +     ND+  + I    S T+++++  IK  + I  
Sbjct: 95  LLKAHNIRYVLNVAKELIPTEEAKMIAQNNDIVSEWIPMSDSHTQDVSEHLIKAFRFIER 154

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            ++    +L+HC+ G  R+      YL    H   E+A
Sbjct: 155 ARSEHSRVLVHCRRGISRSAAIIVAYLMASEHRSYEDA 192


>gi|315041409|ref|XP_003170081.1| hypothetical protein MGYG_07325 [Arthroderma gypseum CBS 118893]
 gi|311345115|gb|EFR04318.1| hypothetical protein MGYG_07325 [Arthroderma gypseum CBS 118893]
          Length = 678

 Score = 34.7 bits (78), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 111 ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYG 170
           E+  EQ  Q + I      PL+IH  S ++  G      L  +  Y +++  +QLS++ G
Sbjct: 252 EMASEQ-SQSVDITPDESLPLIIHAISSSESHGEGYGCLLNALNGYLQKDKFQQLSIING 310

Query: 171 HFPVLKTITMDITFE 185
           H   L +I MD TF+
Sbjct: 311 HVEALLSIFMD-TFK 324


>gi|268565357|ref|XP_002639420.1| Hypothetical protein CBG04012 [Caenorhabditis briggsae]
          Length = 538

 Score = 34.7 bits (78), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 26/35 (74%), Gaps = 2/35 (5%)

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +L+++ + +PKP+++HC +G  RTG  + V ++I+
Sbjct: 435 RLLNLYRASPKPIIVHCSAGVGRTG--TLVLIFII 467


>gi|294808467|ref|ZP_06767220.1| conserved hypothetical protein, YceG family [Bacteroides
          xylanisolvens SD CC 1b]
 gi|294444395|gb|EFG13109.1| conserved hypothetical protein, YceG family [Bacteroides
          xylanisolvens SD CC 1b]
          Length = 371

 Score = 34.7 bits (78), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 3  KIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTF 62
          K+KK ++N+L+    IL+G  +LCAV+ G ++  +  F   FH      IY         
Sbjct: 26 KMKKKKRNILL---SILIGAFLLCAVAGGTFYYYL--FAPQFHPSKTVYIYVDRDDTADS 80

Query: 63 IEYLKKEYG 71
          I +  KE+G
Sbjct: 81 IYHKIKEFG 89


>gi|219362899|ref|NP_001136639.1| hypothetical protein LOC100216768 [Zea mays]
 gi|194696478|gb|ACF82323.1| unknown [Zea mays]
          Length = 373

 Score = 34.7 bits (78), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
           IHC +G  R    +  Y++ +  Y   E HR L      FP L+ I +  T + +T L  
Sbjct: 188 IHCTAGLGRAPAVALAYMFWILGYSLNEGHRLLQSKRACFPKLEAIKL-ATADILTGLSK 246

Query: 193 NNVS 196
           N ++
Sbjct: 247 NTIT 250


>gi|238491852|ref|XP_002377163.1| tyrosine phosphatase family protein [Aspergillus flavus NRRL3357]
 gi|220697576|gb|EED53917.1| tyrosine phosphatase family protein [Aspergillus flavus NRRL3357]
          Length = 183

 Score = 34.7 bits (78), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 10/112 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   IYRSA P+   +  L+   G+K+I+ L   + E +         + GI   
Sbjct: 8   NFGEVV-EGIYRSAFPSPWNLPALEN-LGLKTIITL---VEEPYSVSHMSFLRENGIAHF 62

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVY 149
              + A ++  ++    +I+     +L  A  P+LIHC  G  RTG   A +
Sbjct: 63  RIIVQANKDPEEKTPDHVINGILEILLNKANHPILIHCNKGKHRTGCVVACF 114


>gi|193638888|ref|XP_001943978.1| PREDICTED: dual specificity protein phosphatase 7-like
           [Acyrthosiphon pisum]
          Length = 421

 Score = 34.7 bits (78), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 68/155 (43%), Gaps = 22/155 (14%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           ++F   +  +++     N   +E+LKK + I+ ILN+   LP ++ ++         I+ 
Sbjct: 230 RDFPVEILPDLFLGNATNSEDLEWLKK-HRIEYILNVTSDLPNTFEEQGH-------IKY 281

Query: 102 INFPLSATRELNDE----QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  P+S     N      Q  + I   +   K +L+HC +G  R+      YL       
Sbjct: 282 MQIPISDHMGQNLASFFPQAIEFIDKSRAQKKGVLVHCLAGISRSVTVMLAYLM------ 335

Query: 158 KEEAHRQLSMLYGHFPVLKT-ITMDITFEKITQLY 191
              AHRQL++   +  VLK    +D  F  + QL+
Sbjct: 336 ---AHRQLTLNEAYNMVLKRKANIDPNFHFMQQLH 367


>gi|302831047|ref|XP_002947089.1| hypothetical protein VOLCADRAFT_56904 [Volvox carteri f.
           nagariensis]
 gi|300267496|gb|EFJ51679.1| hypothetical protein VOLCADRAFT_56904 [Volvox carteri f.
           nagariensis]
          Length = 207

 Score = 34.7 bits (78), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 52/134 (38%), Gaps = 9/134 (6%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR-GKLPESWHKEEEKAANDLGIQLI 102
           +H +VP+ I  +   N + ++ L +   I  ILNL+  K    W  + E          I
Sbjct: 19  YHEIVPNLICGTQPRNASDVDILAESERITHILNLQQDKDMHYWGVKLEDIRRACSRHSI 78

Query: 103 NFPLSATRELNDEQIKQ--------LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           N      R+ +   +++        L   L +    + +HC +G  R       YLY   
Sbjct: 79  NHMRRPARDFDPHSLRRTIPGAVHSLAQALNSGGSRVYVHCTAGLGRAPAVCIAYLYWFT 138

Query: 155 HYPKEEAHRQLSML 168
               +EA+  L+ L
Sbjct: 139 QLQLDEAYSYLTSL 152


>gi|325187341|emb|CCA21879.1| hypothetical protein ALNC14_080220 [Albugo laibachii Nc14]
          Length = 169

 Score = 34.7 bits (78), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 16/110 (14%)

Query: 42  QNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           +NF A++   +YRS  P   N  F+E L    G++SIL L   + E +     +      
Sbjct: 32  ENF-AMIERGLYRSGFPKKKNFAFLESL----GLRSILTL---VLEEYPFANTEFNKTNR 83

Query: 99  IQLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
           IQL+ F +   +E          +  L ++L     P+LIHC  G  RTG
Sbjct: 84  IQLLQFGVPGNKEPFVDIPEAGMLSALKAVLDIRNHPMLIHCNKGKHRTG 133


>gi|88799531|ref|ZP_01115108.1| protein tyrosine/serine phosphatase [Reinekea sp. MED297]
 gi|88777841|gb|EAR09039.1| protein tyrosine/serine phosphatase [Reinekea sp. MED297]
          Length = 132

 Score = 34.7 bits (78), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW--HKEEEKAA 94
           +  F  N H +  H ++RS QP+           G ++I+NLRG  P  W  +  E++A 
Sbjct: 44  LRAFWSNLHPLT-HSVWRSNQPS-PRRIRRLARRGFRTIVNLRG--PSRWGSYALEKEAC 99

Query: 95  NDLGIQLINFPLSATR 110
              G+ LIN  + + R
Sbjct: 100 EQSGLTLINHKMYSRR 115


>gi|289618604|emb|CBI54848.1| unnamed protein product [Sordaria macrospora]
          Length = 345

 Score = 34.7 bits (78), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 14/17 (82%)

Query: 128 PKPLLIHCKSGADRTGL 144
           P PLL+HC +G DRTGL
Sbjct: 205 PAPLLVHCSAGKDRTGL 221


>gi|168701290|ref|ZP_02733567.1| dual specificity protein phosphatase [Gemmata obscuriglobus UQM
           2246]
          Length = 157

 Score = 34.7 bits (78), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 11/87 (12%)

Query: 68  KEYGIKSILNL-RGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           + +GI  +++L    LP +W        ND G+  ++ P+      +  Q   +++ LK 
Sbjct: 29  RRHGIDVLVSLTENPLPRNW-------LNDAGLLAVSVPVPDMEPPSQRQFDHVLATLKR 81

Query: 127 APKPLL---IHCKSGADRTGLASAVYL 150
           A    +   IHC +G  RTG   A Y 
Sbjct: 82  AHDSQMGVAIHCAAGLGRTGTVLAAYF 108


>gi|145478487|ref|XP_001425266.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124392335|emb|CAK57868.1| unnamed protein product [Paramecium tetraurelia]
          Length = 486

 Score = 34.3 bits (77), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 10/103 (9%)

Query: 68  KEYGIKSILNLRGKLPESWHK-----EEEKAANDLGIQLINFPLSATRELN-DEQIKQLI 121
           K++G+K++LNL+ +L + +H+     E   +     IQ+ NF +      + +++I + +
Sbjct: 323 KDFGVKAVLNLQTRL-DVYHRGVDWDEILSSYKKHNIQMKNFEIFDMDPQDFEKKILKAV 381

Query: 122 SILK---TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            ILK      + + IHC SG  R    + +YL  V   P  E+
Sbjct: 382 QILKKLINQHESVYIHCTSGIGRAPSLAVIYLSSVLQIPLNES 424


>gi|115496614|ref|NP_001069821.1| protein-tyrosine phosphatase mitochondrial 1 [Bos taurus]
 gi|84708724|gb|AAI11307.1| Protein tyrosine phosphatase, mitochondrial 1 [Bos taurus]
 gi|296479668|gb|DAA21783.1| protein tyrosine phosphatase, mitochondrial 1 [Bos taurus]
          Length = 270

 Score = 34.3 bits (77), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF 172
           +HCK+G  R+    A YL  V H+  EEA R ++ +  H 
Sbjct: 199 VHCKAGRSRSATMVAAYLIQVYHWTPEEAIRAITKIRSHI 238


>gi|328779561|ref|XP_003249672.1| PREDICTED: hypothetical protein LOC410442 [Apis mellifera]
          Length = 1193

 Score = 34.3 bits (77), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 26/128 (20%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKE-------YGIKSILNLR---------GKLPESWH 87
           F   V  E+   A+PN   I  +KK+       + IK+I+NL+         G L ES  
Sbjct: 627 FSHWVTDEVLAMARPNTAQI--IKKDIIAQFQGWSIKTIINLQTPGEHASCGGPLEESGF 684

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP-----KPLLIHCKSGADRT 142
             +       GI   NF L   ++  D  + +L+ ++K          + IHC +G  RT
Sbjct: 685 TYDPNIFMKHGIYYYNFAL---KDYGDATMSKLLDMVKVVAFAVQEGRVAIHCHAGLGRT 741

Query: 143 GLASAVYL 150
           G+  A YL
Sbjct: 742 GVLIACYL 749


>gi|194862944|ref|XP_001970199.1| GG23504 [Drosophila erecta]
 gi|190662066|gb|EDV59258.1| GG23504 [Drosophila erecta]
          Length = 1039

 Score = 34.3 bits (77), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +D  +K+ + I +T    + +HCK+G  RTG  S +  YI+ HY
Sbjct: 261 SDAIMKKFLCICETTKGAIAVHCKAGLGRTG--SLIGAYIMKHY 302


>gi|84502464|ref|ZP_01000600.1| protein tyrosine/serine phosphatase-like protein [Oceanicola
           batsensis HTCC2597]
 gi|84389276|gb|EAQ02073.1| protein tyrosine/serine phosphatase-like protein [Oceanicola
           batsensis HTCC2597]
          Length = 251

 Score = 34.3 bits (77), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
              +++ ++  AP  ++ HC +G DRTG+ +A +L ++A  P++
Sbjct: 120 SFAEVLRLIAEAPGLVVFHCTAGKDRTGMIAA-FLLLLAGTPRD 162


Searching..................................................done


Results from round 2




>gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040575|gb|ACT57371.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score =  310 bits (794), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG
Sbjct: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL
Sbjct: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM
Sbjct: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180

Query: 181 DITFEKITQLYPNNVSKGDTEQPMNAT 207
           DITFEKITQLYPNNVSKGDTEQPMNAT
Sbjct: 181 DITFEKITQLYPNNVSKGDTEQPMNAT 207


>gi|315122684|ref|YP_004063173.1| hypothetical protein CKC_04680 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496086|gb|ADR52685.1| hypothetical protein CKC_04680 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 207

 Score =  231 bits (590), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 108/201 (53%), Positives = 153/201 (76%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIE 64
           KK ++N+ + +   LLG+ V+  + LGL+   +T++TQNFH +VP+E+YRSAQP G FIE
Sbjct: 5   KKLKQNIFLSFKISLLGLFVIFPIVLGLFCFILTSYTQNFHVIVPNELYRSAQPTGQFIE 64

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
            + +++GIKSILNLRG+  E W++EEE    +LGIQLINFP+ A++ELN+ +IK+LI IL
Sbjct: 65  TIWEKHGIKSILNLRGENNEPWYREEEMTIRNLGIQLINFPIPASKELNNAEIKKLIDIL 124

Query: 125 KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           + APKPLLIHCK+GADRTGLASA+YLY ++HYPK +A  QLS+ YGH P+    +MDITF
Sbjct: 125 RKAPKPLLIHCKAGADRTGLASALYLYSISHYPKYKASGQLSIFYGHIPLFGARSMDITF 184

Query: 185 EKITQLYPNNVSKGDTEQPMN 205
           EK T+ + N++   + +  +N
Sbjct: 185 EKYTKEFSNDLYIENAKHFLN 205


>gi|15889438|ref|NP_355119.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str.
           C58]
 gi|15157300|gb|AAK87904.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str.
           C58]
          Length = 186

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 12  LIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYG 71
           ++ ++KI    LV   V  G + + I   T NFH V+P E+YRSAQP+G  I    K YG
Sbjct: 4   VLKFLKITAIGLVALPVLAGAH-MGIGQLTGNFHEVIPGELYRSAQPSGKDIAAYAKAYG 62

Query: 72  IKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPL 131
           IK+I+NLR +  E W++ E  AA + GI+L+++PLS++ +++ E  + L ++L+ A KP+
Sbjct: 63  IKTIINLRDEKREGWYEAESLAAKNNGIRLVDYPLSSSEKVSVEDSETLAAVLRNAEKPV 122

Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           LIHC+ GA+RTGLASA+Y+ +VA   +  A  QLS  YGH P+
Sbjct: 123 LIHCEHGANRTGLASAIYVAVVAGKSEAAAEFQLSPYYGHVPI 165


>gi|149915807|ref|ZP_01904332.1| protein tyrosine/serine phosphatase [Roseobacter sp. AzwK-3b]
 gi|149810389|gb|EDM70234.1| protein tyrosine/serine phosphatase [Roseobacter sp. AzwK-3b]
          Length = 233

 Score =  195 bits (495), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 63/201 (31%), Positives = 96/201 (47%), Gaps = 3/201 (1%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           ++  ++  +N     +            +L      +     NF+ V P  +YRS QP  
Sbjct: 13  LVDWERNLRNSFDTDLSTPENRRRANIYNLWFDHAVLRKVWTNFYQVAPD-VYRSNQPTH 71

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
                LKK+ GIK+ILNLRG    + +  EE++   LG+ L+N  L A +     +IK L
Sbjct: 72  ERFVKLKKK-GIKTILNLRGAGGTAHYLVEEESCRTLGLTLVNVNLMARQAAPGTEIKAL 130

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           I   +   KP ++HCKSGADR G A+A+YL ++   P  EA R L + Y H    KT  +
Sbjct: 131 IRAFREIEKPFVMHCKSGADRAGFAAAIYLLVIEGRPVSEARRMLGVKYIHLKWSKTGVL 190

Query: 181 DITFEKITQLYP-NNVSKGDT 200
           D   ++  Q +    +S  D 
Sbjct: 191 DHILDRYEQSHKATGISFEDW 211


>gi|325293519|ref|YP_004279383.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
 gi|325061372|gb|ADY65063.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
          Length = 186

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
           +++ ++KI    LV   V  G + + I   T NFH V+P E+YRSAQP+G  I    K Y
Sbjct: 3   IVLKFLKIAAIGLVALPVLAGAH-MGIGQLTGNFHEVIPGELYRSAQPSGKDITAYAKAY 61

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           GIK+I+NLR +  E W+  E +AA   G++L+++PLS++ +++ E+ + L+++L+ A KP
Sbjct: 62  GIKTIINLRDEKREGWYDAESQAAKKNGVRLVDYPLSSSEKVSVEEAETLVAVLRNAEKP 121

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           +LIHC+ GA+RTGLASA+Y+  VA   +  A  QLS  YGH P+
Sbjct: 122 ILIHCEHGANRTGLASAIYVSAVAGKSEAAAEFQLSPYYGHVPI 165


>gi|254293374|ref|YP_003059397.1| protein tyrosine/serine phosphatase [Hirschia baltica ATCC 49814]
 gi|254041905|gb|ACT58700.1| protein tyrosine/serine phosphatase [Hirschia baltica ATCC 49814]
          Length = 231

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 56/202 (27%), Positives = 90/202 (44%), Gaps = 7/202 (3%)

Query: 3   KIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTF 62
           K+K+PR       I    G  +     +      +    +N H +   E+YR  QP+   
Sbjct: 4   KLKEPR------DISTPEGRKLANHDLMWGDHGFLRLRFRNLHQI-SDEMYRGNQPSPKQ 56

Query: 63  IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           +    KE GIK+I+NLRG+ P+ ++  E++A  +  I LI+F + +      ++I     
Sbjct: 57  VAAYAKELGIKTIINLRGESPKGYYVLEKEACEENRIDLIDFQMFSRDTPTPKKIHDAKY 116

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDI 182
           +      P  +HCKSGADR G+ S +Y++     P  EA  QLS  Y H    KT  +D 
Sbjct: 117 LFDNIAYPAFMHCKSGADRAGIMSVLYMHFRQGLPIAEAVEQLSFKYLHVKQGKTGMLDF 176

Query: 183 TFEKITQLYPNNVSKGDTEQPM 204
            F++   L             +
Sbjct: 177 FFQQYIDLVEQTPEGETPLTFL 198


>gi|206890973|ref|YP_002248592.1| hypothetical protein THEYE_A0750 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206742911|gb|ACI21968.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 190

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 75/158 (47%), Positives = 106/158 (67%), Gaps = 1/158 (0%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHKEEEKAANDLGIQ 100
            NFH + P E YRSAQ +   +EY  K+Y IKSILNLRGK P + W+ EE + +++L ++
Sbjct: 30  GNFHIITPGEAYRSAQLDRDELEYYIKKYNIKSILNLRGKNPNAAWYIEELQVSSELNVK 89

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
             +  LSATREL DE++++LI I K+AP+P+LIHCKSGADR+GL +A++  +V   PK E
Sbjct: 90  HYDIALSATRELTDEEVRKLIEIFKSAPRPVLIHCKSGADRSGLVAAMWKVVVDGEPKSE 149

Query: 161 AHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
           A +QLS+LYGH    KT  MD  F++  + +       
Sbjct: 150 ARKQLSLLYGHLSTGKTKAMDQFFDEFFEKWTRGAYSD 187


>gi|312113878|ref|YP_004011474.1| protein tyrosine/serine phosphatase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219007|gb|ADP70375.1| protein tyrosine/serine phosphatase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 253

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 59/168 (35%), Positives = 92/168 (54%), Gaps = 10/168 (5%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
            +   N H + P  ++RSAQP+   I +L K  GIK+++NLRG+     ++ E +A    
Sbjct: 61  RSIYSNRHQIAPG-VWRSAQPSPAHIAWLAKR-GIKTVVNLRGERDCGSYRLEAEACERH 118

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           GI+LINF L +      + I+Q  ++      P+L HCKSGADR G+ SA+ +Y+    P
Sbjct: 119 GIRLINFQLQSRMVPRVDVIRQARALFDEIEYPVLFHCKSGADRAGMMSALLMYMKEGQP 178

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMN 205
            E+A +QLS+ +GH    +T  +D  FE+            +TE+PM 
Sbjct: 179 IEQAAKQLSLKFGHIRSSETGVLDYLFERYL--------ADNTEEPMT 218


>gi|15888562|ref|NP_354243.1| hypothetical protein Atu8150 [Agrobacterium tumefaciens str. C58]
 gi|15156276|gb|AAK87028.1| hypothetical protein Atu8150 [Agrobacterium tumefaciens str. C58]
          Length = 195

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 75/182 (41%), Positives = 114/182 (62%), Gaps = 6/182 (3%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            F+   L G+  +  ++ G Y   I     NFH VV  + YRS QP+   +    +++GI
Sbjct: 3   RFWKCSLWGMGFIV-LAAGGYLYAI-QLLGNFHEVVAGQFYRSNQPSSEELVRYTEDHGI 60

Query: 73  KSILNLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPL 131
           K+++NLRG    ESW+++E + +  LG+  I+F +SA+REL+  Q+ QL++I++ APKP+
Sbjct: 61  KTVINLRGSNEAESWYRDEVETSKKLGLNHIDFGMSASRELDMNQVNQLVAIMRDAPKPI 120

Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV---LKTITMDITFEKIT 188
           LIHCKSGADRTGLA+A+YL  +A   +EEA  QLS+ YGH  +        MD T+E   
Sbjct: 121 LIHCKSGADRTGLATALYLSRIARLGEEEAESQLSIRYGHVSIPYLSAAYAMDRTWENAE 180

Query: 189 QL 190
           ++
Sbjct: 181 KM 182


>gi|78485859|ref|YP_391784.1| protein tyrosine/serine phosphatase [Thiomicrospira crunogena
           XCL-2]
 gi|78364145|gb|ABB42110.1| protein tyrosine/serine phosphatase [Thiomicrospira crunogena
           XCL-2]
          Length = 220

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 98/168 (58%), Gaps = 3/168 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +  F +NFHA+  +  YRS  P+  FI+ L ++ GIK+I++LR       ++ E++A + 
Sbjct: 25  LRLFYRNFHAL-SNNAYRSNHPSAAFIQKLHEKKGIKTIISLRRADQTGQYQLEKEACDR 83

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LGI+LIN P+S+    + ++I Q   IL+ A  P+LIHCKSGADR G+ S  Y + + + 
Sbjct: 84  LGIKLINHPMSSRSFPDVDKILQAKKILEDAEYPILIHCKSGADRAGMMSVFYKHFILNQ 143

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPN--NVSKGDTEQ 202
           P +EA  +L+M YGHF    T  +DI FE          NVS  +  Q
Sbjct: 144 PIKEALSELNMKYGHFRWADTGKLDIFFESFLTFEKAHPNVSFVEWVQ 191


>gi|325292592|ref|YP_004278456.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
 gi|325060445|gb|ADY64136.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
          Length = 180

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 72/167 (43%), Positives = 111/167 (66%), Gaps = 5/167 (2%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESW 86
           ++ G Y L I     NFH VV  ++YRS QP+   +    +++GIK+++NLRG+   E W
Sbjct: 2   LAAGGYLLAI-QLLGNFHEVVAGQLYRSNQPSSEQLVRYTRDHGIKTVINLRGENESEDW 60

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           +K+E K + +LG+  I+F +SA  EL+  ++ QL++I++ APKP+LIHCKSGADRTGLA+
Sbjct: 61  YKDEIKTSRELGLTHIDFGMSARHELDMTKVNQLVAIMRDAPKPILIHCKSGADRTGLAT 120

Query: 147 AVYLYIVAHYPKEEAHRQLSMLYGHFPV---LKTITMDITFEKITQL 190
           A+YL  VA+  ++ A  QLS+ YGH  +    +T  MD T+E +  +
Sbjct: 121 ALYLGRVAYLGEKAAESQLSVRYGHIGIPYLSETYAMDQTWENVEHM 167


>gi|114797931|ref|YP_760077.1| hypothetical protein HNE_1360 [Hyphomonas neptunium ATCC 15444]
 gi|114738105|gb|ABI76230.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 237

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 54/201 (26%), Positives = 90/201 (44%), Gaps = 2/201 (0%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIE 64
           +K R+  +   +    G               +     N H + P E++R+ QP+   + 
Sbjct: 7   RKMRRPHVAADLATAEGRARAKRELYWGDHGFLRLRFSNLHQISP-EMWRANQPSPKQVL 65

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
              +E GIK+ILNLRG   + ++  E++A    GI LI+F + +      E++     + 
Sbjct: 66  AHARERGIKTILNLRGPTTKGFYLLEKEACEAAGIDLIDFQMYSREPPTVEKVFGARDLF 125

Query: 125 KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           +    P L+HCKSGADR G+ + +Y  +    P EEA  QLS  Y H    KT  +D  F
Sbjct: 126 ERIRYPALMHCKSGADRAGIMAVLYKLLREKLPYEEAIEQLSGRYLHIRHGKTGVLDAFF 185

Query: 185 EKITQLYPNNVSKGDTEQPMN 205
           E     +       + +  ++
Sbjct: 186 ETYA-AFNAGRPANEWKPFLD 205


>gi|254420876|ref|ZP_05034600.1| hypothetical protein BBAL3_3186 [Brevundimonas sp. BAL3]
 gi|196187053|gb|EDX82029.1| hypothetical protein BBAL3_3186 [Brevundimonas sp. BAL3]
          Length = 221

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 55/189 (29%), Positives = 90/189 (47%), Gaps = 3/189 (1%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            F +   +G               +     N H + P  + R+ QP+   + Y KK+ G+
Sbjct: 3   RFDLSTAMGRFRAHWHYFWADHAFLRLAFSNAHWLGPDLV-RTNQPSPRQLAYWKKK-GV 60

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLL 132
           K+++NLRG+  E ++  E++A   LG+ LI+ PL +      ++I +   +  T   P+L
Sbjct: 61  KTVINLRGQRDEGYYWLEKEACERLGLTLIDAPLDSRDPPETDRIHRARRLFTTIEYPVL 120

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLY 191
           IHCKSGADR G+ +  Y +     P   A  +LS  Y H     T  +D T EK  +++ 
Sbjct: 121 IHCKSGADRAGMMAVFYRHFHLGEPISVAMAELSKKYLHSREGLTGVLDYTLEKYVSEIE 180

Query: 192 PNNVSKGDT 200
           P  +S  D 
Sbjct: 181 PRGISFIDW 189


>gi|220935425|ref|YP_002514324.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996735|gb|ACL73337.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 244

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 63/205 (30%), Positives = 98/205 (47%), Gaps = 14/205 (6%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           + ++    +  +    +  LG   L  V  G     I     N H V P  +YRSAQP+ 
Sbjct: 19  LARVVSRARGDMRTPWQRFLGRFELLLVDHGF----IRALYSNRHQVAPG-MYRSAQPSP 73

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
             ++ +  + G+K+I+NLRG+     +  E +A    GI+L+NF +S+ R    E +   
Sbjct: 74  AHVKQM-ADLGVKTIVNLRGEGDTGAYLLEAEACRRFGIELVNFSVSSKRAPPRETLLAA 132

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
             + +    P L+HCKSGADR GL SAVYL +      +EA  QL + YGH  + +T  +
Sbjct: 133 ARMFQELNYPALMHCKSGADRAGLMSAVYLAMHERRDADEAAAQLRLRYGHLRIGRTGVL 192

Query: 181 DITFEKITQLYPNNVSKGDTEQPMN 205
           D  F +  +           E PM+
Sbjct: 193 DEIFRQYRR--------DAAETPMD 209


>gi|260576858|ref|ZP_05844841.1| protein tyrosine/serine phosphatase [Rhodobacter sp. SW2]
 gi|259020895|gb|EEW24208.1| protein tyrosine/serine phosphatase [Rhodobacter sp. SW2]
          Length = 191

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/184 (41%), Positives = 115/184 (62%), Gaps = 6/184 (3%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           K ++ F +++  G+L+L  ++L  Y L + ++  NFH V+  E+YRSAQ     I   + 
Sbjct: 2   KQVVRFGLRLF-GLLMLGVLALIAYLLVLYSY-NNFHTVIEGELYRSAQVTPEQIAQYQA 59

Query: 69  EYGIKSILNLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           ++GI SILNLRG  P + W+  E  A+  LGI  ++F +SA + L  +Q K LI++++  
Sbjct: 60  DHGIASILNLRGAAPGKPWYDAEMAASEKLGITHVDFRMSARKALTADQAKALIALMRDM 119

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLK---TITMDITF 184
           PKP+LIHC  GADRTGLASA+YL  +A   ++EA  Q+S+ YGHF V K      MD T+
Sbjct: 120 PKPILIHCLQGADRTGLASALYLASIAGRSEDEAAGQISIRYGHFSVPKLSEAYPMDETW 179

Query: 185 EKIT 188
           + + 
Sbjct: 180 QMML 183


>gi|170740880|ref|YP_001769535.1| protein tyrosine/serine phosphatase [Methylobacterium sp. 4-46]
 gi|168195154|gb|ACA17101.1| protein tyrosine/serine phosphatase [Methylobacterium sp. 4-46]
          Length = 241

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 62/209 (29%), Positives = 97/209 (46%), Gaps = 22/209 (10%)

Query: 1   MIKIKKP---RKNLLIFYIKILL---GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYR 54
           + + +KP   R++ L  ++ +LL   GVL L  +              N H V    ++R
Sbjct: 19  IARWEKPIAGRRSRLRAWVNMLLVDHGVLRLAYL--------------NRHRVGRGLVWR 64

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           SAQP      +  K +G+++I++LRG       + + +A    G+ L  F + +    N 
Sbjct: 65  SAQPAPHDFSWF-KRHGVRTIVSLRGGREHGSWQLQREACEREGLVLREFVVRSREAPNR 123

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           E +        +   P L+HCKSGADR G A+A+YL +    P  EA RQLS  +GHF  
Sbjct: 124 EMLLGARDFFASVEYPALLHCKSGADRAGFAAALYLILHEGRPVAEAARQLSPRFGHFRF 183

Query: 175 LKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
            KT  +D  FE    Q     +S  +  +
Sbjct: 184 AKTGILDAFFESYLAQGERRGLSFLEWVE 212


>gi|209963868|ref|YP_002296783.1| hypothetical protein RC1_0533 [Rhodospirillum centenum SW]
 gi|209957334|gb|ACI97970.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 237

 Score =  185 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 84/166 (50%), Gaps = 4/166 (2%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAAN 95
           +    +N   + P  +YRS+QP    I    K  GI++++NLRG+      +  EE+A  
Sbjct: 43  LRMAYKNMFRISPG-MYRSSQPTPAHIAA-AKRMGIRTVINLRGRRDDCGSYFLEERACR 100

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           + GI L++FP+++        +     I      P+L+HCK+G+DR G  SA+Y+ +   
Sbjct: 101 EHGITLVDFPVNSRDAPRKHILHAARDIWAGVEYPVLMHCKAGSDRVGFMSALYMLVHEK 160

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDT 200
            P EEA RQL+  YGH    KT  +D  FE+   +   + +   D 
Sbjct: 161 RPLEEAVRQLNWRYGHLRAAKTGILDQFFEEYAARNAESPIDFYDW 206


>gi|315500495|ref|YP_004089298.1| protein tyrosine/serine phosphatase [Asticcacaulis excentricus CB
           48]
 gi|315418507|gb|ADU15147.1| protein tyrosine/serine phosphatase [Asticcacaulis excentricus CB
           48]
          Length = 239

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 52/202 (25%), Positives = 93/202 (46%), Gaps = 3/202 (1%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGT 61
           +K+ K RK   +F      G+       L      +     N H +   ++ R+ QP   
Sbjct: 10  VKLFKKRKTPKVFDTSTQWGLFKTYLAFLWNDHAYLRLGFTNAHWI-DDKMVRTNQPWPF 68

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
            + + KK   I++++NLRG    ++   E  A   LG+ L++F +++    + E I +  
Sbjct: 69  QLAWFKKHDRIRTVINLRGG-QGAFFALERHACQTLGLNLVDFIVTSRDVPSAEAILEAE 127

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +  +   P L+HCKSGADR G+ S +Y ++   +P  EA ++L +   H    KT  +D
Sbjct: 128 KLFDSIQYPALMHCKSGADRAGIMSVLYRHLHLKHPLREAVQELGLRTLHMKAGKTGVLD 187

Query: 182 ITFEKI-TQLYPNNVSKGDTEQ 202
             F+    +  P  +S  +  Q
Sbjct: 188 YIFDCYFAEGEPRGMSFVEWTQ 209


>gi|222085806|ref|YP_002544336.1| hypothetical protein Arad_2152 [Agrobacterium radiobacter K84]
 gi|221723254|gb|ACM26410.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 198

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 76/183 (41%), Positives = 111/183 (60%), Gaps = 5/183 (2%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           + L      +LL +     ++ G  F     +T NFH V+  E+YRS+QP+ + I  L+K
Sbjct: 10  RRLRRIGRGVLLALSPFALIATG--FYAHMLWTTNFHPVIAGEVYRSSQPSASTIAELQK 67

Query: 69  EYGIKSILNLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           +YGIK+I+NLRG     +W+  E   A +L I  I+F +S+  EL   Q  QL+ I++ A
Sbjct: 68  QYGIKTIINLRGNNTGHAWYDSEVAQAKELNIDHIDFRMSSAHELTQAQAAQLVEIMRDA 127

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL--KTITMDITFE 185
           PKPLLIHC++G+DRTGLASA+YL  +A   +  A  Q+S++YGH P    +   MD TFE
Sbjct: 128 PKPLLIHCQAGSDRTGLASALYLAAIAKTGEATAESQMSIIYGHLPFSFTRAYAMDRTFE 187

Query: 186 KIT 188
           K+ 
Sbjct: 188 KLE 190


>gi|220922853|ref|YP_002498155.1| protein tyrosine/serine phosphatase [Methylobacterium nodulans ORS
           2060]
 gi|219947460|gb|ACL57852.1| protein tyrosine/serine phosphatase [Methylobacterium nodulans ORS
           2060]
          Length = 241

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 98/209 (46%), Gaps = 22/209 (10%)

Query: 1   MIKIKKP---RKNLLIFYIKILL---GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYR 54
           + + +KP   R+N L  ++ +LL   GVL L  +              N H +    ++R
Sbjct: 19  IARWEKPIAGRRNRLRAWVNMLLVDHGVLRLAYL--------------NRHRIGRGLLWR 64

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           SAQP    + + K++ G+++I++LRG       + + +A    G+ L  F + +    + 
Sbjct: 65  SAQPAPHDLAWFKRQ-GLRTIISLRGGREHGSWQLQREACEREGLLLREFVVRSREAPDR 123

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
             +            P LIHCKSGADR G A+A+YL +    P  EA RQLS  YGHF  
Sbjct: 124 AMLLSARDFFAGVEYPALIHCKSGADRAGFAAALYLILHEGRPVAEAARQLSPRYGHFRF 183

Query: 175 LKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
            KT  +D  F++   +     +S  D  +
Sbjct: 184 AKTGILDAFFDRYLLEGEAKGLSFLDWVE 212


>gi|126735048|ref|ZP_01750794.1| protein tyrosine/serine phosphatase [Roseobacter sp. CCS2]
 gi|126715603|gb|EBA12468.1| protein tyrosine/serine phosphatase [Roseobacter sp. CCS2]
          Length = 267

 Score =  183 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 75/158 (47%), Gaps = 2/158 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            L    + TF  NF  +    +YRS  P+           GIK++LNLRG   +  +  E
Sbjct: 71  WLDHGILRTFWHNFAQISDG-VYRSNHPDHKRFAAYAA-MGIKTVLNLRGVHRQPHYLFE 128

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            ++   L ++L+   +SA      E++  +++   T  +P L+HCKSGADRTGL +A+YL
Sbjct: 129 AESCERLSLKLVTIHMSARDAPRKEKLIDVMNAFDTMERPFLMHCKSGADRTGLVAALYL 188

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
                    EA +QLS  Y H     T  +D   +   
Sbjct: 189 MTKEGQSVAEARKQLSFRYLHIRRSSTGILDHFLDVYE 226


>gi|300024092|ref|YP_003756703.1| protein tyrosine/serine phosphatase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525913|gb|ADJ24382.1| protein tyrosine/serine phosphatase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 245

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 84/180 (46%), Gaps = 2/180 (1%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP 83
            LC   +      I     N    +  +++RSAQP    + +L +  G+K+I+NLRG+  
Sbjct: 38  ALCYAEMLFVDYGIARIAYNNRHRISKDVWRSAQPAPHHVGWLARR-GVKTIINLRGEQS 96

Query: 84  ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
                 E++A    GI L++  L +        ++ +  +LK    P+L+HCKSGADR G
Sbjct: 97  FGTRWLEQQACARHGITLVDLALKSRAPPTTADLRAMRDVLKNVEYPILLHCKSGADRAG 156

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT-QLYPNNVSKGDTEQ 202
           + S +  +     P EEA +QLS+ YGH     T  +D  FE+         +   D  +
Sbjct: 157 IMSVIVRHERDGVPIEEAKKQLSLRYGHIRSADTGVLDAVFERYLDDKAKTGIEFWDWVE 216


>gi|16124561|ref|NP_419125.1| hypothetical protein CC_0306 [Caulobacter crescentus CB15]
 gi|221233247|ref|YP_002515683.1| hypothetical protein CCNA_00308 [Caulobacter crescentus NA1000]
 gi|13421449|gb|AAK22293.1| hypothetical protein CC_0306 [Caulobacter crescentus CB15]
 gi|220962419|gb|ACL93775.1| hypothetical protein CCNA_00308 [Caulobacter crescentus NA1000]
          Length = 221

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 53/190 (27%), Positives = 86/190 (45%), Gaps = 3/190 (1%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIK 73
           F +    G        L      +     N H + P E+ R+ QP    + + KK  GIK
Sbjct: 4   FDLTTPWGRFKTYLHYLWNDHAYLRLGFSNAHWISP-ELVRANQPWPFQLAWWKKR-GIK 61

Query: 74  SILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLI 133
           +I+NLRG    S++  E+ A   LG+  ++F +++      E+++    + +    P L+
Sbjct: 62  TIVNLRGGFDGSFYALEKDACERLGLNFVDFVITSREVPIRERVRGAKELFERIEYPALM 121

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYP 192
           HCKSGADR G+ S  Y +     P  EA +QL   Y H     T  +D  FE+   +  P
Sbjct: 122 HCKSGADRAGIMSVFYAHYRLGQPIREAMQQLGPRYLHIKHGNTGVLDYVFEQYLEKGEP 181

Query: 193 NNVSKGDTEQ 202
             ++  D  +
Sbjct: 182 KGLTFSDWVE 191


>gi|167648492|ref|YP_001686155.1| protein tyrosine/serine phosphatase [Caulobacter sp. K31]
 gi|167350922|gb|ABZ73657.1| protein tyrosine/serine phosphatase [Caulobacter sp. K31]
          Length = 221

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/190 (27%), Positives = 91/190 (47%), Gaps = 3/190 (1%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIK 73
           +      G        L      +    +N H + P E+ R+ QP    +   KK+ G+K
Sbjct: 4   YDTTTRWGRFRTYLSYLWNDHAYLRLGFKNDHWISP-ELVRTNQPWPHQLAAWKKK-GVK 61

Query: 74  SILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLI 133
           +++NLRG    S++  E+ A   LG+++++F +++      E++     + ++   P L+
Sbjct: 62  TVINLRGGFDGSFYALEKHACQQLGLKMVDFVITSREVPIKERVLGARDLFESIEYPALM 121

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT-QLYP 192
           HCKSGADR G+ S +Y +     P EEA  QLS+ Y H    KT  +D  FE+      P
Sbjct: 122 HCKSGADRAGIMSVLYAHYRLGLPIEEAVEQLSLKYLHIKQGKTGVLDYVFERYLTDAAP 181

Query: 193 NNVSKGDTEQ 202
             ++  +  +
Sbjct: 182 MGLTFTEWVE 191


>gi|295691195|ref|YP_003594888.1| protein tyrosine/serine phosphatase [Caulobacter segnis ATCC 21756]
 gi|295433098|gb|ADG12270.1| protein tyrosine/serine phosphatase [Caulobacter segnis ATCC 21756]
          Length = 221

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 52/190 (27%), Positives = 86/190 (45%), Gaps = 3/190 (1%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIK 73
           F +    G        L      +     N H + P  + R+ QP    + + KK+ GIK
Sbjct: 4   FDLTTPWGRFRTYLHYLWNDHAYLRLGFSNAHWISPEMV-RANQPWPFQLAWWKKQ-GIK 61

Query: 74  SILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLI 133
           +I+NLRG    S++  E+ A   LG+  ++F +++      E+++    + +T   P L+
Sbjct: 62  TIVNLRGGFDGSFYALEKDACQRLGLNFVDFTITSREVPIRERVRGAKELFETIEYPALM 121

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYP 192
           HCKSGADR G+ S  Y +     P  EA +QL   Y H     T  +D  FE+   +  P
Sbjct: 122 HCKSGADRAGIMSVFYAHYRLGQPIREAMKQLGPRYLHIKHGNTGVLDYVFEQYLERGEP 181

Query: 193 NNVSKGDTEQ 202
              +  +  +
Sbjct: 182 KGQTFSEWVE 191


>gi|288961764|ref|YP_003452074.1| protein tyrosine/serine phosphatase [Azospirillum sp. B510]
 gi|288914044|dbj|BAI75530.1| protein tyrosine/serine phosphatase [Azospirillum sp. B510]
          Length = 215

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 54/169 (31%), Positives = 82/169 (48%), Gaps = 3/169 (1%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
                   N H V  + + R++QP+ + I    +  G+K+ILNLRG    + +  E +A 
Sbjct: 20  ACFRLVYSNTHRVSANMV-RASQPSPSHIAAAARS-GVKTILNLRGSRDCASYILEAEAC 77

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
              G+QLI+FP+++      E + +   + K    P L+HCKSGADR G  + +YL+   
Sbjct: 78  RAHGLQLIDFPVNSRDMPRKETLLKARELFKGMNYPALMHCKSGADRAGFMATLYLFAHE 137

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL-YPNNVSKGDTEQ 202
             P E A +QLS  YGHF   KT  +D  FE          +   D  +
Sbjct: 138 GQPLERAMKQLSWKYGHFKQAKTGILDYFFELYAAYNQKRPIDFWDWVE 186


>gi|296536753|ref|ZP_06898809.1| protein tyrosine/serine phosphatase [Roseomonas cervicalis ATCC
           49957]
 gi|296262920|gb|EFH09489.1| protein tyrosine/serine phosphatase [Roseomonas cervicalis ATCC
           49957]
          Length = 222

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 82/164 (50%), Gaps = 2/164 (1%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKA 93
             +    +N+  V P  +YRS  P+   +    +  G++SI+NLRG              
Sbjct: 24  AVLRLGWRNWGVVAPGRLYRSNHPSPWQLRRAARTLGLRSIINLRGHRESCGSDALGRAM 83

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           A +LG+  ++ PL +    + +++ +L  I +  P P+LIHCKSGADRTGLA+ V+L + 
Sbjct: 84  AAELGLSHVDAPLESRGAPHKDRLLRLAGIFRDLPGPVLIHCKSGADRTGLAAGVWLLL- 142

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
              P EEA RQLS  +GH    KT  +D  F         N  K
Sbjct: 143 QGRPVEEAMRQLSWRHGHVSASKTGILDAFFRDYAAFQKANGPK 186


>gi|119898606|ref|YP_933819.1| putative tyrosine/serine phosphatase [Azoarcus sp. BH72]
 gi|119671019|emb|CAL94932.1| conserved hypothetical tyrosine/serine phosphatase [Azoarcus sp.
           BH72]
          Length = 234

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 79/158 (50%), Gaps = 1/158 (0%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
            I     NFHA+    +YR +QP+   I      +GI+SI+NLRG      +  EE+A  
Sbjct: 39  AIRAVYNNFHALG-GGMYRCSQPSPAQIRRYHARHGIRSIINLRGVHDYGSYFFEEEACA 97

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            LGI L +  L +    + E+I ++  +      P L+HCKSGADR GL +A+Y  +   
Sbjct: 98  RLGIALHSVKLYSRVPPSVEEIHRMRDLFAGLQYPALLHCKSGADRAGLGAALYRILQLG 157

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPN 193
           +P  EA R+LS  YGH    +T  +D  F      +  
Sbjct: 158 HPVREAMRELSWKYGHSKRARTGILDFFFASYLAHHAR 195


>gi|197103982|ref|YP_002129359.1| hypothetical protein PHZ_c0516 [Phenylobacterium zucineum HLK1]
 gi|196477402|gb|ACG76930.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 227

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 56/193 (29%), Positives = 91/193 (47%), Gaps = 4/193 (2%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIK 73
           F +   LG        L      +     N H +   E+ R+ QP    +   K   GIK
Sbjct: 10  FDLSTPLGRARTYLDYLWNDHAYLRLGFSNAHWI-SEELVRANQPWPHQLAAWKAR-GIK 67

Query: 74  SILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLI 133
           +I+NLRG    S+H  E+ A   LG+ +++F +++    + +++     + +T   P ++
Sbjct: 68  TIINLRGGFDASFHALEKDACQRLGLTMVDFTITSREVPSVQRVLGAKRLFETIEYPAMM 127

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYP 192
           HCKSGADR G+ S +Y++        EA  QL + Y H    KT  +D TFE+   +  P
Sbjct: 128 HCKSGADRAGIMSVLYMHFRKGKTIREAMDQLHLRYLHVKQGKTGVLDYTFERYLEEGEP 187

Query: 193 NNVSKGDTEQ-PM 204
             +S  +  Q PM
Sbjct: 188 AGMSFLEWVQSPM 200


>gi|294084698|ref|YP_003551456.1| hypothetical protein SAR116_1129 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664271|gb|ADE39372.1| conserved hypothetical tyrosine/serine phosphatase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 219

 Score =  181 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 81/164 (49%), Gaps = 2/164 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +  F  N H + P  ++R+ QP    +  +    GIK+I+NLRG   +   + E +A   
Sbjct: 27  LRLFWHNRHEIAPG-MWRANQPGPVEVSRIAAS-GIKTIINLRGPRDDGVWQLEAEACAK 84

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            GI L++F   +    +   +    +I K   KP L+HCKSGADR GL SA+Y+ +    
Sbjct: 85  AGITLLDFTARSRAAPDKAMLHDAKAIFKAIEKPALMHCKSGADRAGLMSALYMLVAEER 144

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
           P  EA +QL+  YGH    KT  +D+ F+         ++  D 
Sbjct: 145 PAREAAKQLAWKYGHVKQAKTGLLDVFFKAYFPYEDQGMAFYDW 188


>gi|83950364|ref|ZP_00959097.1| hypothetical protein ISM_04680 [Roseovarius nubinhibens ISM]
 gi|83838263|gb|EAP77559.1| hypothetical protein ISM_04680 [Roseovarius nubinhibens ISM]
          Length = 227

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 55/174 (31%), Positives = 80/174 (45%), Gaps = 3/174 (1%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE 89
           L      + T   NF  V P  ++RS  P     E LK   G +S+LNLRG    + +  
Sbjct: 36  LWFDHAILRTVWTNFFEVAPG-VWRSNHPTHRRFEKLKA-MGFRSVLNLRGSGGAAHYLT 93

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
           E ++   LG+ L+N  L A      E I  L+   +   KP ++HCKSGADR G ASA++
Sbjct: 94  EVESCEKLGLTLVNVTLHARYAAPREDILTLLEAFRQIEKPFVMHCKSGADRAGFASAIW 153

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT-QLYPNNVSKGDTEQ 202
           L ++   P  EA R LS  Y H    KT  +D   +    +     +   +  +
Sbjct: 154 LLVMEGRPVSEARRMLSFKYVHIRRSKTGVLDHILDVYEARQAETGIGFEEWVR 207


>gi|329890440|ref|ZP_08268783.1| protein tyrosine/serine phosphatase [Brevundimonas diminuta ATCC
           11568]
 gi|328845741|gb|EGF95305.1| protein tyrosine/serine phosphatase [Brevundimonas diminuta ATCC
           11568]
          Length = 221

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 49/167 (29%), Positives = 87/167 (52%), Gaps = 3/167 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + T   N H + P  + R+ QP+   + + K++ G+++++NLRG+  E+++  E+ A   
Sbjct: 27  LRTAFTNAHWLGPDLV-RTNQPSPRQLAWWKRQ-GVRTVVNLRGQRDEAYYWLEKDACER 84

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG+ LI+ PL +      +++++  ++ +T   P LIHCKSGADR G+ +  Y +     
Sbjct: 85  LGLTLIDAPLDSRDPPGKDRVRRAKALFQTMEYPALIHCKSGADRAGMMAVFYRHFHLGE 144

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
           P   A  +L     H     T  +D T EK   ++ P  VS  D  +
Sbjct: 145 PISAAMEELGKRTLHSREGLTGVLDYTLEKYVAEVEPTGVSFEDWVE 191


>gi|302382966|ref|YP_003818789.1| protein tyrosine/serine phosphatase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193594|gb|ADL01166.1| protein tyrosine/serine phosphatase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 221

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 47/167 (28%), Positives = 82/167 (49%), Gaps = 3/167 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +     N H + P  + R+ QP+   +E   +  GI++++NLRG+  E ++  E+ A   
Sbjct: 27  LRLAFSNAHWIGPDLV-RTNQPSPRQLEGWARR-GIRTVINLRGERDEGYYWLEKAACER 84

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG+ LI+ PL +    + +++++   +  +   P LIHCKSGADR GL +  Y +     
Sbjct: 85  LGLTLIDAPLDSRDPPSKDRVRRARDLFASIEYPALIHCKSGADRAGLMAVFYRHFHLGE 144

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
           P   A ++LS  Y H     T  +D   E    ++ P  V   +  +
Sbjct: 145 PISVARQELSKRYLHSREGLTGVLDHFVETYIDEVEPTGVGFMEWVE 191


>gi|222147302|ref|YP_002548259.1| tyrosine/serine protein phosphatase [Agrobacterium vitis S4]
 gi|221734292|gb|ACM35255.1| tyrosine/serine protein phosphatase [Agrobacterium vitis S4]
          Length = 191

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 70/184 (38%), Positives = 107/184 (58%), Gaps = 4/184 (2%)

Query: 10  NLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKE 69
           ++L+        +  L  +     +L     T NFH V+P E YRSAQP+   I+     
Sbjct: 2   SILLAKATRYTALACLTGLLSCGAYLGYLRLTGNFHEVIPGEFYRSAQPSAADIKDYAGR 61

Query: 70  YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK 129
           YGIK+I+NLRG  P  W+ +E   A +LGI  I+F +SA + L  ++ +QL+++LK+APK
Sbjct: 62  YGIKTIVNLRGPSPSPWYAQEVATARELGIGHIDFRMSAGKGLTIDKAEQLVALLKSAPK 121

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV---LKTITMDITFE 185
           P+LIHC+ GADR+GLAS +YL  +A   ++ A +QL   +YGH  +    K   MD ++ 
Sbjct: 122 PILIHCEGGADRSGLASVLYLQQIAGVQEDTAEQQLWPVIYGHVGIPYVTKAYAMDRSWL 181

Query: 186 KITQ 189
              +
Sbjct: 182 DFEK 185


>gi|84515251|ref|ZP_01002613.1| hypothetical protein SKA53_01296 [Loktanella vestfoldensis SKA53]
 gi|84510534|gb|EAQ06989.1| hypothetical protein SKA53_01296 [Loktanella vestfoldensis SKA53]
          Length = 235

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 55/158 (34%), Positives = 80/158 (50%), Gaps = 2/158 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            L    +     NF  V P  +YRS  PN +       + GIK++LNLRG   +  H  E
Sbjct: 39  WLDHGILRRRWHNFDLVAPG-VYRSNHPNHSRFAAY-AQMGIKTVLNLRGAALQPHHLFE 96

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            ++   LG+ L+N  ++A R  + +++  L+    T  +P L+HCKSGADRTGLA+A+YL
Sbjct: 97  VESCATLGLTLVNVQMAARRAPDRDELLALLDAFATMERPFLMHCKSGADRTGLAAAIYL 156

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
                 P  +A RQLS  Y H     T  +D   +   
Sbjct: 157 LHYQDAPIAQAKRQLSFRYVHIRRTSTGILDHFLDVYA 194


>gi|254440390|ref|ZP_05053884.1| hypothetical protein OA307_5260 [Octadecabacter antarcticus 307]
 gi|198255836|gb|EDY80150.1| hypothetical protein OA307_5260 [Octadecabacter antarcticus 307]
          Length = 235

 Score =  178 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 78/160 (48%), Gaps = 2/160 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +  F  N   + P  ++RS  P       L    GI +I++LRG     W   E++A   
Sbjct: 57  LRKFWTNMFEIAPG-VWRSNHPTAKRFPALTAR-GIHTIISLRGSTTTPWALLEKEACTR 114

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            GI+L    L +    N   ++ LI + ++  KP+L HCKSGADRTGLAS +YL ++ + 
Sbjct: 115 HGIRLETVALKSQSAPNRRDLQALIGLFRSVEKPVLFHCKSGADRTGLASVMYLLVIENQ 174

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVS 196
           P E+A + LS  Y H    K   +D+  +       ++  
Sbjct: 175 PLEQARKMLSWRYAHLSWTKAGVLDMLLDDFATSARHDFE 214


>gi|260424450|ref|YP_003212651.1| hypothetical protein Ctu_1p00750 [Cronobacter turicensis z3032]
 gi|260219258|emb|CBA34612.1| hypothetical protein Ctu_1p00750 [Cronobacter turicensis z3032]
          Length = 483

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 68/155 (43%), Positives = 101/155 (65%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           LG+LV   ++L          T NFH V+  E+YRSAQP+ T I    + Y I++ILNLR
Sbjct: 308 LGLLVAAVLALTGLHAGYEQLTGNFHEVIEGELYRSAQPDATDIAEYSERYHIRTILNLR 367

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGA 139
            +    W+++E+ +A+  GIQL+++PLS+++E++  + ++L  ++KT P+PLLIHC  GA
Sbjct: 368 DEPRGDWYEQEKASADVHGIQLVDYPLSSSKEISVREAEKLAELMKTLPRPLLIHCDHGA 427

Query: 140 DRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           +RTGL SA+YL  VA      A  QLS  YGHFP+
Sbjct: 428 NRTGLVSAIYLDAVAQTSDLIAQLQLSPWYGHFPI 462


>gi|258541139|ref|YP_003186572.1| hypothetical protein APA01_00350 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632217|dbj|BAH98192.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635274|dbj|BAI01243.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638329|dbj|BAI04291.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641383|dbj|BAI07338.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644438|dbj|BAI10386.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647493|dbj|BAI13434.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256650546|dbj|BAI16480.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653537|dbj|BAI19464.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 220

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 43/168 (25%), Positives = 78/168 (46%), Gaps = 1/168 (0%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
                   NFHAV+P ++YR   P    ++   +  G+++++NLRG            AA
Sbjct: 25  AIFRLMWTNFHAVIPGKVYRCNHPTPARLKRAMERLGLRTLVNLRGHRKCGSDALSRNAA 84

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
             LG+  ++    +    + ++I +   + +    P+L+HCKSGADR GLAS + + +  
Sbjct: 85  RGLGLHHVDMAFESRGAPHKDRILRFADMYQKLDFPMLMHCKSGADRAGLASGL-VVLFE 143

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
               ++A ++LS  YGHF   +T  +D  F          +   +  +
Sbjct: 144 GGSAQQALKELSWKYGHFRSSRTGILDAFFLHYQAEGEGRMPFLEWVR 191


>gi|153007388|ref|YP_001368603.1| protein tyrosine/serine phosphatase [Ochrobactrum anthropi ATCC
           49188]
 gi|151559276|gb|ABS12774.1| protein tyrosine/serine phosphatase [Ochrobactrum anthropi ATCC
           49188]
          Length = 197

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 5/172 (2%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           LG+LV  +V +G Y  T+  +  N H ++  + YRS QP+   I  L+K YGIK+I+NLR
Sbjct: 20  LGLLVGSSV-MGGYLYTL-QYKGNVHTIIDGQAYRSNQPDPARIASLQKLYGIKTIINLR 77

Query: 80  GKLPES-WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           G  P S W+ EE   A  LGI+  +F +S+ REL+  Q +QLI++++ A KP+LIHCKSG
Sbjct: 78  GPEPGSKWYDEEIATAKTLGIKHADFEMSSRRELSPAQTRQLIALMQNAEKPVLIHCKSG 137

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH--FPVLKTITMDITFEKIT 188
           ADRTGLA+A+Y+  VA   + +A RQ+S+ YGH  FP+  T  M+ TFE I 
Sbjct: 138 ADRTGLAAALYVAAVAKGSEGKAERQMSIAYGHFGFPLSPTYAMEKTFEAIE 189


>gi|84500026|ref|ZP_00998292.1| hypothetical protein OB2597_08799 [Oceanicola batsensis HTCC2597]
 gi|84391960|gb|EAQ04228.1| hypothetical protein OB2597_08799 [Oceanicola batsensis HTCC2597]
          Length = 226

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 5/177 (2%)

Query: 27  AVSLGLYF--LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE 84
           A +  LYF    + T   NF  + P  +YRS  P    +  +K   GI ++LNLRG    
Sbjct: 31  ARTYNLYFDHAVLRTVWGNFFQISPD-VYRSNHPTHARLARMKAR-GITTVLNLRGTESG 88

Query: 85  SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
           + +  E  +  +LG+ +++  L A      E I  LI   +   KP ++HCKSGADR G 
Sbjct: 89  APYLTERVSCGELGLTMVDCNLIARAAAPKEDILNLIDCFRRIEKPFVMHCKSGADRAGF 148

Query: 145 ASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDT 200
           ASA+YL ++   P E A R LS  Y HF   +T  +D   +    +   + +   D 
Sbjct: 149 ASAIYLMVIEGEPVERARRMLSPRYIHFRWTRTGILDHILDHYAARNAASEIGFEDW 205


>gi|329114750|ref|ZP_08243507.1| Protein Tyrosine/Serine Phosphatase [Acetobacter pomorum DM001]
 gi|326695881|gb|EGE47565.1| Protein Tyrosine/Serine Phosphatase [Acetobacter pomorum DM001]
          Length = 226

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 44/168 (26%), Positives = 77/168 (45%), Gaps = 1/168 (0%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
                   NFHAV+P ++YR   P    ++      G+++++NLRG            AA
Sbjct: 31  AIFRLMWTNFHAVIPGKVYRCNHPTPARLKRAMGRLGLRTLVNLRGHRKCGSDALSRNAA 90

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
             LG+  I+    +    + ++I +   + +    P+L+HCKSGADR GLAS + + +  
Sbjct: 91  RGLGLHHIDMAFESRGAPHKDRILRFADMYQKLDFPILMHCKSGADRAGLASGL-VVLFE 149

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
               ++A ++LS  YGHF   +T  +D  F          +   +  +
Sbjct: 150 GGSAQQALKELSWKYGHFRSSRTGILDAFFLHYQAEGEGRMPFLEWVR 197


>gi|254561265|ref|YP_003068360.1| hypothetical protein METDI2844 [Methylobacterium extorquens DM4]
 gi|254268543|emb|CAX24500.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 241

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 77/161 (47%), Gaps = 2/161 (1%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H +    ++RSAQP    + + K++ G+++I++LRG         + +A    G+ L+
Sbjct: 53  NRHRIGTGLVWRSAQPTPHQLAWFKRQ-GVRTIVSLRGGREHGSWPLQREACERQGLNLV 111

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
            F L +    + E +            P ++HCKSGADR GLA+ ++L +    P  EA 
Sbjct: 112 EFVLRSREAPSRETLLAARDFFDGLEYPAVMHCKSGADRAGLAATLFLILHEGRPVREAL 171

Query: 163 RQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
           RQLS  YGHF   KT  +D  F     +      S  D  +
Sbjct: 172 RQLSPRYGHFRFAKTGILDAFFATYLREGEARGQSFLDWVE 212


>gi|83859487|ref|ZP_00953008.1| hypothetical protein OA2633_13820 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852934|gb|EAP90787.1| hypothetical protein OA2633_13820 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 220

 Score =  176 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (51%), Gaps = 4/162 (2%)

Query: 31  GLYFLTITTFTQNFHAV--VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWH 87
           GL +       Q FH +  V  E++R  QP+   +  L K+ G K+ILNLRG  P   ++
Sbjct: 17  GLMWGDHGVLRQRFHNMHRVGGEMWRGNQPSPKRLREL-KDMGFKTILNLRGTQPGRHYY 75

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
             E    +++G+ +++ P  +      E+I+ LI++      P  +HCKSGADR G+ + 
Sbjct: 76  DLEHFTCDEIGLDIVDLPWGSREAPYVERIEHLITVFDEIAYPAFMHCKSGADRAGIVAV 135

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           +Y  +    P EEA +QLS  YGH    KT  +D  F+   Q
Sbjct: 136 MYKLLHEKAPFEEAVQQLSFKYGHIKQGKTGMLDHFFDLYRQ 177


>gi|330991160|ref|ZP_08315113.1| hypothetical protein SXCC_01067 [Gluconacetobacter sp. SXCC-1]
 gi|329761746|gb|EGG78237.1| hypothetical protein SXCC_01067 [Gluconacetobacter sp. SXCC-1]
          Length = 220

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 79/168 (47%), Gaps = 1/168 (0%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  V+P  +YR   P    +    + YG+K+++NLRG           +AA
Sbjct: 25  AILRQTWTNFRVVIPGRVYRCNHPTPWRLRLATRRYGLKTLVNLRGHRRCGSDALSREAA 84

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
             LG+  I+    +    + ++I++   I +T   P+L+HCKSGADRTGLA+ + + +  
Sbjct: 85  QALGLTHIDMAFESRNAPHRDRIERFERIYRTIRFPMLMHCKSGADRTGLAAGL-VILFE 143

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
                +A RQLS   GHF   +T  +D  F +        +   D  +
Sbjct: 144 GGTARQALRQLSWKNGHFNSSRTGVLDAFFLRYQAEAEGRIPFMDWVR 191


>gi|294670992|ref|ZP_06735848.1| hypothetical protein NEIELOOT_02698 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307479|gb|EFE48722.1| hypothetical protein NEIELOOT_02698 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 197

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/195 (27%), Positives = 92/195 (47%), Gaps = 10/195 (5%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
           +LI    + + V    A  + + + T      N + +   ++YRS Q   +    ++   
Sbjct: 6   VLILATALSVNVCAENAADMSMKWATPVKQDANLYRL-DDKLYRSEQLTRSDAAAVQ-GL 63

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK- 129
           GIKS++NLR    +    +   A +  GI L N PL   R +  + I + + +++   K 
Sbjct: 64  GIKSVINLRFFDRD----DNATALSGSGIALFNKPLLTWR-IKPKHIAETLYLIEQQQKQ 118

Query: 130 -PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKI 187
            P+LIHC  GADRTGL S +Y  I  ++P EEA R++    YG+  + + I    T EK+
Sbjct: 119 GPVLIHCYHGADRTGLISGMYRVIYQNWPIEEAKREMQQGPYGYHSIWRNIANMFTEEKV 178

Query: 188 TQLYPNNVSKGDTEQ 202
            ++          E+
Sbjct: 179 AKVREELARIRQREE 193


>gi|114328740|ref|YP_745897.1| hypothetical protein GbCGDNIH1_2076 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316914|gb|ABI62974.1| hypothetical protein GbCGDNIH1_2076 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 219

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 47/166 (28%), Positives = 77/166 (46%), Gaps = 2/166 (1%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
                   N+  V+P  +YRS  P    +    + +GI++++NLRG            AA
Sbjct: 25  AVFRLVWDNWAEVLPG-LYRSNHPTPGRLAAAVRRHGIRTLINLRGHRQCGSDALSRDAA 83

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
             LG+  ++    +    + ++I +  SIL+    P L+HCKSGADR GLAS +   ++ 
Sbjct: 84  QRLGMAHVDMAFESRGAPHRDRILRFASILQQIEYPALMHCKSGADRAGLASGL-AIVLT 142

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
                +A RQLS  +GHF   +T  +D  F +  +      +  D 
Sbjct: 143 GGTAAQALRQLSWRFGHFNRSRTGILDAFFVRYAREAEGKQNFLDW 188


>gi|163795969|ref|ZP_02189932.1| hypothetical protein BAL199_28110 [alpha proteobacterium BAL199]
 gi|159178724|gb|EDP63262.1| hypothetical protein BAL199_28110 [alpha proteobacterium BAL199]
          Length = 228

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/166 (33%), Positives = 82/166 (49%), Gaps = 4/166 (2%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL-PESWHKEEEKAAN 95
           +     + H V    ++R+AQP    ++   KE GI++ILNLRG       ++ E +A  
Sbjct: 34  LRQVYVHRHKVADG-VWRAAQPGPGHLDQFAKE-GIRTILNLRGPRVECGAYRLEREACA 91

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            LG+ LI+FP+ +   L+ E +   I +      PLL+HCKSGADRTG  + +YL+    
Sbjct: 92  RLGLTLIDFPIRSRAALDRETVLAAIDLWDGLELPLLMHCKSGADRTGFMATLYLWQRTG 151

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPN-NVSKGDT 200
            P  +A  QLS  YGH    KT  +D  FE          +   D 
Sbjct: 152 LPLRQAMEQLSWRYGHIRQAKTGVIDFFFESYLAAEARSGIGFRDW 197


>gi|260427419|ref|ZP_05781398.1| protein tyrosine/serine phosphatase [Citreicella sp. SE45]
 gi|260421911|gb|EEX15162.1| protein tyrosine/serine phosphatase [Citreicella sp. SE45]
          Length = 231

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 80/165 (48%), Gaps = 3/165 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + T   NF  + P  ++RS  P     E   K  GIK+++ LRG+   S +  E+++   
Sbjct: 45  LRTVWTNFWEIAPG-VWRSNHPTHRRFEKYAK-MGIKTVITLRGEEKFSHYLFEKESCEA 102

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG++L +  L A       +I  LI  ++T  +P++ HCKSGADR G ASAVYL +    
Sbjct: 103 LGLKLEHAKLWARMAPKRARILHLIETMRTVERPMMFHCKSGADRAGFASAVYLMVFEGV 162

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDT 200
           P EEA +QL + Y H    KT       +    +     +   D 
Sbjct: 163 PVEEARKQLGLKYIHLEFTKTGIQGYILDTYAARNRREPIGFEDW 207


>gi|170750050|ref|YP_001756310.1| protein tyrosine/serine phosphatase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656572|gb|ACB25627.1| protein tyrosine/serine phosphatase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 241

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 57/209 (27%), Positives = 92/209 (44%), Gaps = 22/209 (10%)

Query: 1   MIKIKKP---RKNLLIFYIKILL---GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYR 54
           + + ++P     + L+ +  +LL   GV  L  +              N H V    ++R
Sbjct: 19  IARFERPIAGPGDRLMAWANMLLMDHGVFRLAYL--------------NRHRVGSGALWR 64

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           SAQP    +   + E G+++I++LRG         + +A    G++L+ F L +    + 
Sbjct: 65  SAQPGPHQLARFRAE-GVRTIISLRGGREHGSWPLQREACERHGLKLVEFVLRSREAPDR 123

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
             I    +       P ++HCKSGADR GLASA+YL +    P  EA RQLS  YGH   
Sbjct: 124 ATILGAKAFFAGIEYPAVMHCKSGADRAGLASALYLILHEGRPVAEAARQLSARYGHLRF 183

Query: 175 LKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
            KT  +D  F +   +     +      +
Sbjct: 184 AKTGILDAFFARYRAEGEAKGLDFLTWVE 212


>gi|188581291|ref|YP_001924736.1| protein tyrosine/serine phosphatase [Methylobacterium populi BJ001]
 gi|179344789|gb|ACB80201.1| protein tyrosine/serine phosphatase [Methylobacterium populi BJ001]
          Length = 241

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 77/161 (47%), Gaps = 2/161 (1%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H +    ++RSAQP    + + K++ G+++I++LRG         + +A    G+ L+
Sbjct: 53  NRHRIGTGLVWRSAQPTPHQLAWFKRQ-GVRTIVSLRGGREHGSWPLQREACERQGLTLV 111

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
            F L +    + E +            P ++HCKSGADR GLA+ ++L +    P  EA 
Sbjct: 112 EFVLRSREAPSRETLLAARDFFAGLEYPAVMHCKSGADRAGLAATLFLILHEGRPVREAL 171

Query: 163 RQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
           RQLS  YGHF   KT  +D  F     +      S  D  +
Sbjct: 172 RQLSPRYGHFRFAKTGILDAFFATYLREGEARGQSFLDWVE 212


>gi|162147197|ref|YP_001601658.1| hypothetical protein GDI_1402 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785774|emb|CAP55345.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 239

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 81/168 (48%), Gaps = 1/168 (0%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
                   NF AV+P ++YR   P    +    + YG+++++NLRG           +AA
Sbjct: 44  AVFRLPWTNFAAVIPGKVYRCNHPTPRRLAAATRRYGLRTLVNLRGHRRCGSDALSREAA 103

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           + +G+  ++    +    + ++I +  ++  T   P+L+HCKSGADR GLAS + + +  
Sbjct: 104 SRIGLTHLDMAFESRGAPHRDRILRFAAMYATLDFPMLMHCKSGADRAGLASGL-VILFE 162

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
               E+A RQLS  +GHF   +T  +D  F +        +   D  +
Sbjct: 163 GGTAEQALRQLSWRFGHFNRSRTGILDAFFLRYRHEAEGRLPFLDWVR 210


>gi|163851502|ref|YP_001639545.1| hypothetical protein Mext_2078 [Methylobacterium extorquens PA1]
 gi|218530309|ref|YP_002421125.1| protein tyrosine/serine phosphatase [Methylobacterium
           chloromethanicum CM4]
 gi|240138669|ref|YP_002963141.1| hypothetical protein MexAM1_META1p2063 [Methylobacterium extorquens
           AM1]
 gi|163663107|gb|ABY30474.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
 gi|218522612|gb|ACK83197.1| protein tyrosine/serine phosphatase [Methylobacterium
           chloromethanicum CM4]
 gi|240008638|gb|ACS39864.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 241

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 77/161 (47%), Gaps = 2/161 (1%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H +    ++RSAQP    + + K++ G+++I++LRG         + +A    G+ L+
Sbjct: 53  NRHRIGTGLVWRSAQPTPHQLAWFKRQ-GVRTIVSLRGGREHGSWPLQREACERQGLNLV 111

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
            F L +    + E +            P ++HCKSGADR GLA+ ++L +    P  EA 
Sbjct: 112 EFVLRSREAPSRETLLAARDFFAGLEYPAVMHCKSGADRAGLAATLFLILHEGRPVREAL 171

Query: 163 RQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
           RQLS  YGHF   KT  +D  F     +      S  D  +
Sbjct: 172 RQLSPRYGHFRFAKTGILDAFFATYLREGEARGQSFLDWVE 212


>gi|209544250|ref|YP_002276479.1| protein tyrosine/serine phosphatase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531927|gb|ACI51864.1| protein tyrosine/serine phosphatase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 220

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 46/168 (27%), Positives = 81/168 (48%), Gaps = 1/168 (0%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
                   NF AV+P ++YR   P    +    + YG+++++NLRG           +AA
Sbjct: 25  AVFRLPWTNFAAVIPGKVYRCNHPTPRRLAAATRRYGLRTLVNLRGHRRCGSDALSREAA 84

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           + +G+  ++    +    + ++I +  ++  T   P+L+HCKSGADR GLAS + + +  
Sbjct: 85  SRIGLTHLDMAFESRGAPHRDRILRFAAMYATLDFPMLMHCKSGADRAGLASGL-VILFE 143

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
               E+A RQLS  +GHF   +T  +D  F +        +   D  +
Sbjct: 144 GGTAEQALRQLSWRFGHFNRSRTGILDAFFLRYRHEAEGRLPFLDWVR 191


>gi|84503445|ref|ZP_01001505.1| hypothetical protein OB2597_03809 [Oceanicola batsensis HTCC2597]
 gi|84388232|gb|EAQ01184.1| hypothetical protein OB2597_03809 [Oceanicola batsensis HTCC2597]
          Length = 212

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 84/164 (51%), Gaps = 3/164 (1%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
                N H V P  ++RS  PN        ++ GI++ILNLRG      ++ EE+   + 
Sbjct: 32  RELWTNLHEVAPG-VWRSNHPNERRFTRY-RDMGIRTILNLRGAEDNVTYRWEERLCAEH 89

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           GI+L    L A R    E I+Q++++L+ A +PLL HCKSGADR GL SA+YL ++   P
Sbjct: 90  GIRLHAVRLDARRAPQVEPIQQVLAVLRQAERPLLFHCKSGADRAGLVSALYLLVIEGQP 149

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPN-NVSKGDT 200
            + A + LS  + HF    T  +D   E   + +    +   + 
Sbjct: 150 ADIARKMLSRRFLHFRSSMTGVLDHFLESYARAHSRSGIGFEEW 193


>gi|254461851|ref|ZP_05075267.1| protein tyrosine/serine phosphatase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678440|gb|EDZ42927.1| protein tyrosine/serine phosphatase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 231

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 50/157 (31%), Positives = 81/157 (51%), Gaps = 6/157 (3%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +     NF+ V    ++RS QP         ++ GIKS++NLRG  P + +  EE++   
Sbjct: 45  LRVPWTNFYPV-SVGVWRSNQPTHKRFMRY-RDLGIKSVINLRGTDPRAHYLFEEESCRI 102

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG++L N  L A    N E I  ++ ++++  +P + HCKSGADR G  +A+Y  +    
Sbjct: 103 LGLKLHNTKLWARTAANRENIVAVLDLMRSVERPFMFHCKSGADRAGFCAAMYQIVFDGV 162

Query: 157 PKEEAHRQLSMLYGHFPVLKTIT----MDITFEKITQ 189
             EEA RQLS+ + H    KT      +D+   +  +
Sbjct: 163 SVEEAKRQLSIKFIHLKWSKTGVQGYILDVFQARQAK 199


>gi|89057701|ref|YP_512155.1| protein tyrosine/serine phosphatase [Jannaschia sp. CCS1]
 gi|88866255|gb|ABD57131.1| protein tyrosine/serine phosphatase [Jannaschia sp. CCS1]
          Length = 244

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 76/165 (46%), Gaps = 3/165 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +     NF  + P  ++RS  P     +   +  GIK+IL LRG      H  E +A  D
Sbjct: 50  LRYPWTNFDEIAPG-VFRSNHPTRARFKAYAER-GIKTILTLRGGEDRPHHLLEVEACRD 107

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            G+     P+SA       Q+  +  +L    +P LIHCKSGADRTGL SA+YL    + 
Sbjct: 108 FGLTFECVPMSARHAPTVAQLSAVFEVLDRIERPFLIHCKSGADRTGLVSAIYLMHYENI 167

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLY-PNNVSKGDT 200
           P ++A  QLS  Y H    +T  +D+  E     +    +   D 
Sbjct: 168 PFDQARVQLSFRYIHIRRSQTGILDVFLEAFAARHAETGIGIRDW 212


>gi|114763435|ref|ZP_01442842.1| hypothetical protein 1100011001336_R2601_17659 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543973|gb|EAU46984.1| hypothetical protein R2601_17659 [Roseovarius sp. HTCC2601]
          Length = 231

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 80/167 (47%), Gaps = 3/167 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + T   NF  + P  ++RS  P     E   K  GIK+++ LRG+   S +  E+++   
Sbjct: 45  LRTVWTNFWQIAPG-VWRSNHPTHRRFEKYAK-MGIKTVITLRGEEKFSHYLFEKESCEK 102

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG+ L +  L A      E+I  LI  L+ A +P++ HCKSGADR G ASAVYL +    
Sbjct: 103 LGLTLKHAKLWARSAPKRERILTLIDTLREAERPMMFHCKSGADRAGFASAVYLMVFEGV 162

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDTEQ 202
           P E A +QL + Y H    +T       +    +     +   +  +
Sbjct: 163 PVEVARKQLGLKYIHLEFTRTGVQGYILDVYAARNRRAPIPFEEWVR 209


>gi|114569186|ref|YP_755866.1| hypothetical protein Mmar10_0635 [Maricaulis maris MCS10]
 gi|114339648|gb|ABI64928.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 241

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 50/166 (30%), Positives = 82/166 (49%), Gaps = 4/166 (2%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAAN 95
           +     N H V    ++R+ QP+   +E L  + G K+ILN+RG  P   ++  E++A  
Sbjct: 47  LRQKFHNMHEVG-GGMWRANQPSPERLEQLAAD-GFKTILNIRGTQPGVCYYDLEKEACE 104

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
             G+ +I+ P  +      +++++ + I ++   P LIHCKSGADR G+ S +Y      
Sbjct: 105 KHGLTMIDMPFGSREAPYVDRMQRAVKIFESIEYPALIHCKSGADRAGIISVLYALTKLK 164

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
            P +EA + LS+ Y H    KT  +D  FE   + Y         E
Sbjct: 165 LPYDEAIKHLSLKYLHVKAGKTGVLDYFFECY-RAYNETTPIDFWE 209


>gi|298571356|gb|ADI87699.1| hypothetical protein LW2_0240 [uncultured Nitrospirae bacterium
           MY2-3C]
          Length = 180

 Score =  173 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 66/173 (38%), Positives = 101/173 (58%), Gaps = 1/173 (0%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSIL 76
            ++L   V+    L L +++ T    NFH +   + YRSAQ     ++Y    YGI+SIL
Sbjct: 5   NVILRADVVLLYILLLSYISYTMAAGNFHVITQGKAYRSAQLEQRQLQYYINNYGIRSIL 64

Query: 77  NLRGKLPES-WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           NLRG+ P + W++ E + +    I   +  LS+ RE    ++ +L+ I   AP+P+LIHC
Sbjct: 65  NLRGQNPRAAWYETEVRFSGLHNIAHYDIALSSAREPTARELNELMRIFAEAPRPILIHC 124

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
            SG+DR+GL +A++  +V   PK +AHRQLS+LYGH P      +D  FEK +
Sbjct: 125 WSGSDRSGLVAAMWKVVVEKEPKAKAHRQLSILYGHLPFGDAAVLDRFFEKWS 177


>gi|126732786|ref|ZP_01748581.1| protein tyrosine/serine phosphatase [Sagittula stellata E-37]
 gi|126706782|gb|EBA05853.1| protein tyrosine/serine phosphatase [Sagittula stellata E-37]
          Length = 240

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/165 (31%), Positives = 79/165 (47%), Gaps = 3/165 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +     NF  + P  +YRS QP     E   K  GI++++NLRG    + +  E ++   
Sbjct: 45  LRVLWTNFFEIAPG-VYRSNQPTHGRFERYAK-MGIRTVINLRGPDVRAQYLFERESCET 102

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           LG+ L++  L A       +I+ +I  L+ A KP++ HCKSGADR G  +A+YL I    
Sbjct: 103 LGLTLVDAKLWARTAAPRSKIEAVIDALRAAEKPVMFHCKSGADRAGFVAAMYLLIFEDA 162

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDT 200
           P E A +QL + Y H    KT   D        +L    +   + 
Sbjct: 163 PLEVAQKQLGLKYIHLDFTKTGVQDYILRVYGARLALGQIGFEEW 207


>gi|299133235|ref|ZP_07026430.1| protein tyrosine/serine phosphatase [Afipia sp. 1NLS2]
 gi|298593372|gb|EFI53572.1| protein tyrosine/serine phosphatase [Afipia sp. 1NLS2]
          Length = 227

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 67/175 (38%), Positives = 101/175 (57%), Gaps = 4/175 (2%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSIL 76
           KI L ++V  AV   L +      T N H +   + YRSAQ +   +  L  +  I++++
Sbjct: 41  KICLRLIVFGAVC-ALLWAGYLRMTGNVHTIEEGQAYRSAQLSANALLKLIGDKKIRTVI 99

Query: 77  NLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           NLRG    ++W+  E +A +  GI  ++  LSA R+L+D+Q+ +L  IL  +PKP+LIHC
Sbjct: 100 NLRGYNGGKNWYDAEIEATHKAGITHVDLALSANRKLSDQQLSRLSDILIKSPKPILIHC 159

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV--LKTITMDITFEKIT 188
           + GADR GLA+A+Y  IVA      A  QLS  +GHFP    +T+ MD T++   
Sbjct: 160 EGGADRAGLAAAMYELIVAGRSALVAGTQLSFRFGHFPWLGSRTVAMDQTWDHFL 214


>gi|296114433|ref|ZP_06833087.1| protein tyrosine/serine phosphatase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295979194|gb|EFG85918.1| protein tyrosine/serine phosphatase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 220

 Score =  171 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 79/168 (47%), Gaps = 1/168 (0%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  V+P  +YR   P    +    +   +K+++NLRG           +AA
Sbjct: 25  AVLRMTWTNFRTVIPGRVYRCNHPTPWRLAMATRRLHLKTLVNLRGHRQCGSDALSREAA 84

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           + LG++ I+    +    + ++I++   I +T   P+L+HCKSGADRTGLA+ + + +  
Sbjct: 85  HRLGLKHIDMAFESRNAPHRDRIERFEKIYRTLTFPMLMHCKSGADRTGLAAGL-VLLFE 143

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
               ++A RQLS   GHF   +T  +D  F +        +      +
Sbjct: 144 GGTADDALRQLSWKNGHFNRSRTGVLDAFFLRYQAEAEGRIPFMQWVR 191


>gi|220936409|ref|YP_002515308.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997719|gb|ACL74321.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 223

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 49/165 (29%), Positives = 77/165 (46%), Gaps = 10/165 (6%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQ 100
            NFH +     +RS QP+   +      +GI++++NLRG+ P+      E  A   LG++
Sbjct: 33  NNFHRI-SERAFRSGQPSPRHLSLRIPRHGIRTVINLRGEEPDNPMLALEADACERLGVR 91

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           L +    +      E I Q   +L+    P+  HCKSGADR GL + +YL+ +   P E+
Sbjct: 92  LEHLRTYSRDLPTREVIHQAHELLQRIEYPVWFHCKSGADRAGLMATLYLHWIEGVPLEQ 151

Query: 161 AHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMN 205
             +     Y H+   KT  +D  FE           K   E+PM+
Sbjct: 152 TRQLKLWPYFHYRYAKTGLLDYFFETYL--------KDTAERPMS 188


>gi|320104233|ref|YP_004179824.1| protein tyrosine/serine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319751515|gb|ADV63275.1| protein tyrosine/serine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 275

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 59/173 (34%), Positives = 90/173 (52%), Gaps = 4/173 (2%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHKEE 90
           L   + +    NF  V P   YR AQP G  +E     +GI ++LNLRG  PE  W+ +E
Sbjct: 53  LAIWSQSWIDTNFGVVQPGVAYRCAQPQGDDLERFIDAHGIATVLNLRGGKPEDQWYAKE 112

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            +     G+   + P+SAT+     Q+  ++ +L+ AP+P+LIHCK+GADRTGLASA+  
Sbjct: 113 VETVQKRGVTYYDLPMSATKRPERRQMLWILDVLRDAPRPILIHCKAGADRTGLASALQK 172

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
            ++   P  +A    ++ +GHF    T  +    E I +       +G   QP
Sbjct: 173 LVIQGEPPRQALSAFTLRHGHFAWGPTGVL---HEPILEYEKWLNERGLNHQP 222


>gi|241759893|ref|ZP_04757993.1| protein tyrosine/serine phosphatase [Neisseria flavescens SK114]
 gi|241319901|gb|EER56297.1| protein tyrosine/serine phosphatase [Neisseria flavescens SK114]
          Length = 196

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 45/161 (27%), Positives = 80/161 (49%), Gaps = 11/161 (6%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T      N + +   ++YRS QP     E + K  GI+S++NLR      + + ++  
Sbjct: 34  WATPVKHDANLYRI-DDKLYRSEQPVAEDGEAIVK-LGIQSVINLRF-----FDRNDDDY 86

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLY 151
               G+ L+N PL +   +  ++I +++ +++       +LIHC  GADRTGL + +Y  
Sbjct: 87  LKAYGLTLLNRPLLS-WSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRI 145

Query: 152 IVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLY 191
           I   +  EEA  ++    YG+  + K I    T EK+ Q+ 
Sbjct: 146 IYQGWTVEEAKAEMQHGPYGYHSIWKNIANLFTEEKVKQVK 186


>gi|329851178|ref|ZP_08265935.1| protein tyrosine/serine phosphatase [Asticcacaulis biprosthecum
           C19]
 gi|328840024|gb|EGF89596.1| protein tyrosine/serine phosphatase [Asticcacaulis biprosthecum
           C19]
          Length = 229

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 4/202 (1%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGT 61
           +K+   + +   F               L      +     N H + P  + R+ QP   
Sbjct: 1   MKLFPKKIHAKPFRTDTGWHRFWTRMHFLWADHAYLRLGFTNAHWIGPDMV-RTNQPWPF 59

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
            +   KK+ GI++++NLRG    S++  E+ A   LG+ L +F L++      ++++   
Sbjct: 60  QLASWKKK-GIRTVINLRGGKG-SFYYMEKYACEKLGLILEDFGLTSRSLPTAQEMRDAK 117

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMD 181
           ++ +    P L+HCKSGADR G+ S +Y +     P E A +QLSM Y H     T  +D
Sbjct: 118 ALFERIQYPALLHCKSGADRAGMMSVLYCHFHLKQPIEVAAQQLSMKYLHMKAGMTGVLD 177

Query: 182 ITFEKI-TQLYPNNVSKGDTEQ 202
             FE     + P  V+  D  Q
Sbjct: 178 HLFEVYLRDVAPTGVAFYDWTQ 199


>gi|304320094|ref|YP_003853737.1| hypothetical protein PB2503_02597 [Parvularcula bermudensis
           HTCC2503]
 gi|303298997|gb|ADM08596.1| hypothetical protein PB2503_02597 [Parvularcula bermudensis
           HTCC2503]
          Length = 233

 Score =  168 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 84/173 (48%), Gaps = 6/173 (3%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG----KLPESWHKEEEK 92
           + T   N H + P  + R+ QP+   I    +E G+K+++NLRG          +  E++
Sbjct: 31  LRTLYDNTHEL-PGGMRRTYQPSPGRIARYAQE-GVKTLINLRGIKTDGRQSGVYWLEKE 88

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           A    GI L++    +      E +  L +  ++   P ++HCKSGADR GLA+ +YL++
Sbjct: 89  ACEAAGIALVDLRAYSREAPKPEFLVDLDACFRSIAYPAVMHCKSGADRAGLAAVLYLFL 148

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMN 205
              +P EEA  QL+  YGH    KT  +D  F    +    +    + +  +N
Sbjct: 149 KEGWPLEEALAQLTYRYGHVKSGKTGVLDHFFAVYREAARRDGVVPNRDHFLN 201


>gi|148260026|ref|YP_001234153.1| protein tyrosine/serine phosphatase [Acidiphilium cryptum JF-5]
 gi|326403018|ref|YP_004283099.1| putative phosphatase [Acidiphilium multivorum AIU301]
 gi|146401707|gb|ABQ30234.1| protein tyrosine/serine phosphatase [Acidiphilium cryptum JF-5]
 gi|325049879|dbj|BAJ80217.1| putative phosphatase [Acidiphilium multivorum AIU301]
          Length = 229

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 48/168 (28%), Positives = 82/168 (48%), Gaps = 2/168 (1%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  V P  +YRS  P    +   ++  GI +++NLRG+          +AA
Sbjct: 28  AVLRLGWTNFAPVKPGALYRSNHPVPFQLAKFRRLVGINTLINLRGECRNGSDALSREAA 87

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
             LG+   +  L +    + ++I +L  I++T  +P L+HCKSGADR G+ASA++  ++ 
Sbjct: 88  RRLGLDFYDMALESRGAPHRDRILRLAEIIRTMRRPALVHCKSGADRAGIASALF-VLIE 146

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
                EA RQLS+ +GH     T  +D   +   +     ++  D  +
Sbjct: 147 GGSVAEARRQLSLRFGHIRQSNTGILDAFLDMYEE-EGGGMAFLDWVR 193


>gi|294651422|ref|ZP_06728736.1| phosphatase [Acinetobacter haemolyticus ATCC 19194]
 gi|292822668|gb|EFF81557.1| phosphatase [Acinetobacter haemolyticus ATCC 19194]
          Length = 197

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 84/164 (51%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+ + T NF+ +   ++YRS QP+   I  L K++ I +++NLR +  ++   +++  
Sbjct: 38  WGTLISNTHNFYQI-SQDVYRSEQPDAELIASL-KQHQIHTVINLRARNKDANVFKDQDF 95

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYL 150
                  L++ P+  T  +N + +   +  ++TA    + +L+HC  G+DRTG   A+Y 
Sbjct: 96  ------NLVHIPIY-TWAINRDDLLTAMRAIQTAKQQNQKVLVHCYHGSDRTGATIAMYR 148

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  E+A +++    YG+  + K I    T + +  +   
Sbjct: 149 IIFENWSIEDAVKEMKQGGYGYHVIWKNIEHLFTTDNVKWIQQQ 192


>gi|226954408|ref|ZP_03824872.1| phosphatase [Acinetobacter sp. ATCC 27244]
 gi|226834856|gb|EEH67239.1| phosphatase [Acinetobacter sp. ATCC 27244]
          Length = 196

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 84/164 (51%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+ + T NF+ +   ++YRS QP+   I  L K++ I +++NLR +  ++   +++  
Sbjct: 38  WGTLISNTHNFYQI-SQDVYRSEQPDAELIASL-KQHQIHTVINLRARNKDANVFKDQDF 95

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYL 150
                  L++ P+  T  +N + +   +  ++TA    + +L+HC  G+DRTG   A+Y 
Sbjct: 96  ------NLVHIPIY-TWAINRDDLLTAMRAIQTAKQQNQKVLVHCYHGSDRTGATIAMYR 148

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  E+A +++    YG+  + K I    T + +  +   
Sbjct: 149 IIFENWSIEDAVKEMKQGGYGYHVIWKNIEHLFTTDNVKWIQQQ 192


>gi|262371722|ref|ZP_06065001.1| protein tyrosine/serine phosphatase [Acinetobacter junii SH205]
 gi|262311747|gb|EEY92832.1| protein tyrosine/serine phosphatase [Acinetobacter junii SH205]
          Length = 194

 Score =  166 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 81/164 (49%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +  + + T NF+ +   ++YRS QPN   I  LKK Y I++++NLR +        + K 
Sbjct: 34  WGALISDTHNFYQI-SQDVYRSEQPNSELIPLLKK-YQIETVINLRARNE------DAKV 85

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYL 150
             +  + L++ P+  T  +N + + Q +  +   K   + +L+HC  G+DRTG   A+Y 
Sbjct: 86  LQNQSLNLVHIPIQ-TWAINRQDLLQAMQAIQIAKNNNQKVLVHCYHGSDRTGATIAMYR 144

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  E A +++    YG+  + K I    T E +  +   
Sbjct: 145 IIFENWSIENAVKEMKQGGYGYHIIWKNIENLFTSENVQWIQQQ 188


>gi|254449478|ref|ZP_05062915.1| protein tyrosine/serine phosphatase [Octadecabacter antarcticus
           238]
 gi|198263884|gb|EDY88154.1| protein tyrosine/serine phosphatase [Octadecabacter antarcticus
           238]
          Length = 223

 Score =  166 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 74/158 (46%), Gaps = 2/158 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
                 +  +  N   + P  ++RS  P    +  L ++ G  +I+ LRG     W   E
Sbjct: 39  WFDHGILRRYWTNMFEIAPG-VWRSNHPTAARLTALAQQ-GTHTIITLRGNRTTPWALLE 96

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            +A   LG++L    L +    N   ++ LI + +   KP+L HCKSGADRTGLAS +YL
Sbjct: 97  HEACTRLGLRLETLALRSQHAPNRHDLQTLIDLFRRVEKPVLFHCKSGADRTGLASVIYL 156

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
            ++   P  +A + LS  Y H    K   +D+  +   
Sbjct: 157 LVIEKQPLAQARKMLSWRYVHLSWTKAGVLDLLLDDFA 194


>gi|149194653|ref|ZP_01871748.1| protein tyrosine/serine phosphatase [Caminibacter mediatlanticus
           TB-2]
 gi|149135076|gb|EDM23557.1| protein tyrosine/serine phosphatase [Caminibacter mediatlanticus
           TB-2]
          Length = 210

 Score =  166 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 53/158 (33%), Positives = 87/158 (55%), Gaps = 1/158 (0%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           I+ FT NFH +     YRSAQP    +E + K+Y IK++LN+RG+  ++    +++    
Sbjct: 15  ISLFTFNFHKI-DDNFYRSAQPTDKHLEEIIKKYNIKTVLNVRGEEHKNILASQKEICKK 73

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             ++LI   L +    + E+I +L  IL T+  P+L+HCKSG+DRTGL + +Y + +   
Sbjct: 74  YNVELITIKLHSRGIPSKEKINRLYEILTTSKYPMLVHCKSGSDRTGLVATLYCHWIKGK 133

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
             +E  +  +  Y HF   KT  +D  FE+  +    N
Sbjct: 134 DIKEIKQLKAFPYLHFKHSKTGLIDKYFEEYLKFKQKN 171


>gi|58039233|ref|YP_191197.1| hypothetical protein GOX0767 [Gluconobacter oxydans 621H]
 gi|58001647|gb|AAW60541.1| Hypothetical protein GOX0767 [Gluconobacter oxydans 621H]
          Length = 220

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 82/200 (41%), Gaps = 13/200 (6%)

Query: 3   KIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTF 62
           +I  P      ++  + +   +                  N   VVP +++R   P    
Sbjct: 5   RITSPAARRRAWWDSLFVDHSIF------------RLGWTNLAPVVPGKVWRCNHPTPAR 52

Query: 63  IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           +  L +   +K+++NLRG            A+  LG+  ++    +    + ++I +   
Sbjct: 53  LRSLTRRLHLKTLVNLRGHRKCGSDALSRGASAKLGLTHLDMAFESRGAPHRDRILRFYD 112

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDI 182
           + +T   P+L+HCKSGADR GLAS + L        ++A  QL   +GHF   +T  +D 
Sbjct: 113 MYQTLAFPMLMHCKSGADRAGLASGLVLM-FEGGTAQDALGQLHWRFGHFNRSRTGILDA 171

Query: 183 TFEKITQLYPNNVSKGDTEQ 202
            F +  +     +   D  +
Sbjct: 172 FFLRYQKEAEGRLPFLDWVR 191


>gi|251792715|ref|YP_003007441.1| protein tyrosine/serine phosphatase [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534108|gb|ACS97354.1| protein tyrosine/serine phosphatase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 204

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 48/162 (29%), Positives = 80/162 (49%), Gaps = 10/162 (6%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
           ++ T+ +  +N + +     YRS Q +    E L  +  IK+I+NLR          +E+
Sbjct: 43  HWATVISENENLYRI-DDNFYRSEQLD-RQAEPLLNKLNIKTIVNLRFFDR----NNDEQ 96

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYL 150
           A     I LIN PL  T  +N  ++  ++  ++   K  P+L+HC  GADRTGL  A+Y 
Sbjct: 97  AFGHKNINLINTPL-LTWSINTREVADILWQIRQHQKDGPVLVHCYHGADRTGLIVAMYR 155

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLY 191
            I  ++   EA R++    YG+  + K I    T E + ++ 
Sbjct: 156 VIYQNWDLNEAKREMQQAPYGYHSIWKNIDNFFTEENVAKIK 197


>gi|293611065|ref|ZP_06693364.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826717|gb|EFF85083.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 192

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 86/164 (52%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + ++ + T NF+ +  +++YRS QP+   I  L K++ I +I+NLR K  +S   + E  
Sbjct: 33  WGSLVSQTHNFYQI-SNDVYRSEQPDTAMISEL-KDHQIGTIINLRAKDADSLVFKNE-- 88

Query: 94  ANDLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
                  L++ P++ T  ++ +   ++ Q I I K   + +L+HC  G+DRTG + A+Y 
Sbjct: 89  ----NFNLVHIPIN-TWAIDRQDLLEVMQQIKIAKQNDQRVLLHCYHGSDRTGASVAMYR 143

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  ++A +++    YG+  + K I    T E +  +   
Sbjct: 144 IIFENWTIDDAVKEMKQGGYGYHIIWKNIDRLFTPENVRWIQQQ 187


>gi|261381013|ref|ZP_05985586.1| protein tyrosine/serine phosphatase [Neisseria subflava NJ9703]
 gi|284796046|gb|EFC51393.1| protein tyrosine/serine phosphatase [Neisseria subflava NJ9703]
          Length = 196

 Score =  165 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 43/161 (26%), Positives = 80/161 (49%), Gaps = 11/161 (6%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T      N + +   ++YRS QP     E + K  GI+S++NLR      + + ++  
Sbjct: 34  WATPVKHDANLYRI-DDKLYRSEQPVAEDGEAIVK-LGIQSVINLRF-----FDRNDDDH 86

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLY 151
               G+ L+N PL +   +  ++I +++ +++       +LIHC  GADRTGL + +Y  
Sbjct: 87  LKAHGLTLLNRPLLS-WSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRI 145

Query: 152 IVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLY 191
           I   +  ++A  ++    YG+  + K I    T EK+ Q+ 
Sbjct: 146 IYQGWSVDDAKAEMQHGPYGYHSIWKNIAKLFTEEKVKQVK 186


>gi|301156145|emb|CBW15616.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 205

 Score =  165 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 52/205 (25%), Positives = 90/205 (43%), Gaps = 13/205 (6%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSL---GLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           + K  KN+L       L               ++ T+ +  +N + +   + YRS Q   
Sbjct: 8   LYKMSKNVLFALTAFSLVACTTTPSEPPKNTEHWATLISEQENLYQI-DDKFYRSEQLEA 66

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
              E L  +  I +I+NLR         ++++A     I LIN PL  T  ++ +++  +
Sbjct: 67  QS-EALLNKLNIHTIVNLRFFDR----NDDKQAFGHTKINLINTPL-LTWSISPDEVADI 120

Query: 121 ISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML-YGHFPVLKT 177
           +  +K   K   +L+HC  GADRTGL  A Y  I  ++   EA R++    YG+  V K 
Sbjct: 121 LWQIKQHQKNGAVLVHCYHGADRTGLIVASYRVIYQNWDLNEAKREMQQGPYGYHSVWKN 180

Query: 178 ITMDITFEKITQLYPNNVSKGDTEQ 202
           I    T E + ++      + +T +
Sbjct: 181 IDNFFTQENMAKIKAELDKRSNTTK 205


>gi|255066578|ref|ZP_05318433.1| protein tyrosine/serine phosphatase [Neisseria sicca ATCC 29256]
 gi|255049162|gb|EET44626.1| protein tyrosine/serine phosphatase [Neisseria sicca ATCC 29256]
          Length = 176

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 47/167 (28%), Positives = 79/167 (47%), Gaps = 10/167 (5%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           +    + T+     N + +   ++YRS QP       L +  GI+S++NLR         
Sbjct: 8   TASARWATLVKQDANLYRI-DDKLYRSEQPVAED-GELIEHLGIRSVINLRFFDR----N 61

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLAS 146
           + E       + L+N PL  T ++  + I Q + +++   K  P+L+HC  GADRTGL S
Sbjct: 62  DNETHLKGRNLMLLNRPL-LTWKIKPKDIAQTLFLIEKQQKYGPVLVHCYHGADRTGLIS 120

Query: 147 AVYLYIVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLYP 192
            +Y  I   +  EEA  ++    YG+  + K I    T EK+ ++  
Sbjct: 121 GMYRIIYQGWSVEEARLEMQHGPYGYHSIWKNIENLFTEEKVQEVRE 167


>gi|260557159|ref|ZP_05829375.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           19606]
 gi|260409265|gb|EEX02567.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           19606]
          Length = 192

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 84/164 (51%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+ + T NF+ +  ++++RS QP+   I  L K Y I +++NLR K        ++  
Sbjct: 33  WGTLVSQTHNFYQI-SNDVFRSEQPDAAMIPEL-KHYQIGTVINLRAK------ASDDLV 84

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYL 150
             +    L++ P++ T  ++ + + +++  +   K   + +L+HC  G+DRTG + A+Y 
Sbjct: 85  FKNENFNLVHIPIN-TWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYR 143

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  ++A +++    YG+  + K I    T E +  +   
Sbjct: 144 IIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENVKWIQQQ 187


>gi|169794794|ref|YP_001712587.1| putative phosphatase [Acinetobacter baumannii AYE]
 gi|184159433|ref|YP_001847772.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ACICU]
 gi|213157879|ref|YP_002320677.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           AB0057]
 gi|215482338|ref|YP_002324520.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB307-0294]
 gi|301346256|ref|ZP_07226997.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB056]
 gi|301512777|ref|ZP_07238014.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB058]
 gi|301597753|ref|ZP_07242761.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB059]
 gi|332852245|ref|ZP_08434050.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013150]
 gi|332870468|ref|ZP_08439232.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013113]
 gi|332876274|ref|ZP_08444049.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6014059]
 gi|169147721|emb|CAM85584.1| conserved hypothetical protein; putative phosphatase [Acinetobacter
           baumannii AYE]
 gi|183211027|gb|ACC58425.1| Protein tyrosine/serine phosphatase [Acinetobacter baumannii ACICU]
 gi|213057039|gb|ACJ41941.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           AB0057]
 gi|213985690|gb|ACJ55989.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB307-0294]
 gi|322509346|gb|ADX04800.1| putative phosphatase [Acinetobacter baumannii 1656-2]
 gi|323519371|gb|ADX93752.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332729375|gb|EGJ60715.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013150]
 gi|332732205|gb|EGJ63473.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013113]
 gi|332735546|gb|EGJ66598.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6014059]
          Length = 192

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 84/164 (51%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+ + T NF+ +  ++++RS QP+   I  L K + I +I+NLR K        ++  
Sbjct: 33  WGTLVSQTHNFYQI-SNDVFRSEQPDAAMIPEL-KHHQIGTIINLRAK------ASDDLV 84

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYL 150
             +    L++ P++ T  ++ + + +++  +   K   + +L+HC  G+DRTG + A+Y 
Sbjct: 85  FKNENFNLVHIPIN-TWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYR 143

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  ++A +++    YG+  + K I    T E +  +   
Sbjct: 144 IIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENVKWIQQQ 187


>gi|225024155|ref|ZP_03713347.1| hypothetical protein EIKCOROL_01023 [Eikenella corrodens ATCC
           23834]
 gi|224943180|gb|EEG24389.1| hypothetical protein EIKCOROL_01023 [Eikenella corrodens ATCC
           23834]
          Length = 203

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 46/162 (28%), Positives = 76/162 (46%), Gaps = 10/162 (6%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
            +    +   N + V   ++YRS QP    +E L+    +KS++NLR          + K
Sbjct: 38  AWAEQVSKAANLYRV-DDKLYRSEQPVEEDVELLQS-LNVKSVVNLRYFNRSG----DRK 91

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKT--APKPLLIHCKSGADRTGLASAVYL 150
              D GI L N PL   R +  +Q+ + + +++   A   +LIHC  GADRTGL + +Y 
Sbjct: 92  VLADRGIALFNQPLLTWR-ITPKQVAETLYLIEQQQAEGTVLIHCYHGADRTGLIAGMYR 150

Query: 151 YIVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLY 191
            I   +  E+A  ++    YG   + + I    T E + Q+ 
Sbjct: 151 IIYQGWTVEQAKNEMRHGPYGFHSIWRNIEDLFTEENVRQVR 192


>gi|325578243|ref|ZP_08148378.1| protein tyrosine/serine phosphatase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159979|gb|EGC72108.1| protein tyrosine/serine phosphatase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 205

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 53/205 (25%), Positives = 91/205 (44%), Gaps = 13/205 (6%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLC---AVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           + K  KN+L       L               ++ T+ +  +N + +  ++ YRS Q   
Sbjct: 8   LYKMSKNVLFALTAFSLVACTTAQSEPPKNTEHWATLISEQENLYQI-DNKFYRSEQLEA 66

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
              E L  +  I +I+NLR         ++++A     I LIN PL  T  ++ +++  +
Sbjct: 67  QS-EALLNKLNIHTIVNLRFFDR----NDDKQAFGHTKINLINTPLL-TWSISPDEVADI 120

Query: 121 ISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML-YGHFPVLKT 177
           +  +K   K   +L+HC  GADRTGL  A Y  I  H+   EA R++    YG+  V K 
Sbjct: 121 LWQIKQHQKNGAVLVHCYHGADRTGLIVASYRVIYQHWDLNEAKREMQQGPYGYHSVWKN 180

Query: 178 ITMDITFEKITQLYPNNVSKGDTEQ 202
           I    T E + ++      + +T +
Sbjct: 181 IDNFFTQENMAKIKAELDKRSNTTK 205


>gi|260548832|ref|ZP_05823054.1| protein tyrosine/serine phosphatase [Acinetobacter sp. RUH2624]
 gi|260408000|gb|EEX01471.1| protein tyrosine/serine phosphatase [Acinetobacter sp. RUH2624]
          Length = 192

 Score =  164 bits (415), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 83/164 (50%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+ + T NF+ V  ++++RS QPN   I  L K + I +I+NLR K        +E  
Sbjct: 33  WGTLVSQTHNFYQV-SNDVFRSEQPNAAMIPEL-KHHQIGTIINLRAKD------SDELV 84

Query: 94  ANDLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
             +    L++ P+  T  +N +   ++ Q I I K   + +L+HC  G+DRTG + A+Y 
Sbjct: 85  FKNENFNLVHIPID-TWAINRQDLLEVMQQIKIAKQNHQRVLLHCYHGSDRTGASVAMYR 143

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I   +  ++A +++    YG+  + K I +  T E +  +   
Sbjct: 144 IIFEDWTIDDAVKEMKQGGYGYHIIWKNIDLLFTPENVKWIQQQ 187


>gi|288576374|ref|ZP_05978680.2| protein tyrosine/serine phosphatase [Neisseria mucosa ATCC 25996]
 gi|288565650|gb|EFC87210.1| protein tyrosine/serine phosphatase [Neisseria mucosa ATCC 25996]
          Length = 203

 Score =  163 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 43/162 (26%), Positives = 78/162 (48%), Gaps = 11/162 (6%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
            +        N + +   ++YRS QP     E + ++ GIKS++NLR      + + ++ 
Sbjct: 33  LWAVSVKQDANLYRI-DDKLYRSEQPVPEDGETISQQ-GIKSVVNLRF-----FDRNDDD 85

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYL 150
                GI +IN PL +   +  + I +++ +++       +LIHC  GADRTGL + +Y 
Sbjct: 86  YLKQYGINIINRPLLSWN-VKPKDIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYR 144

Query: 151 YIVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLY 191
            +   +  EEA  ++    YG+  + K I    T  KI ++ 
Sbjct: 145 ILYQGWQIEEAKAEMQHGPYGYHSIWKNIANLFTEAKIQEVK 186


>gi|239501722|ref|ZP_04661032.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB900]
          Length = 192

 Score =  163 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 84/164 (51%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + ++ + T NF+ +  ++++RS QP+   I  L K + I +I+NLR K  +    + E  
Sbjct: 33  WGSLISQTHNFYQI-SNDVFRSEQPDAAMIPEL-KHHQIGTIINLRAKASDDLVFKNEDF 90

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYL 150
                  L++ P++ T  ++ + + +++  +   K   + +L+HC  G+DRTG + A+Y 
Sbjct: 91  ------NLVHIPIN-TWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYR 143

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  ++A +++    YG+  + K I    T E +  +   
Sbjct: 144 IIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENVKWIQQQ 187


>gi|320104940|ref|YP_004180531.1| hypothetical protein Isop_3424 [Isosphaera pallida ATCC 43644]
 gi|319752222|gb|ADV63982.1| hypothetical protein Isop_3424 [Isosphaera pallida ATCC 43644]
          Length = 265

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/188 (31%), Positives = 94/188 (50%), Gaps = 7/188 (3%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSIL 76
           ++  G L+L A      F+       NF  + P E+YRSAQ +   ++ +  ++GI+++L
Sbjct: 28  RVWAGRLMLLAGLAVAGFVGWRVAIGNFAVIEPGELYRSAQLSAAQLDRVIADHGIRAVL 87

Query: 77  NLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           NLRG  P E W++ E       G   I+  +S+    +  Q+ +++ IL+TAP+PLLIHC
Sbjct: 88  NLRGHNPDEPWYRNEVATTLKRGATQIDVAMSSCDWASRAQMNEIVRILETAPRPLLIHC 147

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNV 195
             G++RTGL SA+ + +      EEA RQ S  Y + P    +T          L     
Sbjct: 148 WHGSERTGLVSALAILLRPGSTLEEAERQFSWRYLYVPFGDGVT------TYAHLKQYKH 201

Query: 196 SKGDTEQP 203
               T +P
Sbjct: 202 WLERTRRP 209


>gi|325123389|gb|ADY82912.1| conserved hypothetical tyrosine/serine phosphatase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 174

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 85/164 (51%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + ++ + T NF+ +  +++YRS QP+   I  L K + I +I+NLR K  +S   + E  
Sbjct: 15  WGSLVSQTHNFYQI-SNDVYRSEQPDTAMISEL-KNHQIGTIINLRAKDADSLVFKNE-- 70

Query: 94  ANDLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
                  L++ P++ T  ++ +   ++ Q I I K   + +L+HC  G+DRTG + A+Y 
Sbjct: 71  ----NFNLVHIPIN-TWAIDRQDLLEVMQQIKIAKQNDQRVLLHCYHGSDRTGASVAMYR 125

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  ++A +++    YG+  + K I    T E +  +   
Sbjct: 126 IIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENVKWIQQQ 169


>gi|299768829|ref|YP_003730855.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter sp. DR1]
 gi|298698917|gb|ADI89482.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter sp. DR1]
          Length = 192

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 42/164 (25%), Positives = 84/164 (51%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+ + + NF+ +  ++++RS QP+   I  L K + I +I+NLR K        +   
Sbjct: 33  WGTLVSQSHNFYQI-SNDVFRSEQPSAAMISEL-KNHQIGTIINLRAKD------ADTLV 84

Query: 94  ANDLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
             +    L++ P++ T  +N +   ++ Q I I K + + +L+HC  G+DRTG + A+Y 
Sbjct: 85  FKNENFNLVHIPIN-TWAINRQDLLEVMQQIKIAKQSNQRVLLHCYHGSDRTGASVAMYR 143

Query: 151 YIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  ++A +++    YG+  + K I    T E +  +   
Sbjct: 144 IIFENWAIDDAVKEMKEGGYGYHIIWKNIDRLFTPENVKWIQQQ 187


>gi|298369990|ref|ZP_06981306.1| protein tyrosine/serine phosphatase [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281450|gb|EFI22939.1| protein tyrosine/serine phosphatase [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 183

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 45/162 (27%), Positives = 77/162 (47%), Gaps = 10/162 (6%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T      N + +   ++YRS QP     + ++K  GIKS++NLR           +  
Sbjct: 19  WATSVKQDANLYRI-DDKLYRSEQPVADDGDTIEK-LGIKSVINLRYFDR----NNNDSH 72

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLY 151
             + G+ L+N PL + R +  E I Q + +++   +   +LIHC  GADRTGL S +Y  
Sbjct: 73  LKNRGLTLLNRPLRSWR-IKPEDIAQTLYLIEKQQQQGAVLIHCYHGADRTGLISGMYRI 131

Query: 152 IVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLYP 192
           I   +   +A  ++    YG+  + K I    T + + Q+  
Sbjct: 132 IYQGWTVADAKEEMLHGPYGYHSIWKNIANLFTEKTVKQVRQ 173


>gi|198282552|ref|YP_002218873.1| protein tyrosine/serine phosphatase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218668152|ref|YP_002424743.1| hypothetical protein AFE_0236 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247073|gb|ACH82666.1| protein tyrosine/serine phosphatase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218520365|gb|ACK80951.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 226

 Score =  161 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 50/151 (33%), Positives = 82/151 (54%), Gaps = 4/151 (2%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLG 98
           F  NFH + P  ++RSAQP+   + + +++YG+ ++LNLR   P E  ++ E++A + LG
Sbjct: 31  FYANFHEIAPG-VFRSAQPSPVQLRHWQQKYGLCTVLNLRAPAPHEPHYRLEQEACDALG 89

Query: 99  IQLINFP-LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  +      +      +++   I++L   P+P L+HCKSGADR G  S +YL++V   P
Sbjct: 90  MTHLTLHGFGSRDLPERDKLLAGIAVLDQLPQPFLLHCKSGADRAGFISVLYLHLVLGIP 149

Query: 158 KEEAHRQLS-MLYGHFPVLKTITMDITFEKI 187
              A RQL    +GH     T  +D  F   
Sbjct: 150 LSAAQRQLRLWPFGHIRHANTGILDWFFVNY 180


>gi|297470462|ref|XP_002683965.1| PREDICTED: LKHP9428-like [Bos taurus]
 gi|296491789|gb|DAA33822.1| LKHP9428-like [Bos taurus]
          Length = 174

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 47/164 (28%), Positives = 83/164 (50%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+ + T NF+ V  ++++RS QPN   I  L K + I +I+NLR K        +E  
Sbjct: 15  WGTLVSQTHNFYQV-SNDVFRSEQPNAAMIPEL-KRHEIGTIINLRAKN------SDELV 66

Query: 94  ANDLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
             +    L++ P+  T  +N +   ++ Q I I K   + +L+HC  G+DRTG + A+Y 
Sbjct: 67  FKNENFNLVHIPID-TWAINRQDLLEVMQQIKIAKQNNQRVLLHCYHGSDRTGASVAMYR 125

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  H+  ++A +++    YG+  + K I    T E +  +   
Sbjct: 126 IIFEHWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPENVKWIQQQ 169


>gi|193078301|gb|ABO13271.2| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           17978]
          Length = 192

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 83/164 (50%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +  + + T NF+ +  ++++RS QP+   I  L K + I +++NLR K        ++  
Sbjct: 33  WGALVSQTHNFYQI-SNDVFRSEQPDAAMIPEL-KHHQIGTVINLRAK------ASDDLV 84

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYL 150
             +    L++ P++ T  ++ + + +++  +   K   + +L+HC  G+DRTG + A+Y 
Sbjct: 85  FKNENFNLVHIPIN-TWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYR 143

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  ++A +++    YG+  + K I    T + +  +   
Sbjct: 144 IIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPKNVKWIQQQ 187


>gi|315919344|ref|ZP_07915584.1| protein tyrosine/serine phosphatase [Bacteroides sp. D2]
 gi|313693219|gb|EFS30054.1| protein tyrosine/serine phosphatase [Bacteroides sp. D2]
          Length = 186

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 49/193 (25%), Positives = 90/193 (46%), Gaps = 10/193 (5%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           +K + +  + I+L V +          +   +   N + +    +YRS QP+    + L+
Sbjct: 2   QKQIPLCLLAIVLSVSLFGQNLKADKIILSDSDLTNLYQI-DSGVYRSEQPSKEGFKALE 60

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K YGI  +LNLR +     H ++++A     I+L      A   ++++Q+ Q + I+K  
Sbjct: 61  K-YGIGEVLNLRNR-----HSDDDEA-KGTSIKLHRVKTKA-HSISEKQLIQALRIIKNR 112

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEK 186
             P++ HC  G+DRTG   A Y  I  +  KE+A  +++   YG   + K I   I    
Sbjct: 113 KAPIVFHCHHGSDRTGAVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNIIRRIKEAN 172

Query: 187 ITQLYPNNVSKGD 199
           + Q+    +  G+
Sbjct: 173 VEQIRKEVMEGGE 185


>gi|160883262|ref|ZP_02064265.1| hypothetical protein BACOVA_01231 [Bacteroides ovatus ATCC 8483]
 gi|260171024|ref|ZP_05757436.1| hypothetical protein BacD2_04084 [Bacteroides sp. D2]
 gi|156111246|gb|EDO12991.1| hypothetical protein BACOVA_01231 [Bacteroides ovatus ATCC 8483]
          Length = 196

 Score =  160 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 93/200 (46%), Gaps = 10/200 (5%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           +I I   +K + +  + I+L V +          +   +   N + +    +YRS QP+ 
Sbjct: 5   IISILLMQKQIPLCLLAIVLSVSLFGQNLKADKIILSDSDLTNLYQI-DSGVYRSEQPSK 63

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
              + L+K YGI  +LNLR +     H ++++A     I+L      A   ++++Q+ Q 
Sbjct: 64  EGFKALEK-YGIGEVLNLRNR-----HSDDDEA-KGTSIKLHRVKTKA-HSISEKQLIQA 115

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTIT 179
           + I+K    P++ HC  G+DRTG   A Y  I  +  KE+A  +++   YG   + K I 
Sbjct: 116 LRIIKNRKAPIVFHCHHGSDRTGAVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNII 175

Query: 180 MDITFEKITQLYPNNVSKGD 199
             I    + Q+    +  G+
Sbjct: 176 RRIKEANVEQIRKEVMEGGE 195


>gi|299146344|ref|ZP_07039412.1| protein tyrosine/serine phosphatase [Bacteroides sp. 3_1_23]
 gi|298516835|gb|EFI40716.1| protein tyrosine/serine phosphatase [Bacteroides sp. 3_1_23]
          Length = 196

 Score =  160 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 94/200 (47%), Gaps = 10/200 (5%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           +I I   +K + +  + I+L V +          +   +   N + +    +YRS QP+ 
Sbjct: 5   IISILLMQKQIPLCLLAIVLSVSLFGQNLKADKIILFDSDLTNLYQI-DSGVYRSEQPSK 63

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
              + L+K YGI  +LNLR +     H ++++A     I+L      A   ++++Q+ Q 
Sbjct: 64  EGFKALEK-YGIGEVLNLRNR-----HSDDDEA-KGTSIKLHRVKTKA-HSISEKQLIQA 115

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTIT 179
           + I+K    P++ HC  G+DRTG+  A Y  I  +  KE+A  +++   YG   + K I 
Sbjct: 116 LRIIKNRKAPIVFHCHHGSDRTGVVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNII 175

Query: 180 MDITFEKITQLYPNNVSKGD 199
             I    + Q+    +  G+
Sbjct: 176 RRIKEANVEQIRKEVMEGGE 195


>gi|126642889|ref|YP_001085873.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           17978]
          Length = 174

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 83/164 (50%), Gaps = 13/164 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +  + + T NF+ +  ++++RS QP+   I  L K + I +++NLR K        ++  
Sbjct: 15  WGALVSQTHNFYQI-SNDVFRSEQPDAAMIPEL-KHHQIGTVINLRAK------ASDDLV 66

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYL 150
             +    L++ P++ T  ++ + + +++  +   K   + +L+HC  G+DRTG + A+Y 
Sbjct: 67  FKNENFNLVHIPIN-TWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYR 125

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            I  ++  ++A +++    YG+  + K I    T + +  +   
Sbjct: 126 IIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPKNVKWIQQQ 169


>gi|329119556|ref|ZP_08248240.1| protein tyrosine/serine phosphatase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464343|gb|EGF10644.1| protein tyrosine/serine phosphatase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 192

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 47/164 (28%), Positives = 81/164 (49%), Gaps = 10/164 (6%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
           ++        N + +   ++YRS Q       ++K   GIKS++NLR         +   
Sbjct: 28  HWAEPVKEDANLYRI-DDKLYRSEQLTRADAPHIKA-LGIKSVVNLRYFDR----NDNHT 81

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYL 150
           A    G +L N PL   R +  +QI Q + +++   +  P+LIHC  GADRTGL +A+Y 
Sbjct: 82  ALAQSGAELFNQPLLTWR-ITPKQIAQTLHLIEQRRRHGPVLIHCYHGADRTGLIAAMYR 140

Query: 151 YIVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLYPN 193
            +  ++P EEA R++    YG+  + + +    T +K+ Q+   
Sbjct: 141 IVYQNWPIEEARREMQQGPYGYHSIWRNLGKLFTADKVRQVKEE 184


>gi|255263931|ref|ZP_05343273.1| protein tyrosine/serine phosphatase [Thalassiobium sp. R2A62]
 gi|255106266|gb|EET48940.1| protein tyrosine/serine phosphatase [Thalassiobium sp. R2A62]
          Length = 230

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 75/165 (45%), Gaps = 2/165 (1%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +  F  NF  +    +YRS   +           G+K+I+NLRG      +  E++    
Sbjct: 45  LRKFWTNFRTL-DTGVYRSNHGDAARFGADIDRLGLKTIINLRGASKAGHYYAEKELCTA 103

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            GI LI+  L+A +    + +  L+  L+T  +P+LIHCKSGADR GL SA+Y  IV  +
Sbjct: 104 KGITLIDIRLNARKAPRQQALLDLVDALETTERPVLIHCKSGADRAGLGSALYRMIVMGH 163

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLYPNNVSKGDT 200
           P ++A  +LS    H        M    +         ++   D 
Sbjct: 164 PTKDARSELSFRTLHVRKSSAGIMGHVLDVYAADTADTSLPFRDW 208


>gi|169632471|ref|YP_001706207.1| putative phosphatase [Acinetobacter baumannii SDF]
 gi|169151263|emb|CAO99956.1| conserved hypothetical protein; putative phosphatase [Acinetobacter
           baumannii]
          Length = 192

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 83/162 (51%), Gaps = 13/162 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +  ++++RS QP+   I  L K + I +I+NLR K        ++    
Sbjct: 35  TLVSQTHNFYQI-SNDVFRSEQPDAAMIPEL-KHHQIGTIINLRAK------ASDDLVFK 86

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYLYI 152
           +    LI+ P++ T  ++ + + +++  +   K   + +L+HC  G+DRTG + ++Y  I
Sbjct: 87  NENFNLIHIPIN-TWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVSMYRII 145

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
             ++  ++A +++    YG+  + K I    T E +  +   
Sbjct: 146 FENWVIDDAVKEMKQGGYGYHIIWKNIDRLFTPENVKWIQQQ 187


>gi|262281114|ref|ZP_06058896.1| protein tyrosine/serine phosphatase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257345|gb|EEY76081.1| protein tyrosine/serine phosphatase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 193

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 39/159 (24%), Positives = 81/159 (50%), Gaps = 13/159 (8%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+ + + NF+ +    ++RS QP+ T +  L K + I +I+NLR +        ++  
Sbjct: 33  WGTLVSQSHNFYQI-SDTVFRSEQPDATMVPEL-KRHQISTIINLRAR------ASDDLV 84

Query: 94  ANDLGIQLINFPLSATRELNDE---QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
             +    L + P++ T  ++ +   ++ Q I I K   + +L+HC  G+DRTG + A+Y 
Sbjct: 85  FKNENFNLAHIPIN-TWAIDRQDLLEVMQQIKIAKQNNQRVLLHCYHGSDRTGASVAMYR 143

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKIT 188
            I  ++  ++A +++    YG+  + K I    T + + 
Sbjct: 144 IIFENWAIDDAVKEMKQGGYGYHIIWKNIDRLFTPKNVK 182


>gi|89067809|ref|ZP_01155253.1| hypothetical protein OG2516_05128 [Oceanicola granulosus HTCC2516]
 gi|89046407|gb|EAR52463.1| hypothetical protein OG2516_05128 [Oceanicola granulosus HTCC2516]
          Length = 242

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 78/158 (49%), Gaps = 1/158 (0%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            L    +     N   + P  ++RS QP    +  L+  +G+ +ILNLRG+   + +   
Sbjct: 39  WLDHAHLRRVWTNQVEIAPG-VWRSNQPTFRRLRELRDRHGVHTILNLRGEDVFAHYLFL 97

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            +    LG++L++  L+AT     E++ +L+       +P L+HCKSGADRTGLA+A+++
Sbjct: 98  REECAALGLRLVDVKLNATTAPTRERLVELLEAFDRVERPFLMHCKSGADRTGLAAALWM 157

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
            +      E+A  QL   + H+       +D   +   
Sbjct: 158 MLKEGQSLEQARDQLHRRHWHYRNGPAGVIDEILDLYE 195


>gi|253567614|ref|ZP_04845025.1| tyrosine/serine phosphatase [Bacteroides sp. 1_1_6]
 gi|251841687|gb|EES69767.1| tyrosine/serine phosphatase [Bacteroides sp. 1_1_6]
          Length = 186

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 47/189 (24%), Positives = 90/189 (47%), Gaps = 18/189 (9%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTF--------TQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           +I LG+ +   +S  +Y   I             N + +    +YRS QP+    + L+K
Sbjct: 7   RIWLGLFIGIVMSFSVYGQNINAEKITVPDSKLTNLYQI-DSGVYRSEQPSDADFKALEK 65

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
            YGI+ +LNLR +     H ++++AA    I+L    + A   ++++Q+   + I+K   
Sbjct: 66  -YGIREVLNLRNR-----HSDDDEAAG-TKIKLYRLKMKA-HSVSEDQLINALRIIKNRK 117

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEKI 187
            P++ HC  G+DRTG   A+Y  +     K++A ++++   +G   + K I   I    I
Sbjct: 118 GPIVFHCHHGSDRTGAVCAMYRIVFQGVSKQKAIQEMTEGGFGFHRIYKNIIRTIEKADI 177

Query: 188 TQLYPNNVS 196
            ++    + 
Sbjct: 178 ERIKREVLQ 186


>gi|168702681|ref|ZP_02734958.1| hypothetical protein GobsU_24351 [Gemmata obscuriglobus UQM 2246]
          Length = 343

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 47/167 (28%), Positives = 78/167 (46%), Gaps = 1/167 (0%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAAND 96
                N H V+P  +YR+AQ     +  L  E G+++++NLRG   + +W+  E +  + 
Sbjct: 43  VVVRTNEHTVIPGRVYRTAQLKPEQLRELIAEKGVRTVVNLRGVCTDTAWYLGECRTTHA 102

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             +   +   SA R     ++++L+ +L     P++ HC+ GADRTGLAS V + +    
Sbjct: 103 ANVNQEDITFSAKRFPAPGEVRRLVEVLDHTAYPIVFHCQRGADRTGLASTVAVLLHTDA 162

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
               A RQL   YGH  V +T  +D  F+               E+ 
Sbjct: 163 DLATARRQLWPRYGHVAVGRTAVLDAFFDYYEAWLARRGEPHAPERF 209


>gi|298292204|ref|YP_003694143.1| protein tyrosine/serine phosphatase [Starkeya novella DSM 506]
 gi|296928715|gb|ADH89524.1| protein tyrosine/serine phosphatase [Starkeya novella DSM 506]
          Length = 191

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 69/179 (38%), Positives = 104/179 (58%), Gaps = 8/179 (4%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            +  + L G LVL  +  G  +        N H VV  E+YRSA  +   ++ + +  GI
Sbjct: 10  RWLTRGLAGGLVLVGLYAGWAYAN-----GNLHTVVEGELYRSATLSSAQLQEVIESRGI 64

Query: 73  KSILNLRGKLPES-WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPL 131
           ++I+NLRG+   S W++EE + A +  ++LI+ P  A+REL D Q+     +L  AP+P+
Sbjct: 65  RTIVNLRGRNAYSAWYREEARVAAETNVKLIDLPWLASRELTDAQVAAFFEVLADAPRPI 124

Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF--PVLKTITMDITFEKIT 188
           LIHC+SGADRTGLA+A+YL  +    +  A  QLS+L+GH   P      MD TFE++ 
Sbjct: 125 LIHCRSGADRTGLAAALYLAAIKKVDEFTAELQLSLLFGHISLPFAPFYAMDETFERLE 183


>gi|298384534|ref|ZP_06994094.1| protein tyrosine/serine phosphatase [Bacteroides sp. 1_1_14]
 gi|298262813|gb|EFI05677.1| protein tyrosine/serine phosphatase [Bacteroides sp. 1_1_14]
          Length = 186

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 47/189 (24%), Positives = 89/189 (47%), Gaps = 18/189 (9%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTF--------TQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           +I LG+ +   +S  +Y   I             N + +    +YRS QP+    + L+K
Sbjct: 7   RIWLGLFIGIVMSFSVYGQNINAEKITVPDSKLTNLYQI-DSGVYRSEQPSDADFKALEK 65

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
            YGI+ +LNLR +     H ++++AA    I+L    + A   +++ Q+   + I+K   
Sbjct: 66  -YGIREVLNLRNR-----HSDDDEAAG-TKIKLYRLKMKA-HSVSEGQLINALRIIKNRK 117

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEKI 187
            P++ HC  G+DRTG   A+Y  +     K++A ++++   +G   + K I   I    I
Sbjct: 118 GPIVFHCHHGSDRTGAVCAMYRIVFQGVSKQKAIQEMTEGGFGFHRIYKNIIRTIEKADI 177

Query: 188 TQLYPNNVS 196
            ++    + 
Sbjct: 178 ERIKREVLQ 186


>gi|317062979|ref|ZP_07927464.1| protein tyrosine/serine phosphatase [Fusobacterium ulcerans ATCC
           49185]
 gi|313688655|gb|EFS25490.1| protein tyrosine/serine phosphatase [Fusobacterium ulcerans ATCC
           49185]
          Length = 193

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 42/160 (26%), Positives = 81/160 (50%), Gaps = 15/160 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             NF+ V    ++RS QP    ++ ++  +GI ++++LR +       ++ + A +  + 
Sbjct: 39  ADNFYKV-SETLFRSEQPTEDGMKNIEA-FGIGTVISLRSRQ------KDVELAKNTELN 90

Query: 101 LINFPLSATRELNDEQIKQLISIL-----KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           LI+  + A      E   +++  L     +T  KP+LIHC  GADRTG+  A+Y  +  +
Sbjct: 91  LIHVSMRAWN-PKYEDAVKVMYFLNPNNPETNKKPILIHCYHGADRTGMMVALYRMVYQN 149

Query: 156 YPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYPNN 194
           + +EEA  ++ +  YG+  + K I   I    + QL  ++
Sbjct: 150 WEREEALNEMLNGGYGYHSMWKDIVTFIKTVDVEQLRKDS 189


>gi|257468724|ref|ZP_05632818.1| hypothetical protein FulcA4_05240 [Fusobacterium ulcerans ATCC
           49185]
          Length = 204

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 42/160 (26%), Positives = 81/160 (50%), Gaps = 15/160 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             NF+ V    ++RS QP    ++ ++  +GI ++++LR +       ++ + A +  + 
Sbjct: 50  ADNFYKV-SETLFRSEQPTEDGMKNIEA-FGIGTVISLRSRQ------KDVELAKNTELN 101

Query: 101 LINFPLSATRELNDEQIKQLISIL-----KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           LI+  + A      E   +++  L     +T  KP+LIHC  GADRTG+  A+Y  +  +
Sbjct: 102 LIHVSMRAWN-PKYEDAVKVMYFLNPNNPETNKKPILIHCYHGADRTGMMVALYRMVYQN 160

Query: 156 YPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYPNN 194
           + +EEA  ++ +  YG+  + K I   I    + QL  ++
Sbjct: 161 WEREEALNEMLNGGYGYHSMWKDIVTFIKTVDVEQLRKDS 200


>gi|310816645|ref|YP_003964609.1| protein tyrosine/serine phosphatase [Ketogulonicigenium vulgare
           Y25]
 gi|308755380|gb|ADO43309.1| protein tyrosine/serine phosphatase [Ketogulonicigenium vulgare
           Y25]
          Length = 205

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 87/171 (50%), Gaps = 5/171 (2%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH 87
           +        +  +T    A V  +++RS       +  L+ + GIK+IL LRG  P + +
Sbjct: 17  LDFLFLDHAVLRYTWCNQAKVCDDVWRSNHAGFGRLRRLRDQ-GIKAILTLRGSSPSAAN 75

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
           + E  A + LG+ L +  L A R    +++ +L +  +  P+P L+HCKSGADR GLA A
Sbjct: 76  RFEAAACHTLGLHLYSVSLEARRAPKRDEVLRLFNTFRALPRPFLMHCKSGADRAGLAGA 135

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
           +YL  +     E+A +QLS+ Y H    +T  +D     +  LY N+  + 
Sbjct: 136 LYLLGMQGATIEQARKQLSLRYLHIRASQTGVLDH----VLDLYENDFRRY 182


>gi|327398356|ref|YP_004339225.1| protein tyrosine/serine phosphatase [Hippea maritima DSM 10411]
 gi|327180985|gb|AEA33166.1| protein tyrosine/serine phosphatase [Hippea maritima DSM 10411]
          Length = 381

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 67/154 (43%), Positives = 95/154 (61%), Gaps = 3/154 (1%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEK 92
           F        NFH V    +YRS Q +   + Y  K+Y IKSI+NLRGK   ++W+KEE K
Sbjct: 215 FEVYMEENGNFHTVENGALYRSGQLDKDELLYYIKQYHIKSIVNLRGKQQGKNWYKEEIK 274

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
            +  L +  I+F LS  +     ++ +LI+IL+  PKP+LIHCK+GADR+GL SA++ Y 
Sbjct: 275 LSKQLNLVHIDFRLSPNKIAKPRKLIKLINILEKIPKPILIHCKAGADRSGLVSAIWKYY 334

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTI--TMDITF 184
           V +YP + +  QLS+LY HFP L +    MD +F
Sbjct: 335 VENYPIKRSDEQLSLLYLHFPYLGSPSEAMDKSF 368


>gi|29345614|ref|NP_809117.1| hypothetical protein BT_0204 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29337506|gb|AAO75311.1| protein tyrosine/serine phosphatase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 169

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 41/156 (26%), Positives = 79/156 (50%), Gaps = 10/156 (6%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N + +    +YRS QP+    + L+K YGI+ +LNLR +     H ++++AA    I+L
Sbjct: 23  TNLYQI-DSGVYRSEQPSDADFKALEK-YGIREVLNLRNR-----HSDDDEAAG-TKIKL 74

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
               + A   ++++Q+   + I+K    P++ HC  G+DRTG   A+Y  +     K++A
Sbjct: 75  YRLKMKA-HSVSEDQLINALRIIKNRKGPIVFHCHHGSDRTGAVCAMYRIVFQGVSKQKA 133

Query: 162 HRQLS-MLYGHFPVLKTITMDITFEKITQLYPNNVS 196
            ++++   +G   + K I   I    I ++    + 
Sbjct: 134 IQEMTEGGFGFHRIYKNIIRTIEKADIERIKREVLQ 169


>gi|237722313|ref|ZP_04552794.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_2_4]
 gi|262407523|ref|ZP_06084071.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_1_22]
 gi|294646817|ref|ZP_06724438.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294808854|ref|ZP_06767583.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|298483703|ref|ZP_07001877.1| protein tyrosine/serine phosphatase [Bacteroides sp. D22]
 gi|229448123|gb|EEO53914.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_2_4]
 gi|262354331|gb|EEZ03423.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_1_22]
 gi|292637762|gb|EFF56159.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294443896|gb|EFG12634.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|295087592|emb|CBK69115.1| Protein tyrosine/serine phosphatase [Bacteroides xylanisolvens
           XB1A]
 gi|298270120|gb|EFI11707.1| protein tyrosine/serine phosphatase [Bacteroides sp. D22]
          Length = 187

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/189 (24%), Positives = 88/189 (46%), Gaps = 10/189 (5%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           ++ LL   + ++  + +              +   N + +    +YRS QP+    + L+
Sbjct: 3   KRILLSLLLGVIFSISIFSQNLKVEKITLPDSELTNLYKI-DSGVYRSEQPSHEDFKALE 61

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K YGI   LNLR +     H ++++AA    ++L      A   +N+EQ+ + + I+K  
Sbjct: 62  K-YGIGEALNLRNR-----HSDDDEAAG-TNVKLHRVKTKA-HSINEEQLIEALRIIKNR 113

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEK 186
             P++IHC  G+DRTG   A+Y  +  +  KE+A  +++   +G   + K I   I    
Sbjct: 114 KAPIVIHCHHGSDRTGAVCALYRVVFQNVSKEDAIHEMTEGGFGFHRIYKNIIRRIKEAD 173

Query: 187 ITQLYPNNV 195
           I Q+    +
Sbjct: 174 IEQIRRKVM 182


>gi|303326383|ref|ZP_07356826.1| protein tyrosine/serine phosphatase [Desulfovibrio sp. 3_1_syn3]
 gi|302864299|gb|EFL87230.1| protein tyrosine/serine phosphatase [Desulfovibrio sp. 3_1_syn3]
          Length = 185

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 51/166 (30%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG-IQL 101
           N + V   E+YRS QP G  +    +  GIK++L+LR    +        A +  G + L
Sbjct: 8   NLYRV-DSEVYRSGQPEGEGLRS-AENLGIKTVLSLRSPNRD-------DALDKSGDLLL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            N P+ +    +DE I   + I+  APKP+L+HC+ GADRTGL  A+Y  +   + KE+A
Sbjct: 59  RNVPMHSWNT-HDEDIISALRIIHDAPKPILVHCRHGADRTGLIMAMYRVVFQGWTKEQA 117

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
            +++    YG   V   IT  I    I  +      +      ++A
Sbjct: 118 KKEMLEGGYGFHAVWVNITRRIDKADIAAIRARIFREQGAAAAVSA 163


>gi|237715910|ref|ZP_04546391.1| protein tyrosine/serine phosphatase [Bacteroides sp. D1]
 gi|229443557|gb|EEO49348.1| protein tyrosine/serine phosphatase [Bacteroides sp. D1]
          Length = 181

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 79/158 (50%), Gaps = 10/158 (6%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           +   N + +    +YRS QP+    + L+K YGI   LNLR +     H ++++AA    
Sbjct: 28  SELTNLYKI-DSGVYRSEQPSHEDFKALEK-YGIGEALNLRNR-----HSDDDEAAG-TN 79

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           ++L      A   +N+EQ+ + + I+K    P++IHC  G+DRTG   A+Y  +  +  K
Sbjct: 80  VKLHRVKTKA-HSINEEQLIEALRIIKNRKAPIVIHCHHGSDRTGAVCALYRVVFQNVSK 138

Query: 159 EEAHRQLS-MLYGHFPVLKTITMDITFEKITQLYPNNV 195
           E+A  +++   +G   + K I   I    I Q+    +
Sbjct: 139 EDAIHEMTEGGFGFHRIYKNIIRRIKEADIEQIRRKVM 176


>gi|218782027|ref|YP_002433345.1| protein tyrosine/serine phosphatase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763411|gb|ACL05877.1| protein tyrosine/serine phosphatase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 194

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 79/158 (50%), Gaps = 11/158 (6%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             N + V    +YR AQP     + L+  +GIK+++NLR        + +E+ A D  + 
Sbjct: 45  MSNMYQV-SDSLYRGAQPKAEGFKSLEA-HGIKTVVNLR------ITQGDERYAGDTSMN 96

Query: 101 LINFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           L+  P+    E  +E + Q + + +  A  P+ +HC+ G+DRTG  +A Y  +V  +P E
Sbjct: 97  LVGIPMFP-WEPEEEDVIQFLRLTQDPATAPVFLHCRHGSDRTGALTACYRVVVCGWPLE 155

Query: 160 EAHRQLS-MLYGHFPVLKTITMDITFEKITQLYPNNVS 196
           +A  +++   +G+ P+  T+  D+      ++     S
Sbjct: 156 QAVEEMTKGGFGYHPIWWTLPRDLEDLDFDRIRREVFS 193


>gi|255019986|ref|ZP_05292059.1| hypothetical protein ACA_1196 [Acidithiobacillus caldus ATCC 51756]
 gi|254970515|gb|EET28004.1| hypothetical protein ACA_1196 [Acidithiobacillus caldus ATCC 51756]
          Length = 228

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/145 (33%), Positives = 72/145 (49%), Gaps = 4/145 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLGIQL 101
           NFH V     YRSAQP    +    + YG++++LNLR     E   + E++  + LG++ 
Sbjct: 36  NFHEVG-MGAYRSAQPAPYQLRRWHRRYGLRAVLNLRAPAAHEPQFQLEQEVCDALGMEH 94

Query: 102 INFP-LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           +    + +      EQ  + I  L+  P+P L+HCKSGADR G  S +Y ++      EE
Sbjct: 95  VLLHGIGSRDLPRREQFLEAIETLERLPRPFLMHCKSGADRAGFMSVLYSHLQLGQSLEE 154

Query: 161 AHRQLS-MLYGHFPVLKTITMDITF 184
           A  QL    YGH     T  +D  F
Sbjct: 155 ASAQLRIWPYGHIRHANTGILDWFF 179


>gi|153807935|ref|ZP_01960603.1| hypothetical protein BACCAC_02221 [Bacteroides caccae ATCC 43185]
 gi|149129544|gb|EDM20758.1| hypothetical protein BACCAC_02221 [Bacteroides caccae ATCC 43185]
          Length = 188

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 90/191 (47%), Gaps = 14/191 (7%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQ----NFHAVVPHEIYRSAQPNGTFIEYLKK 68
              + +L GV+   ++          T       N + +    +YRS QP+ +  + L+K
Sbjct: 4   RILLSLLWGVIFSLSLFSQNLKAEKITLPDSKLNNLYKI-DSGVYRSEQPSHSDFKALEK 62

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
            YGI   LNLR +     H + ++A     ++L    + A   +++EQ+   + I+K   
Sbjct: 63  -YGIGESLNLRNR-----HSDNDEATGTT-VKLHRVKMKA-HSVDEEQLITALRIIKNRK 114

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEKI 187
            P++IHC  G+DRTG+  A+Y  I  +  KE+A R+++   +G   + K I   I    I
Sbjct: 115 SPIVIHCHHGSDRTGVVCALYRIIFQNVSKEDAIREMTDGGFGFHRIYKNIIRRIREADI 174

Query: 188 TQLYPNNVSKG 198
            ++    ++ G
Sbjct: 175 ERIKREVMTVG 185


>gi|78061402|ref|YP_371310.1| protein tyrosine/serine phosphatase [Burkholderia sp. 383]
 gi|77969287|gb|ABB10666.1| protein tyrosine/serine phosphatase [Burkholderia sp. 383]
          Length = 194

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/174 (28%), Positives = 86/174 (49%), Gaps = 12/174 (6%)

Query: 27  AVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW 86
           A  +            N H + P  +YRSAQ + + +  L+K  GI+ +++ R     S+
Sbjct: 30  ARPIKWAQSVTDAHVNNLHRITP-TLYRSAQLSRSDVPELQK-LGIRKVISFR-----SF 82

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGL 144
           H ++   A    I++    ++ T ++ DE +   +  L+TA +  P+LIHC+ GADRTGL
Sbjct: 83  HADDTILAG-TQIRMQRIRIN-TWDIRDEDMVAALKALRTADQDGPVLIHCQHGADRTGL 140

Query: 145 ASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSK 197
            SA+Y  +   + +E+A  +L    YG  P+ + IT  +    + +L     S 
Sbjct: 141 VSALYRMVYQGWTREQALDELQHGGYGFHPIWQNITNYLKNVDVERLKREVNSG 194


>gi|293372029|ref|ZP_06618428.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|292633040|gb|EFF51622.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
          Length = 187

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 44/158 (27%), Positives = 78/158 (49%), Gaps = 10/158 (6%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           +   N + +    +YRS QP+    + L+K YGI   LNLR +     H ++++AA    
Sbjct: 34  SELTNLYKI-DSGVYRSEQPSHEDFKALEK-YGIGEALNLRNR-----HSDDDEAAG-TN 85

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           ++L      A   +N+EQ+ + + I+K    P++IHC  G+DRTG   A+Y  +  +  K
Sbjct: 86  VKLHRVKTKA-HSINEEQLIEALRIIKNRKAPIVIHCHHGSDRTGAVCALYRVVFQNVSK 144

Query: 159 EEAHRQLS-MLYGHFPVLKTITMDITFEKITQLYPNNV 195
            +A  +++   +G   + K I   I    I Q+    +
Sbjct: 145 GDAIHEMTEGGFGFHRIYKNIIRRIKEADIEQIRRKVM 182


>gi|238023257|ref|ZP_04603683.1| hypothetical protein GCWU000324_03184 [Kingella oralis ATCC 51147]
 gi|237865640|gb|EEP66780.1| hypothetical protein GCWU000324_03184 [Kingella oralis ATCC 51147]
          Length = 164

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/162 (25%), Positives = 76/162 (46%), Gaps = 9/162 (5%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           + +     N + V   ++YRS Q N   +  + ++ GI+S++NLR       HK ++  A
Sbjct: 1   MQLIKQDANLYRV-DSKLYRSEQLNRDDLATI-RQLGIRSVVNLRYF---GRHKNQKIFA 55

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYI 152
               I LIN PL   R    + I +++  ++   +   +L+HC  GADRTG   A+Y  +
Sbjct: 56  GHPDIALINRPLLTWRVQPRD-IARVLRTIEQQQQQGAVLVHCYHGADRTGTIVAMYRIV 114

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
               P  +A  ++    +G+  + + +    T E + Q+   
Sbjct: 115 YHGLPIADALAEMKHERFGYHSIWRNLERLFTEENVAQVKAE 156


>gi|262371459|ref|ZP_06064775.1| protein tyrosine/serine phosphatase [Acinetobacter johnsonii SH046]
 gi|262313598|gb|EEY94649.1| protein tyrosine/serine phosphatase [Acinetobacter johnsonii SH046]
          Length = 191

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 13/165 (7%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
           ++        NF+ +    ++RS QP+   ++ LK +  I  I+NLR +        + K
Sbjct: 31  HWGQSMQPAHNFYQI-SETVFRSEQPDQNLVQSLKAQ-KIDVIINLRSRNQ------DLK 82

Query: 93  AANDLGIQLINFPLSATRELNDEQ---IKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
             ++ G +L++ P+  T  ++ E    + Q I + +   + +L+HC  G+DRTG + A+Y
Sbjct: 83  KLSNQGFELVHIPIH-TWAIDREDLLKVMQQIQLAEQNQQKVLLHCYHGSDRTGASVAMY 141

Query: 150 LYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
             I  ++   +A  ++    YG  P+ + I    + E I  +   
Sbjct: 142 RIIFQNWSTTDALAEMKHGGYGFHPIWQNIEPLFSPENIKWIQQQ 186


>gi|332880031|ref|ZP_08447715.1| hypothetical protein HMPREF9074_03481 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332682027|gb|EGJ54940.1| hypothetical protein HMPREF9074_03481 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 183

 Score =  147 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 48/185 (25%), Positives = 86/185 (46%), Gaps = 12/185 (6%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
            L+ Y+ + + ++       G    T+     N + V    +YRS Q      + + K  
Sbjct: 3   KLLIYVYLFVCLI---PSLWGQQPATLVNAEANLYKV-DELLYRSEQLVSED-KAIIKRI 57

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK- 129
            IKSI+NLR         + +  A   G++LIN PL   R +   +I Q + +++   + 
Sbjct: 58  PIKSIINLRYFTRSG---DRKLFAPSEGVKLINHPLLTWR-IKAPEIAQTLKLIRQHQQE 113

Query: 130 -PLLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTITMDITFEKI 187
             +L+HC  GADRTG+  A+Y  I  ++  ++A H  L+  YG+  V K +    T + +
Sbjct: 114 GAVLLHCYHGADRTGIMVAMYRIIYQNWSIKDAKHEMLNGPYGYHSVWKNLEALFTEQTV 173

Query: 188 TQLYP 192
            ++  
Sbjct: 174 AEVRQ 178


>gi|269120643|ref|YP_003308820.1| protein tyrosine/serine phosphatase [Sebaldella termitidis ATCC
           33386]
 gi|268614521|gb|ACZ08889.1| protein tyrosine/serine phosphatase [Sebaldella termitidis ATCC
           33386]
          Length = 182

 Score =  147 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 52/183 (28%), Positives = 91/183 (49%), Gaps = 11/183 (6%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
           IF + + L   V  A    +    +    +NF+ V    IYRSAQP+   +E L    G+
Sbjct: 7   IFLLFLFLIQSVGYAEINAIEEEILADNIRNFYKVSDG-IYRSAQPDRKNME-LMDIIGV 64

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLL 132
           K+++NLR       +  +   A +  ++L    ++   ++ DE I ++++++K + KP+L
Sbjct: 65  KTVINLRR------YHSDMNEAKNTSLKLERVKMNP-GKIKDEDIAEILTLIKNSDKPVL 117

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHF-PVLKTITMDITFEKITQL 190
           IHC  G+DRTG+  A+Y  +   + KEEA ++L    YGH   +   I   I    + +L
Sbjct: 118 IHCWHGSDRTGVVVAMYRIVFEGFSKEEAIKELREEKYGHHENIYGNIVKYIRNVDVEKL 177

Query: 191 YPN 193
              
Sbjct: 178 KTK 180


>gi|223940368|ref|ZP_03632223.1| protein tyrosine/serine phosphatase [bacterium Ellin514]
 gi|223890973|gb|EEF57479.1| protein tyrosine/serine phosphatase [bacterium Ellin514]
          Length = 188

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/171 (31%), Positives = 86/171 (50%), Gaps = 6/171 (3%)

Query: 7   PRKNLLIFYIKILLGVLVLCAVSL-GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEY 65
            +K+  +    + +G+L++ A+++ G   L       NF  V    +YR AQP+   I+ 
Sbjct: 8   LKKHKWLKISLLSVGLLLIVAMNVAGRRGLPAQEGIYNFGKV-SEGLYRGAQPDEAGIQN 66

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK 125
           L K  GIK+I+NLR  +P+     EE  A+  GI   N PL       DEQ+K ++++++
Sbjct: 67  L-KRLGIKTIVNLR--MPDDVLSGEETQAHANGITYTNVPLRGLGRPTDEQVKNVLALIE 123

Query: 126 TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLK 176
           T P P+ +HC+ G DRTG   A Y      +  E A  +    YG  P  +
Sbjct: 124 TLPAPVFVHCQHGCDRTGTIVACYRIQHDKWLSETALDEAGH-YGMSPFER 173


>gi|149369956|ref|ZP_01889807.1| hypothetical protein SCB49_02744 [unidentified eubacterium SCB49]
 gi|149356447|gb|EDM45003.1| hypothetical protein SCB49_02744 [unidentified eubacterium SCB49]
          Length = 186

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/181 (23%), Positives = 83/181 (45%), Gaps = 18/181 (9%)

Query: 22  VLVLCAVSLGLYFLTI-------TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKS 74
           + +L  +S G  F          +    N   +    +YRS QP+    + L+ +YG K+
Sbjct: 11  IFILALLSFGFSFAQDMNSKKFESRDFNNLFQINDS-LYRSDQPSKKAFKELE-DYGFKT 68

Query: 75  ILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIH 134
           I+N R        +++++ A D  ++L++ P+   + + +  I + +  LK A KP+LIH
Sbjct: 69  IINFRRF------RDDKRKARDTNLKLVHLPMQTAK-VTETDIIEALKALKDAKKPVLIH 121

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF-PVLKTITMDITFEKITQLYP 192
           C  G+DRTG+  A Y  +  ++ KE A  +  +  +G+       +   +    +  +  
Sbjct: 122 CWHGSDRTGVVIASYRIVFENWTKEAAISEFRISDFGYHENWYPNLINILENLNVEAIKK 181

Query: 193 N 193
            
Sbjct: 182 E 182


>gi|319796308|ref|YP_004157948.1| protein tyrosine/serine phosphatase [Variovorax paradoxus EPS]
 gi|315598771|gb|ADU39837.1| protein tyrosine/serine phosphatase [Variovorax paradoxus EPS]
          Length = 180

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/142 (31%), Positives = 77/142 (54%), Gaps = 12/142 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +N H + P  +YRSAQP    +  L+   GI++I++LR         ++ K     GI+L
Sbjct: 24  ENLHRITP-TLYRSAQPRRANVAALQS-LGIRTIVSLRSFN------DDRKVFAGSGIRL 75

Query: 102 INFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +  P++ T  ++D ++ + +  ++ A K  P+LIHC  GADRTG+ +AVY   V  + KE
Sbjct: 76  VRVPIN-TWSIDDAKVLRALVAIREAEKQGPVLIHCMHGADRTGVVAAVYRMAVQGWDKE 134

Query: 160 EAHRQL-SMLYGHFPVLKTITM 180
            A  ++    YG+  + + I  
Sbjct: 135 SARHEMLRGGYGYHTLWRNIPR 156


>gi|213962566|ref|ZP_03390828.1| protein tyrosine/serine phosphatase [Capnocytophaga sputigena
           Capno]
 gi|213954892|gb|EEB66212.1| protein tyrosine/serine phosphatase [Capnocytophaga sputigena
           Capno]
          Length = 182

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 79/174 (45%), Gaps = 9/174 (5%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
           +L         +  T+     N + V    +YRS Q      + + K   IKSI+NLR  
Sbjct: 10  ILFALLPLWSQHKATLIHADANLYKV-DSLLYRSEQLVTED-KAIIKNIPIKSIVNLRYF 67

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGA 139
                  +++       I+LIN PL   R +   +I Q + I++   K   +LIHC  GA
Sbjct: 68  TRSG---DKKIFNASDNIKLINHPLLTWR-IKAPEIAQTLKIIREHQKQGAVLIHCYHGA 123

Query: 140 DRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYP 192
           DRTG+  A+Y  I  ++  E+A +++ +  YG+  V K +    T   + ++  
Sbjct: 124 DRTGIMVAMYRIIYHNWTIEQAKKEMLNGPYGYHSVWKNLEALFTESTVKEVRK 177


>gi|325520902|gb|EGC99881.1| protein tyrosine/serine phosphatase [Burkholderia sp. TJI49]
          Length = 195

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 27  AVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW 86
           A  L        T   N + + P  +YRSAQ + + +  L+K  GI+ +++ R     ++
Sbjct: 32  ARPLNWALGMTDTRVNNLYRITPS-LYRSAQLSRSDVPQLEK-LGIRKVISFR-----AF 84

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGL 144
           H ++   A    I ++  P++ T  + D  +   + +L+TA +  P+LIHC+ GADRTGL
Sbjct: 85  HSDDSILAG-TQITMLRIPIN-TWHIRDRDMVAALKVLRTADQDGPVLIHCQHGADRTGL 142

Query: 145 ASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPN 193
            SA+   +   + +E+A  +L    YG  PV + IT  +    + +L   
Sbjct: 143 VSALCRVVYQGWTREQALDELQHGGYGFHPVWRNITSYLQNVDVAKLRRE 192


>gi|116623982|ref|YP_826138.1| hypothetical protein Acid_4894 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116227144|gb|ABJ85853.1| protein of unknown function DUF442 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 180

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 48/156 (30%), Positives = 79/156 (50%), Gaps = 8/156 (5%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLT----ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKE 69
           F  + +L  LVLC   L    L     I     NFH V  H +YR  QP+    E+L K 
Sbjct: 4   FKNRRILAALVLCCSILTWQALAETPAIAIPIPNFHQVNEH-VYRGGQPSPETWEHLAK- 61

Query: 70  YGIKSILNLRGKLPESWH-KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
            G+K++++LR +  E     +E +A    G+  +N P+       D+QI +++++L T  
Sbjct: 62  IGVKTVIDLRREGEEEHSVAQEAEAVKKAGMTYVNVPMKGVVAPTDDQIAKVMALLNTNE 121

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
            P+ +HCK G+DRTG   A Y      + +++A ++
Sbjct: 122 -PVFVHCKRGSDRTGAVIACYRISHDRWQQKQALQE 156


>gi|167584148|ref|ZP_02376536.1| protein tyrosine/serine phosphatase [Burkholderia ubonensis Bu]
          Length = 201

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 51/199 (25%), Positives = 89/199 (44%), Gaps = 22/199 (11%)

Query: 12  LIFYIKILLGVLV----------LCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGT 61
           +I  I + L  LV          + A  L            N H + P  +YRSA  +  
Sbjct: 5   VIAVIAVTLAGLVQPVGAQPSTDVAARPLQWAQSVPDARLDNLHRITPS-LYRSALLSRE 63

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
            +  L+K  GI+ +++ R     ++H +E   A    I + + P++ T  + DE +   +
Sbjct: 64  DVPELQK-LGIRKVISFR-----AFHSDERILAG-TQITMQSIPIN-TWYIRDEDMVAAL 115

Query: 122 SILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
             L+ A +  P+LIHC+ GADRTGL SA+Y  +   + +E+A  +L    YG   + + I
Sbjct: 116 RALRDADRDGPVLIHCQHGADRTGLVSALYRMVYQGWTREQALDELQHGGYGFHAIWQNI 175

Query: 179 TMDITFEKITQLYPNNVSK 197
              +    + +L      +
Sbjct: 176 AYYLKHVDVERLRRQVDER 194


>gi|168701753|ref|ZP_02734030.1| protein tyrosine/serine phosphatase [Gemmata obscuriglobus UQM
           2246]
          Length = 191

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 70/153 (45%), Gaps = 8/153 (5%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
           +  L A+++ L         +NF  V P  +YRS Q   +  E L  ++GIK++++LR  
Sbjct: 9   LTALVAIAVLLSGSGCDRGPRNFGVVEPGVLYRSGQLTPSAFERLLTDHGIKTVVSLRPL 68

Query: 82  LPESWHKE--EEKAANDLGIQLINFPLSATRE-----LNDEQIKQLISIL-KTAPKPLLI 133
             E+   +  EE      GI+ +  P   T         +   ++ ++++   A  P+ +
Sbjct: 69  RDEAEKSDAHEETICQSRGIKFVRIPPRETGAEPGGSPLEPVAREFLAVMADPANHPVYV 128

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
           HC +G DRTG   AVY      +  E+A  ++ 
Sbjct: 129 HCTAGRDRTGTVCAVYRVDHDGWSPEQAVAEMR 161


>gi|168699665|ref|ZP_02731942.1| hypothetical protein GobsU_09089 [Gemmata obscuriglobus UQM 2246]
          Length = 194

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 76/174 (43%), Gaps = 12/174 (6%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           ++ L F + +    LV+ A  +  Y     T  +NF  V    +YRS Q     ++ + +
Sbjct: 2   RDRLRFVLSLTAAALVIAAPLV--YSANENTHRRNFRVVEEGVLYRSGQLTPAGLDSVVR 59

Query: 69  EYGIKSILNLRGKLPESWHKE--EEKAANDLGIQLINFPLSATRE------LNDEQIKQL 120
           ++ I+++++LR     +   +  EE      G+  +                 ++ +++ 
Sbjct: 60  DHSIRTVVSLRTSRTAAPPPDSWEEGVCAAKGLNHVRIVPRVWGADEKGEIPAEQAVQEF 119

Query: 121 ISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFP 173
           ++++ K    P+L+HC +G  RTG   A++      +  E A  ++ + YG  P
Sbjct: 120 LTVMEKKENHPVLVHCFAGIHRTGTMCAIFRMEHHRWTAERAMTEMQL-YGFAP 172


>gi|70733565|ref|YP_257204.1| hypothetical protein PFL_0052 [Pseudomonas fluorescens Pf-5]
 gi|68347864|gb|AAY95470.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 223

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 75/168 (44%), Gaps = 13/168 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +        N + + P  +YRSA P+   +  L+ +  + +++N   +   SW       
Sbjct: 40  WAQPVEKQYNLYQMSP-TLYRSALPDKGAVPLLQ-QLKVATVINFLPESDASW------- 90

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTAP--KPLLIHCKSGADRTGLASAVYLY 151
            +  GI  +  P      ++D  + + +  +++A    P+L+HCK G+DRTGL SA+Y  
Sbjct: 91  LSAPGINQVQLPYRTNH-VDDADVLKALRAIQSAEAQGPVLMHCKHGSDRTGLMSAMYRV 149

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
           ++  + KEEA  +++   YG     K     +    + +L     +  
Sbjct: 150 VIQGWSKEEALNEMTQGGYGDSSHFKDGIRYMMQADVDKLRTALANGD 197


>gi|269122994|ref|YP_003305571.1| protein tyrosine/serine phosphatase [Streptobacillus moniliformis
           DSM 12112]
 gi|268314320|gb|ACZ00694.1| protein tyrosine/serine phosphatase [Streptobacillus moniliformis
           DSM 12112]
          Length = 189

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 78/168 (46%), Gaps = 10/168 (5%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + +  +N + +    +YRS Q     +  +  E GIK+I+NLR    +    +++K   +
Sbjct: 24  LISKEKNMYKI-DGGVYRSQQLESEDLS-IINELGIKTIINLRFFNRD----KDKKIFKE 77

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVA 154
             + LIN PL  T  +  +++ Q++  ++ +     +L HC  G+DRTGL S +Y  I  
Sbjct: 78  TDLILINNPLK-TWNITPKEVAQILYDIEKSKENGAVLFHCYHGSDRTGLISGMYRIIYQ 136

Query: 155 HYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
            Y  +EA  +L    YG   +   I        +T++     +  + +
Sbjct: 137 DYEIDEALLELVQGSYGFHKIWSNIPKMFNENTVTEIKNEIFNLKNQK 184


>gi|325265784|ref|ZP_08132471.1| protein tyrosine/serine phosphatase [Kingella denitrificans ATCC
           33394]
 gi|324982767|gb|EGC18392.1| protein tyrosine/serine phosphatase [Kingella denitrificans ATCC
           33394]
          Length = 193

 Score =  141 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 9/165 (5%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
            ++        N H V   ++YRS QP    I        I++I+NLR        +  +
Sbjct: 29  AHWAQSVKADANLHRV-DDKLYRSEQPIADDIAA-INAAQIRTIVNLRYFNRN---RNND 83

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVY 149
             A +  I+L+N PL   R +  + +   +  ++   K   +L+HC  GADRTG+  A Y
Sbjct: 84  LFAQNPHIRLVNQPLLTWR-VRPKDLAAALYQIEQGQKHGAVLVHCYHGADRTGIVIAFY 142

Query: 150 LYIVAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYPN 193
             I  ++   +A  ++    +G+  V K +    T E + ++   
Sbjct: 143 RMIYQNWTLADAKAEMLQGGFGYHSVWKNLENLFTEETLAEVKTE 187


>gi|77920431|ref|YP_358246.1| hypothetical protein Pcar_2841 [Pelobacter carbinolicus DSM 2380]
 gi|77546514|gb|ABA90076.1| protein tyrosine/serine phosphatase [Pelobacter carbinolicus DSM
           2380]
          Length = 693

 Score =  141 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 69/137 (50%), Gaps = 9/137 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H +    +YRSAQP  T ++ L+ + GIK++LNLR          + KA  + G+   
Sbjct: 37  NLHKL-DENLYRSAQPTATGMKNLE-QMGIKTVLNLRSF------HSDRKAIGNTGLGYE 88

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +  + A     ++ I+ L  +      PLL+HC  GADRTG   AVY  +V  + KE+A 
Sbjct: 89  HLYMKAWHPEREDIIRFLRIVTDPERSPLLVHCLHGADRTGTMCAVYRIVVQGWTKEQAL 148

Query: 163 RQLS-MLYGHFPVLKTI 178
           R+++   +    +   +
Sbjct: 149 REMTEGGFNFHSIFDNL 165


>gi|288573895|ref|ZP_06392252.1| protein tyrosine/serine phosphatase [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288569636|gb|EFC91193.1| protein tyrosine/serine phosphatase [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 188

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 93/180 (51%), Gaps = 10/180 (5%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL- 82
           +L A    LY   +     NFH V    +YRSAQ N   +    + + IKSI+NLRG   
Sbjct: 9   LLTAFVTLLYLRAV-----NFHTVSKGVLYRSAQLNLDRLSRYVETHSIKSIVNLRGPQA 63

Query: 83  PESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRT 142
              W++ E++ +   GI   +F LSA R++  +++ +++  ++ APKP+LIHC +GADRT
Sbjct: 64  GRRWYRREKEFSLSKGIVHADFDLSAIRKIPVQELDRILEFMRNAPKPILIHCYAGADRT 123

Query: 143 GLASAVYLYIVAHYPKEEAH-RQLSMLYGHFP---VLKTITMDITFEKITQLYPNNVSKG 198
           GL +A++          +A  RQL  + GHF    +     +   ++ +  +  +   +G
Sbjct: 124 GLIAALWRLAEDRDAPLQALNRQLCWMKGHFSTLHIGTNAMVRSFWDYVKHIQGDGPLRG 183


>gi|168704910|ref|ZP_02737187.1| hypothetical protein GobsU_35559 [Gemmata obscuriglobus UQM 2246]
          Length = 222

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 46/183 (25%), Positives = 76/183 (41%), Gaps = 18/183 (9%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           +N L + +  ++  LVL A  + LY        + F  V P  +YRS Q           
Sbjct: 2   RNGLRWVLGCVVAALVLGA-PVALYRAQYI-QAKRFREVEPGRLYRSGQMTAAGFREAVD 59

Query: 69  EYGIKSILNLRGKLPESWHKE---------EEKAANDLGIQLINF-----PLSATRELND 114
            YGIK+++NL+ + P+    +         E +    LG++         P     +   
Sbjct: 60  RYGIKTVVNLQHEEPDPLLPDHWLGKGQVRESELCAQLGVRYRLLTPDILPPGNQLDWEP 119

Query: 115 EQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
             +KQ   +L   +  P+L+HCK+G  RTG  +A+Y      +   EA R+L    YG+ 
Sbjct: 120 PAVKQWRDLLDDESNYPVLLHCKAGLHRTGRLTAIYRMEYRGWSPGEALRELRANGYGYV 179

Query: 173 PVL 175
              
Sbjct: 180 AAS 182


>gi|149176972|ref|ZP_01855581.1| hypothetical protein PM8797T_07122 [Planctomyces maris DSM 8797]
 gi|148844227|gb|EDL58581.1| hypothetical protein PM8797T_07122 [Planctomyces maris DSM 8797]
          Length = 225

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 54/203 (26%), Positives = 90/203 (44%), Gaps = 6/203 (2%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIE 64
           K PR++ L F I +++  L+   V +    L      + F  V   +IYRS Q +   IE
Sbjct: 16  KSPRRHKL-FKISLIVCALIGTGVLIWEEVLEDRIVAKRFGVVEQGKIYRSGQISSYLIE 74

Query: 65  YLKKEYGIKSILNLRGKL-PESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
            +  E  I+ ++ L G    + + K E + A  L I      L      + +   + ++ 
Sbjct: 75  PVLSENKIEKVIALNGSDLQKPYLKAEVQTAKKLHIDHQVLHLIGDGTGDVDDYAEAVAE 134

Query: 124 L---KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           +   + A KP+L+HC +GA RTG   A Y  +V     EEA+++L + Y   P      +
Sbjct: 135 IMRCEKAGKPVLVHCAAGAQRTGGVIAAYRMLVQKKTPEEAYQEL-LQYDWKPHKDQALI 193

Query: 181 DITFEKITQLYPNNVSKGDTEQP 203
           D   + + QL      K D  +P
Sbjct: 194 DYLNQNLAQLSILLEKKIDWYEP 216


>gi|332878283|ref|ZP_08446009.1| hypothetical protein HMPREF9074_01748 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332683734|gb|EGJ56605.1| hypothetical protein HMPREF9074_01748 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 181

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 44/161 (27%), Positives = 73/161 (45%), Gaps = 9/161 (5%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
            T+     N + V     YRS Q      + + K   IK+I+NLR        K+ ++  
Sbjct: 24  ATVVHSQANLYQV-DSLPYRSEQLVKAN-KEVIKRTPIKTIINLRYFTRS---KDRKEFY 78

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYI 152
              GI LIN PL   R +  + I Q++  ++ A +   +LIHC  GADRTG+  A+Y  I
Sbjct: 79  FTDGITLINHPLLTWR-ITLKDIAQVLQRIRKAQQQGAVLIHCYHGADRTGIMVAMYRII 137

Query: 153 VAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLYP 192
              +    A +++    Y +  + K +    T E + ++  
Sbjct: 138 YHGWSIAAAKKEMLQGTYAYHSIWKNLEALFTEETVKEVRE 178


>gi|255321883|ref|ZP_05363033.1| protein tyrosine/serine phosphatase [Campylobacter showae RM3277]
 gi|255300987|gb|EET80254.1| protein tyrosine/serine phosphatase [Campylobacter showae RM3277]
          Length = 228

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/160 (28%), Positives = 75/160 (46%), Gaps = 11/160 (6%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
            T+    +NF+ V    ++RSAQ +G+    L  E GIKSI+NLR          + +A 
Sbjct: 72  ATLIDEAKNFYRV-DELLFRSAQLDGSDAAKLH-ELGIKSIVNLRHFSRGG----DRRAF 125

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYI 152
            D    L + PL +  E+   QI  ++  ++   K   +L+HC  GADRTGL  A+Y  I
Sbjct: 126 GDQ-FWLASKPLQS-WEIKPAQIADVLRTIRERQKEGAVLVHCYHGADRTGLVVAMYRVI 183

Query: 153 VAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLY 191
              +  + A  ++    YG   + + I   +T +    + 
Sbjct: 184 YQGWSLDAARSEMIDGGYGFHSMWQDIAGFLTPQNEALVR 223


>gi|257459745|ref|ZP_05624854.1| protein tyrosine/serine phosphatase [Campylobacter gracilis RM3268]
 gi|257443170|gb|EEV18304.1| protein tyrosine/serine phosphatase [Campylobacter gracilis RM3268]
          Length = 228

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/162 (29%), Positives = 77/162 (47%), Gaps = 11/162 (6%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
            T+    +NF+ V    ++RSAQ +G++   L  E GIKSI+NLR          +++A 
Sbjct: 72  ATLIDEAKNFYRV-DELLFRSAQLDGSYAAKLH-ELGIKSIVNLRHFSRGG----DKRAF 125

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYI 152
            D    L N PL +  E+   QI  ++  ++   K   +L+HC  GADRTGL  A+Y  I
Sbjct: 126 GDQ-FWLANKPLQS-WEIKPAQIADVLRTIRERQKEGAVLVHCYHGADRTGLVVAMYRVI 183

Query: 153 VAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYPN 193
              +  + A  ++    YG   + + I   +T +    +   
Sbjct: 184 YQGWSLDAARSEMIDGGYGFHSMWQDIAGFLTPQNEALVRAE 225


>gi|229587628|ref|YP_002869747.1| hypothetical protein PFLU0050 [Pseudomonas fluorescens SBW25]
 gi|229359494|emb|CAY46335.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 221

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 71/170 (41%), Gaps = 13/170 (7%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
             +        N H + P  +YRSA P+G     L+K   I +++N   +    W     
Sbjct: 37  AEWAQPVGNQYNLHQMTP-TLYRSALPDGNAAPLLEK-LKIGTVINFLPESDADW----- 89

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVY 149
                  I+ +         ++D  +   +  ++ A    P+L+HCK G+DRTGL +A+Y
Sbjct: 90  --LKSPNIRQVQLSYRTNH-VDDSDVLAALRAIREAEANGPVLMHCKHGSDRTGLMAAMY 146

Query: 150 LYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
             ++  + KE+A  ++S+  +G     K     +    + +L     S  
Sbjct: 147 RVVIQGWSKEDALNEMSLGGFGTSNGFKDGVRYMMRADVDKLRTALASGD 196


>gi|228472848|ref|ZP_04057605.1| protein tyrosine/serine phosphatase [Capnocytophaga gingivalis ATCC
           33624]
 gi|228275430|gb|EEK14207.1| protein tyrosine/serine phosphatase [Capnocytophaga gingivalis ATCC
           33624]
          Length = 178

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 9/153 (5%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + V    +YRS Q      E + +   IK+I+NLR        K+    +   GI LI
Sbjct: 29  NLYQV-DSLLYRSEQLVKADKEEILRTP-IKTIINLRYFTRS---KDRNVFSPTDGITLI 83

Query: 103 NFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           N PL   R +  + I Q++  ++       +LIHC  GAD TG+  A+Y  I   +    
Sbjct: 84  NHPLLTWR-ITPKDIAQVLKRIRRSQEQGAVLIHCYHGADCTGIMVAMYRIIYHDWSIAA 142

Query: 161 AHRQL-SMLYGHFPVLKTITMDITFEKITQLYP 192
           A +++    YG+  + K +    T E + ++  
Sbjct: 143 AKKEMLQGPYGYHSIWKNLEALFTEETVKEVRK 175


>gi|325280120|ref|YP_004252662.1| hypothetical protein Odosp_1446 [Odoribacter splanchnicus DSM
           20712]
 gi|324311929|gb|ADY32482.1| hypothetical protein Odosp_1446 [Odoribacter splanchnicus DSM
           20712]
          Length = 170

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 74/153 (48%), Gaps = 10/153 (6%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF+ +    +YRS QP+      L+K +G++ ILNLR      +H + ++A     + L
Sbjct: 25  KNFYRIGDG-VYRSDQPSAACFRELEK-FGMREILNLR-----CYHTDTKEA-QGTSLIL 76

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            + P  AT  L  + +   + I++    PLL HC  G+DRTG  +A+Y  +  H PK+ A
Sbjct: 77  HHLPTRAT-LLRLDDLVTAMQIIRDRKGPLLFHCWHGSDRTGAVAAMYRMVFQHVPKQHA 135

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQLYPN 193
             ++   ++G   +   I   I    I  +   
Sbjct: 136 IDEMVEGIFGFHMIFDNIIDTIDEADIEHIRQE 168


>gi|258544337|ref|ZP_05704571.1| protein tyrosine/serine phosphatase [Cardiobacterium hominis ATCC
           15826]
 gi|258520417|gb|EEV89276.1| protein tyrosine/serine phosphatase [Cardiobacterium hominis ATCC
           15826]
          Length = 177

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 75/157 (47%), Gaps = 10/157 (6%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +   T + H V P  +YRS Q +      L+    I++I+NLR       H+        
Sbjct: 2   LLERTNHLHEVTPS-LYRSEQLDQDDTALLQA-LNIRTIINLRYFNRGDDHRN----FGH 55

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVA 154
            GI++IN PL  T  +  E++ Q++  ++ + K   +L+HC  G DRTGL   +Y  +  
Sbjct: 56  TGIRIINIPLL-TWNIKAEEMAQVLYTIEQSEKYGNVLVHCYHGEDRTGLTIGLYRILYQ 114

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLY 191
           ++   +A  ++   YG+  + + I      +K+T + 
Sbjct: 115 NWNTADAEAEMR-RYGYNRIWRNIPRFYKPKKLTAVR 150


>gi|320103481|ref|YP_004179072.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319750763|gb|ADV62523.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 249

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 78/170 (45%), Gaps = 10/170 (5%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQN-----FHAVVPHEIYRSAQPNGTF 62
           R++  I    +L GV V  A++    +    T   N     +  V P  +YRS Q +   
Sbjct: 29  RRDR-IGVQSMLAGVTVALALAALAGWRIAATLPDNVDWDHWDVVKPGLLYRSGQLDPDQ 87

Query: 63  IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           +E   + YG+K+++NL  +LP      E + A  LG+     P+        +Q ++++ 
Sbjct: 88  LEEAVRRYGLKTVINL--QLPSPTLARERQVARRLGLNYAVLPMPGDGLGRPDQFRRVLD 145

Query: 123 ILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
           ++     +P+L+HC  G  RTG A A+  Y    +  E+   +L   +G+
Sbjct: 146 MIDDPKSQPVLVHCARGTCRTGSAVALMRYERDGWTLEDVEAELK-RHGY 194


>gi|158523189|ref|YP_001531059.1| protein tyrosine/serine phosphatase [Desulfococcus oleovorans Hxd3]
 gi|158512015|gb|ABW68982.1| protein tyrosine/serine phosphatase [Desulfococcus oleovorans Hxd3]
          Length = 192

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/158 (25%), Positives = 73/158 (46%), Gaps = 10/158 (6%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           I T  +N+H V   ++YRSAQPN   +  ++  +GI+ +LNLR          ++  A  
Sbjct: 37  INTDLKNWHRV-DDKVYRSAQPNAEEMNAVES-FGIEEVLNLRN------LFSDDDEAEG 88

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            G+ L   P S+   +  EQ+ + + I+  A  P+L+HC  GADRTG   A +      +
Sbjct: 89  TGLVLHRIP-SSAGRMTREQVTEALKIINDAKGPILVHCWHGADRTGAVVAAWRMAAHGW 147

Query: 157 PKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYPN 193
             E A  ++ +  +        +   +    + Q+  +
Sbjct: 148 SAEAAIDEMVNGGFNFHATYDNLITLLKGLDVEQVRRD 185


>gi|37181630|gb|AAQ88624.1| LKHP9428 [Homo sapiens]
          Length = 218

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 73/168 (43%), Gaps = 13/168 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +        N H + P  +YRS  P+   +  L+K   + +++N   +  +SW  + +  
Sbjct: 37  WAQPIDAHYNLHQMTP-TLYRSGLPDSRALPLLEK-LNVGTVINFLPESDDSWLADSD-- 92

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLY 151
                I+ +         ++D  +   +  ++ A     +L+HCK G+DRTGL +A+Y  
Sbjct: 93  -----IKQVQLTYRTNH-VDDSDVLAALRAIRQAEANGSVLMHCKHGSDRTGLMAAMYRV 146

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
           ++  + KE+A  ++++  +G     K     +    I +L     +  
Sbjct: 147 VIQGWSKEDALNEMTLGGFGSSNGFKDGVRYMMRADIDKLRTALATGD 194


>gi|77456315|ref|YP_345820.1| protein tyrosine/serine phosphatase [Pseudomonas fluorescens Pf0-1]
 gi|77380318|gb|ABA71831.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 214

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 70/167 (41%), Gaps = 16/167 (9%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +        N   + P  +YRSA P+   +  L     + +++N   +   +W       
Sbjct: 36  WAQPVEVQYNLFQMSP-TLYRSALPDDGAVPLL-NNLKVVTVINFLPEADSNW------- 86

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLY 151
               GI  +  P      ++D  + + +  ++   A  P+L+HCK G+DRTGL +A+Y  
Sbjct: 87  LKAPGIHQVQLPYRTNH-VDDSDVLKTLRAIQSAEAEGPVLMHCKHGSDRTGLMAAMYRI 145

Query: 152 IVAHYPKEEAHRQLSML----YGHFPVLKTITMDITFEKITQLYPNN 194
           +V  + KE+A  +++       GHF       M    +K+     N 
Sbjct: 146 VVQGWSKEDALNEMTQGGFGESGHFRDSVRYVMQADVDKLRTALANG 192


>gi|253559464|gb|ACT32424.1| hypothetical protein [Pseudomonas fluorescens]
          Length = 226

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 74/163 (45%), Gaps = 13/163 (7%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
             +        N + + P  +YRS+ P+G  +  L K   I +++           + ++
Sbjct: 34  AEWAQPVEKNYNLYQMSP-TLYRSSLPDGAALPLLSK-LRIGTVITF-------LPESDK 84

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP--KPLLIHCKSGADRTGLASAVY 149
           +  +  GI+ +  P      ++D  I + +  ++ A    P+L+HCK G+DRTGL +A+Y
Sbjct: 85  RWLSTPGIEQVQLPYRTNH-VDDSDILRALRAVQAAEAKGPVLMHCKHGSDRTGLVAAMY 143

Query: 150 LYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEKITQLY 191
             +V  + KE+A  +++   +G     K     +    + +L 
Sbjct: 144 RVVVQGWSKEDALNEMTEGGFGDSHHFKDGVRYMMQADVDKLR 186


>gi|330806771|ref|YP_004351233.1| hypothetical protein PSEBR_a100 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374879|gb|AEA66229.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 226

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 74/163 (45%), Gaps = 13/163 (7%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
             +        N + + P  +YRS+ P+G  +  L K   I +++           + ++
Sbjct: 34  AEWAQPVEKDYNLYQMSP-TLYRSSLPDGAALPLLTK-LRIGTVITF-------LPESDK 84

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP--KPLLIHCKSGADRTGLASAVY 149
           +  +  GI+ +  P      ++D  I + +  ++ A    P+L+HCK G+DRTGL +A+Y
Sbjct: 85  RWLSTPGIEQVQLPYRTNH-VDDSDILRALRAVQAAEAKGPVLMHCKHGSDRTGLVAAMY 143

Query: 150 LYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEKITQLY 191
             +V  + KE+A  +++   +G     K     +    + +L 
Sbjct: 144 RVVVQGWSKEDALNEMTEGGFGDSHHFKDGVRYMMQADVDKLR 186


>gi|257454910|ref|ZP_05620158.1| protein tyrosine/serine phosphatase [Enhydrobacter aerosaccus SK60]
 gi|257447620|gb|EEV22615.1| protein tyrosine/serine phosphatase [Enhydrobacter aerosaccus SK60]
          Length = 182

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/162 (22%), Positives = 80/162 (49%), Gaps = 11/162 (6%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +  +     N + +   +++RS Q     I  + ++YGI +++NLR    +    + E+ 
Sbjct: 12  WAKLRCQHANLYQI-DEQLFRSEQLTPDDIG-IIQQYGINTLINLRFFDRD----DNEEN 65

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYL 150
             +L +  IN PL  T  +  +Q+ +++  +   +     +L+HC  G+DRTG+  A+Y 
Sbjct: 66  LANLPLTFINHPL-MTWAIKPQQLAEILYDILWHQARGDKVLVHCYHGSDRTGITVAMYR 124

Query: 151 YIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEKITQLY 191
            +V ++  E A  ++    YG   +   I+  +T +K+ ++ 
Sbjct: 125 ILVQNWTIEHAKIEMQDGGYGFHWIWINISNLLTEKKVQEVQ 166


>gi|327188528|gb|EGE55739.1| protein tyrosine/serine phosphatase [Rhizobium etli CNPAF512]
          Length = 191

 Score =  131 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/162 (23%), Positives = 79/162 (48%), Gaps = 12/162 (7%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +      + N + + P   +RSAQ     ++ + +  GIK+I++LR          +   
Sbjct: 36  WAMSVVPSVNLYRITP-TFFRSAQIRKDDVKAI-RLLGIKTIVSLRAF------HSDRNL 87

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLY 151
                I+L+  P++ T  + DE I   +  +++A K  P+L+HC+ G+DRTG+ +A+Y  
Sbjct: 88  PGLERIKLVGVPMN-TWHIEDEDIIAALRAIRSAEKHGPVLLHCQHGSDRTGVVTAMYRV 146

Query: 152 IVAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYP 192
           +   + +++A  +L S  +G+  +   I   +    I ++  
Sbjct: 147 VFQKWSRKKALDELQSGGFGYHAIWTNIPRYLRMVDIDKIRQ 188


>gi|78221312|ref|YP_383059.1| protein tyrosine/serine phosphatase [Geobacter metallireducens
           GS-15]
 gi|78192567|gb|ABB30334.1| protein tyrosine/serine phosphatase [Geobacter metallireducens
           GS-15]
          Length = 202

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 76/157 (48%), Gaps = 16/157 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N   V P  IYR AQP     E L+K  GI+++++LR        + E++     G++ 
Sbjct: 60  SNGGRVAPG-IYRGAQPGPEGYETLRK-MGIRTVIDLRTT------ESEQREVEAAGMKA 111

Query: 102 INFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           I  P++ +R+   E++ +++ ++   A +P+ +HC+ G DRTG+  A Y   V  +   +
Sbjct: 112 IAIPIAMSRDGLREKVDRVVVLMADPANQPVFVHCRHGQDRTGIVVAAYRMKVEGWSLAD 171

Query: 161 AHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           A  ++   +G   V         F+K  + Y   + K
Sbjct: 172 AEAEMQ-SFGFNDVWIN------FKKFIKSYGEQLPK 201


>gi|146307496|ref|YP_001187961.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina ymp]
 gi|145575697|gb|ABP85229.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina ymp]
          Length = 226

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 39/175 (22%), Positives = 77/175 (44%), Gaps = 27/175 (15%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLY---------------FLTITTFTQNFHAVVPHEIYRS 55
            L     + LG L+   +S+                  +        N + + P  +YRS
Sbjct: 9   RLALASLVFLGALLALPLSMAWAATTAPVPGQSARPVNWAQPLDSRINLYRMTPD-LYRS 67

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
           A P+   +  L+   GI +++N        + + +E+   D  +  ++ PL   R ++D 
Sbjct: 68  ALPSAGDLPQLQA-LGIATVINF-------YQRGDEQWLKDPRVVQVHLPLRTDR-IDDA 118

Query: 116 QIKQLISILKTAP--KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML 168
            + +++  ++ A     +LIHCK G +RTGL +A+Y  I  ++ KE+A  ++   
Sbjct: 119 DVIEVLRSIRQAQSRGRVLIHCKHGQNRTGLIAAMYRVIYQNWSKEQALAEMRGG 173


>gi|189423129|ref|YP_001950306.1| protein tyrosine/serine phosphatase [Geobacter lovleyi SZ]
 gi|189419388|gb|ACD93786.1| protein tyrosine/serine phosphatase [Geobacter lovleyi SZ]
          Length = 204

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/137 (24%), Positives = 65/137 (47%), Gaps = 10/137 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N   V P  +YR  QP       L K  GIK++++LR        + E+      G++ 
Sbjct: 55  GNVGRVAPG-VYRGEQPGAAGYATL-KRLGIKTVIDLRTS------ESEKTQVEAAGMKA 106

Query: 102 INFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           I  P+  TR+   +++ Q+++++   A +P+ +HC+ G DRTG+  A Y     ++  ++
Sbjct: 107 IAVPIEMTRKGLRQKVDQVVALMADPANQPVYVHCRHGQDRTGIVVAAYRMTQDNWSLKD 166

Query: 161 AHRQLSMLYGHFPVLKT 177
              ++   +G   V   
Sbjct: 167 VEAEMQ-SFGFNDVWTN 182


>gi|255319421|ref|ZP_05360637.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SK82]
 gi|262380885|ref|ZP_06074036.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SH164]
 gi|255303557|gb|EET82758.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SK82]
 gi|262297520|gb|EEY85438.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SH164]
          Length = 134

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 11/127 (8%)

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK 125
           L K+  IK+++NLR       H  +        IQ+I+ P+  T  +N E +  ++  LK
Sbjct: 3   LLKQKNIKTVINLRT------HDRDSSILEGENIQVIHLPIR-TWAMNREHLLGIMQYLK 55

Query: 126 TAPK---PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
            A      +LIHC  G+DRTG + A+Y  +  ++  E+A  ++    YG+  + K I   
Sbjct: 56  QAQHSGQKVLIHCYHGSDRTGASIAMYRIVFENWSTEQALLEMKHGGYGYHVIWKNIERL 115

Query: 182 ITFEKIT 188
            + E I 
Sbjct: 116 FSTENIQ 122


>gi|222053184|ref|YP_002535546.1| protein tyrosine/serine phosphatase [Geobacter sp. FRC-32]
 gi|221562473|gb|ACM18445.1| protein tyrosine/serine phosphatase [Geobacter sp. FRC-32]
          Length = 200

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/137 (27%), Positives = 68/137 (49%), Gaps = 10/137 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N   + P  IYR AQP       LKK  GIK++++LR        + E+      G++ 
Sbjct: 59  TNVGHIAPG-IYRGAQPGADGYATLKK-MGIKTVIDLRTS------ESEKAQVEAAGMRA 110

Query: 102 INFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           I  P++ +R+   E++  ++++L   A +P+ +HC+ G DRTG+  A Y   V  +   E
Sbjct: 111 IAVPIAMSRDGLKEKVDGVVALLADPANQPIFVHCRHGQDRTGIVVAAYRMKVDKWSLAE 170

Query: 161 AHRQLSMLYGHFPVLKT 177
           A +++   +G   +   
Sbjct: 171 AEKEMQA-FGFNDIWIN 186


>gi|304322339|ref|YP_003855982.1| protein tyrosine/serine phosphatase [Parvularcula bermudensis
           HTCC2503]
 gi|303301241|gb|ADM10840.1| protein tyrosine/serine phosphatase [Parvularcula bermudensis
           HTCC2503]
          Length = 210

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 43/148 (29%), Positives = 70/148 (47%), Gaps = 10/148 (6%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH 87
           ++L L         +N   V    + RS QP    +  L+  YG++ ++NL         
Sbjct: 1   MALALAGCVSVPDVRNLQIVDDGALLRSGQPTPLGLAELRDRYGVRMVINL----DRGTS 56

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK----PLLIHCKSGADRTG 143
            +E   A  LG+  +  P +AT  L  E +  L++ L+ A +    P+L+HC+SG DRTG
Sbjct: 57  DDEMVVALALGLDYLAIP-TATYGLERENLVTLLAALRQAERDGRTPVLVHCRSGQDRTG 115

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLYGH 171
            A AV+  I   +  E+A  ++   Y H
Sbjct: 116 AAVAVFRTIEEDWSAEDAEAEMQ-RYRH 142


>gi|300693572|ref|YP_003749545.1| tyrosine phosphatase protein [Ralstonia solanacearum PSI07]
 gi|299075609|emb|CBJ34902.1| putative tyrosine phosphatase protein [Ralstonia solanacearum
           PSI07]
          Length = 230

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 49/179 (27%), Positives = 72/179 (40%), Gaps = 13/179 (7%)

Query: 19  LLGVLVLCAVSLGLYFLTITTFTQNFHAV--VPHEIYRSAQPNGTFIEYLKKEYGIKSIL 76
           L  +L  C+               NFH V     +++R  QP       L    GIK+I+
Sbjct: 33  LAALLTACSAIHNPSTAPGIEGCLNFHEVEGTSGKLFRGGQPLDESEWNLLANNGIKTII 92

Query: 77  NL-RGKLPESWHKEEEKAANDLGIQLI-------NFPLSATRELNDEQIKQLISILK--T 126
            L R        + E+  A   G+ +I       +  L+  R  +D Q  + ++ +   T
Sbjct: 93  KLNRYSGSTDTDETEKMNAAKHGMMIIPIYMPPEDNSLAFWRAPDDSQTDKALTAISEST 152

Query: 127 APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFE 185
           +     +HC  G DRTGL  A+Y   V H  K  A + L   YGH P L  IT  +  E
Sbjct: 153 SHGATYVHCSHGKDRTGLVIALYQMRVQHKCKAAAMKDL-WDYGHSPWLWGITNRVKHE 210


>gi|315223492|ref|ZP_07865348.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea F0287]
 gi|314946527|gb|EFS98519.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea F0287]
          Length = 182

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/178 (25%), Positives = 75/178 (42%), Gaps = 9/178 (5%)

Query: 18  ILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILN 77
           IL  VL       G    T+     N + V    +YRS Q      + +KK       +N
Sbjct: 6   ILYLVLFSFISLWGQQKATLIHADANLYKV-DSLLYRSEQLVNEDKKIIKKIPIKTI-IN 63

Query: 78  LRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK--TAPKPLLIHC 135
           LR         +++      GI+LIN PL   R +   +I  ++ +++       +LIHC
Sbjct: 64  LRYFTRSG---DKKIFHASEGIKLINHPLLTWR-IKAPEIASVLKLIRKHQNEGAVLIHC 119

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYP 192
             GADRTG+  A+Y  I   +   +A  ++ +  YG+  V K +    T   + ++  
Sbjct: 120 YHGADRTGIMVAMYRIIYEDWSIADAKNEMLNGPYGYHSVWKNLEALFTESTVAEVRK 177


>gi|256820351|ref|YP_003141630.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea DSM
           7271]
 gi|256581934|gb|ACU93069.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea DSM
           7271]
          Length = 182

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           +KNL+++++      L       G    T+     N + V    +YRS Q      + +K
Sbjct: 2   KKNLILYFL------LFSFISLWGQQKATLIHADANLYKV-DSLLYRSEQLVNEDKKIIK 54

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK-- 125
           K       +NLR         +++      GI+LIN PL   R +   +I  ++ +++  
Sbjct: 55  KIPIKTI-INLRYFTRSG---DKKIFHASEGIKLINHPLLTWR-IKAPEIASVLKLIRKH 109

Query: 126 TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLKTITMDITF 184
                +LIHC  GADRTG+  A+Y  I   +   +A  ++ +  YG+  V K +    T 
Sbjct: 110 QNEGAVLIHCYHGADRTGIMVAMYRIIYEDWSIADAKNEMLNGPYGYHSVWKNLEALFTE 169

Query: 185 EKITQLYP 192
             + ++  
Sbjct: 170 STVAEVRK 177


>gi|225076125|ref|ZP_03719324.1| hypothetical protein NEIFLAOT_01157 [Neisseria flavescens
           NRL30031/H210]
 gi|224952544|gb|EEG33753.1| hypothetical protein NEIFLAOT_01157 [Neisseria flavescens
           NRL30031/H210]
          Length = 110

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLY 151
               G+ L+N PL +   +  ++I +++ +++       +LIHC  GADRTGL + +Y  
Sbjct: 1   MKAYGLTLLNRPLLS-WSIKPKEITEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRI 59

Query: 152 IVAHYPKEEAHRQLSML-YGHFPVLKTITMDITFEKITQLY 191
           I   +P EEA  ++    YG+  + K I    T EK+ Q+ 
Sbjct: 60  IYQGWPVEEAKAEMQHGPYGYHSIWKNIANLFTEEKVKQVK 100


>gi|281356890|ref|ZP_06243380.1| protein tyrosine/serine phosphatase [Victivallis vadensis ATCC
           BAA-548]
 gi|281316448|gb|EFB00472.1| protein tyrosine/serine phosphatase [Victivallis vadensis ATCC
           BAA-548]
          Length = 180

 Score =  121 bits (303), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 45/152 (29%), Positives = 70/152 (46%), Gaps = 10/152 (6%)

Query: 23  LVLCAVSLGLYFLTITTFTQNFHAVVPH-EIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
            +L  +          T   NF AV     I+RS QP     E L K  G KSILNLR  
Sbjct: 7   FLLMLIVAPWATAGDGTNPTNFKAVDEELGIFRSGQPGRKEFEALAKR-GFKSILNLRN- 64

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADR 141
                +  + K    L ++     ++ T  + ++ +   + I++ APKPLLIHC  G+DR
Sbjct: 65  -----YHSDLKLIRGLELKEFRCGVN-TGSVTEKDLLNAVRIVRDAPKPLLIHCWHGSDR 118

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSML-YGHF 172
           TG   A +   V ++  E+A  ++ +   G+ 
Sbjct: 119 TGTVVAAFRIAVQNWEVEKAIAEMRLPENGYH 150


>gi|67528456|ref|XP_662030.1| hypothetical protein AN4426.2 [Aspergillus nidulans FGSC A4]
 gi|40741001|gb|EAA60191.1| hypothetical protein AN4426.2 [Aspergillus nidulans FGSC A4]
 gi|259482760|tpe|CBF77547.1| TPA: tyrosine phosphatase family protein (AFU_orthologue;
           AFUA_4G07000) [Aspergillus nidulans FGSC A4]
          Length = 232

 Score =  119 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 70/168 (41%), Gaps = 15/168 (8%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
           V  +  +  G   +      +NF  VV   IYR A P    +  L K  G+++I+ L   
Sbjct: 22  VTTVSPLDPGESDVGKLELPENFGEVVKG-IYRCAFPQPWNLPAL-KTLGLRTIITL--- 76

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCK 136
           + E + +  EK   + GI     P  A ++      +  +  ++ ++   +  P+LIHC 
Sbjct: 77  VDEPYTQSHEKFLEETGITHHRIPFIANKDPAIKTPERVVNTILRLMLNKSNHPILIHCN 136

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
            G  RTG  +A +  +   + +++   +    Y  +   K   +D  F
Sbjct: 137 KGKHRTGCVTACFRKL-QGWDRQDIMNE----YIRYSRPKQRLLDEVF 179


>gi|189196232|ref|XP_001934454.1| tyrosine-protein phosphatase SIW14 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187980333|gb|EDU46959.1| tyrosine-protein phosphatase SIW14 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 279

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 42/152 (27%), Positives = 64/152 (42%), Gaps = 18/152 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AV+P  +YRS  P      +L KE GIK+IL L   +PE      +    + GIQ  
Sbjct: 97  NYGAVIPGCVYRSGYPKEENFGFL-KELGIKTILTL---VPEPISPAYQNFMKEAGIQHF 152

Query: 103 NFPLSAT----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +  + A     R  + E  + L  I+  A  P+L+HC  G  RTG   A +  ++     
Sbjct: 153 HAHIRANKGEVRVESCEMSRALRLIMDRANHPILVHCNKGKHRTGCTIACFRRVL-GVDP 211

Query: 159 EEAHRQLSMLYGHFPVL--KTITMD-ITFEKI 187
           E    +      +      K   +D + FE  
Sbjct: 212 ETVREE------YHTYAGPKARFLDEVFFENF 237


>gi|330503207|ref|YP_004380076.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina NK-01]
 gi|328917493|gb|AEB58324.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina NK-01]
          Length = 232

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/151 (24%), Positives = 68/151 (45%), Gaps = 15/151 (9%)

Query: 18  ILLGVLVLCAVSLGLYFLTITTFTQ---NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKS 74
           +  G     A   G+             N + + P  +YRSA P       L+   GI +
Sbjct: 34  MAWGATTSAAPLQGVRPANWAQPLDTRINLYRMTPD-LYRSALPAARDWPQLQA-LGIAT 91

Query: 75  ILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP--LL 132
           ++N        + + +E+   D  +  ++ PL   R ++D  + +++  ++ A     +L
Sbjct: 92  VINF-------YQRGDEQWLGDPRVHQVHLPLRTDR-IDDTDVIEVLRSIRQAQSRGTVL 143

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           IHCK G +RTGL +A+Y  I  ++ KE+A  
Sbjct: 144 IHCKHGQNRTGLIAALYRVIYQNWSKEQALA 174


>gi|195628302|gb|ACG35981.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 235

 Score =  118 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 72/153 (47%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V H +YRS  P+ + + +L+    ++S+L L    PE + +   +     GI+L 
Sbjct: 81  NF-AMVDHGVYRSGFPDASNLPFLET-LRLRSVLCL---CPEPYPEANLEFLRAHGIKLF 135

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +  ++E      +++I++ +  IL  +  P+LIHCK G  RTG     +  +   + 
Sbjct: 136 QFGIDGSKEPFVNIPEDRIREALEVILDASNHPVLIHCKRGKHRTGCVVGCFRKL-QRWC 194

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   KT   D+ F ++  +
Sbjct: 195 LTSIFDE----YQRFAAAKTRVSDLRFMELFDV 223


>gi|212274893|ref|NP_001130476.1| hypothetical protein LOC100191574 [Zea mays]
 gi|194689234|gb|ACF78701.1| unknown [Zea mays]
          Length = 235

 Score =  118 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 72/153 (47%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V H +YRS  P+ + + +L+    ++S+L L    PE + +   +     GI+L 
Sbjct: 81  NF-AMVDHGVYRSGFPDASNLPFLET-LRLRSVLCL---CPEPYPEANLEFLRAHGIKLF 135

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +  ++E      +++I++ +  IL  +  P+LIHCK G  RTG     +  +   + 
Sbjct: 136 QFGIDGSKEPFVNIPEDRIREALEVILDASNHPVLIHCKRGKHRTGCVVGCFRKL-QRWC 194

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   KT   D+ F ++  +
Sbjct: 195 LTSIFDE----YQRFAAAKTRVSDLRFMELFDV 223


>gi|317146237|ref|XP_001821385.2| tyrosine phosphatase family protein [Aspergillus oryzae RIB40]
          Length = 242

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 62/153 (40%), Gaps = 15/153 (9%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
            +    NF  VV   IYRSA P+   +  L+   G+K+I+ L   + E +         +
Sbjct: 43  YSELPPNFGEVVEG-IYRSAFPSPWNLPALE-NLGLKTIITL---VEEPYSVSHMSFLRE 97

Query: 97  LGIQLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLY 151
            GI      + A ++      D  I  ++ IL   A  P+LIHC  G  RTG   A +  
Sbjct: 98  NGIAHFRIIVQANKDPEEKTPDHVINGILEILLNKANHPILIHCNKGKHRTGCVVACFR- 156

Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
            V  +   +   +    Y  +   K+  +D  F
Sbjct: 157 KVQGWNLRDVLDE----YLSYSWPKSRALDERF 185


>gi|238491852|ref|XP_002377163.1| tyrosine phosphatase family protein [Aspergillus flavus NRRL3357]
 gi|220697576|gb|EED53917.1| tyrosine phosphatase family protein [Aspergillus flavus NRRL3357]
          Length = 183

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 62/153 (40%), Gaps = 15/153 (9%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
            +    NF  VV   IYRSA P+   +  L+   G+K+I+ L   + E +         +
Sbjct: 2   YSELPPNFGEVVEG-IYRSAFPSPWNLPALE-NLGLKTIITL---VEEPYSVSHMSFLRE 56

Query: 97  LGIQLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLY 151
            GI      + A ++      D  I  ++ IL   A  P+LIHC  G  RTG   A +  
Sbjct: 57  NGIAHFRIIVQANKDPEEKTPDHVINGILEILLNKANHPILIHCNKGKHRTGCVVACFR- 115

Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
            V  +   +   +    Y  +   K+  +D  F
Sbjct: 116 KVQGWNLRDVLDE----YLSYSWPKSRALDERF 144


>gi|312212051|emb|CBX92135.1| similar to tyrosine-protein phosphatase SIW14 [Leptosphaeria
           maculans]
          Length = 273

 Score =  116 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/152 (30%), Positives = 66/152 (43%), Gaps = 13/152 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             N+ AVVP  IYRS+ P     E+L K+  IKSI+ L   +PE    E +    + GIQ
Sbjct: 90  PSNYGAVVPGMIYRSSYPEEKNYEFL-KDLKIKSIITL---VPEPLSPEYKDFMEEAGIQ 145

Query: 101 LINFPLSAT----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             +  + A     R  + +  + L  I+     P+LIHC  G  RTG   AV   I    
Sbjct: 146 HFHVHIRANKGEVRVESCDMSRALRLIMDRTNHPILIHCNKGKHRTGCTVAVLRRIFGKM 205

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMD-ITFEKI 187
              +A R+    Y      K   +D + FE  
Sbjct: 206 SL-DAIREEYHTYAGV---KARFLDEVFFETF 233


>gi|294463032|gb|ADE77054.1| unknown [Picea sitchensis]
          Length = 194

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 65/167 (38%), Gaps = 14/167 (8%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           +A+V   +YRS  P+     YL+    ++SI+ L    PE + +   +      IQL  F
Sbjct: 27  YAMVHKGVYRSGFPSAVNFPYLET-LRLRSIIYL---CPEPYPEANTEFLRAHNIQLFQF 82

Query: 105 PLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            +   +E      ++ I++ +  +L     P+LIHCK G  RTG         + ++   
Sbjct: 83  GIEGHKEPFVNIPEDTIREALKVLLDPRNHPVLIHCKRGKHRTGCLVGCLR-KIQNWCLS 141

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
               +    Y HF   K    D  F ++               P ++
Sbjct: 142 SVFAE----YQHFAAAKARVSDQRFIELFDASNLKRYGHAWTHPHSS 184


>gi|330945302|ref|XP_003306532.1| hypothetical protein PTT_19698 [Pyrenophora teres f. teres 0-1]
 gi|311315927|gb|EFQ85376.1| hypothetical protein PTT_19698 [Pyrenophora teres f. teres 0-1]
          Length = 279

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 63/152 (41%), Gaps = 18/152 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AV+P  +YRS  P      +L KE GIK+IL L   +PE      +    + GIQ  
Sbjct: 97  NYGAVLPGCVYRSGYPKEENFGFL-KELGIKTILTL---VPEPISPAYQTFMKEAGIQHF 152

Query: 103 NFPLSAT----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +  + A     R  + E  + L  I+     P+L+HC  G  RTG   A +  ++     
Sbjct: 153 HAHIRANKGEVRIESCEMSRALRLIMDRTNHPILVHCNKGKHRTGCTIACFRRVL-GVDA 211

Query: 159 EEAHRQLSMLYGHFPVL--KTITMD-ITFEKI 187
           E    +      +      K   +D + FE  
Sbjct: 212 ETVREE------YHTYAGPKARFLDEVFFENF 237


>gi|125536422|gb|EAY82910.1| hypothetical protein OsI_38124 [Oryza sativa Indica Group]
          Length = 196

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 62/155 (40%), Gaps = 15/155 (9%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  +V   +YRS  P+     +L +  G++S++ L    PE + +   +  
Sbjct: 17  AMVVAPPSNFG-MVDTGVYRSGFPDPASFGFL-RGLGLRSVVYL---CPEPYMETNAEFL 71

Query: 95  NDLGIQLINFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVY 149
              GI+L  F +   ++       + I   +  IL     P+LIHCK G  RTG     +
Sbjct: 72  KAEGIRLFQFGIEGNKDPNVSIPVDAIMGALRVILDVRNHPVLIHCKRGKHRTGCLVGCF 131

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             +  ++       +    Y  +   K+   D+ F
Sbjct: 132 RKL-QNWCLSSVFEE----YHRYAAGKSRLSDLKF 161


>gi|225447153|ref|XP_002275443.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
          Length = 210

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 15/174 (8%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
            LV     L      + T   NF A+V + I+RS  P+     +L+   G++SI+ L   
Sbjct: 32  ALVAAGDELDRDGEELFTPPLNF-AMVDNGIFRSGFPDTANFAFLQT-LGLRSIIYL--- 86

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCK 136
            PE++ +   +     GI+L  F +   +E      ++ I++ + + L     PLLIHCK
Sbjct: 87  CPETYPEANNEFLKSNGIKLFQFGIEGYKEPFVNIPEDTIREALKVVLDVRNHPLLIHCK 146

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
            G  RTG        +   +       +    Y  F   K    D  F ++  +
Sbjct: 147 RGKHRTGCVVGCLRKL-QKWCLSSIFDE----YQRFAAAKARVSDQRFMELFDV 195


>gi|218889835|ref|YP_002438699.1| putative protein phosphatase [Pseudomonas aeruginosa LESB58]
 gi|218770058|emb|CAW25820.1| putative protein phosphatase [Pseudomonas aeruginosa LESB58]
          Length = 218

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 71/145 (48%), Gaps = 12/145 (8%)

Query: 26  CAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES 85
            A +    +      + N + + P  +YRSA PN   +  L++   +K++++        
Sbjct: 31  TAATRSPAWAQAVDPSINLYRMSP-TLYRSALPNAQNVALLQR-LQVKTVVSF------- 81

Query: 86  WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTG 143
              ++        +++++ P  A R ++D ++  ++  L+ A +  P+L+HCK G +RTG
Sbjct: 82  IKDDDRAWLGQAPVRVLSLPTHADR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTG 140

Query: 144 LASAVYLYIVAHYPKEEAHRQLSML 168
           L +A+Y  +V  + K+ A  ++   
Sbjct: 141 LFAAMYRIVVQGWDKQAALEEMQHG 165


>gi|319638663|ref|ZP_07993423.1| hypothetical protein HMPREF0604_01047 [Neisseria mucosa C102]
 gi|317400047|gb|EFV80708.1| hypothetical protein HMPREF0604_01047 [Neisseria mucosa C102]
          Length = 103

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 4/94 (4%)

Query: 101 LINFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           ++N PL +   +  ++I +++ +++       +LIHC  GADRTGL + +Y  I   +P 
Sbjct: 1   MLNRPLLS-WSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRIIYQGWPV 59

Query: 159 EEAHRQLSML-YGHFPVLKTITMDITFEKITQLY 191
           EEA  ++    YG+  + K I    T EK+ Q+ 
Sbjct: 60  EEAKAEMQHGPYGYHSIWKNIAKLFTEEKVKQVK 93


>gi|110833348|ref|YP_692207.1| hypothetical protein ABO_0487 [Alcanivorax borkumensis SK2]
 gi|110646459|emb|CAL15935.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 179

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 66/163 (40%), Gaps = 11/163 (6%)

Query: 12  LIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYG 71
           ++ YI I++ VL L                 +F  V   ++YRS       I  + +  G
Sbjct: 1   MLLYIAIVISVLALV-------IYRYRKLMYHFRVVERRKLYRSGTLGPIGIRIMHRILG 53

Query: 72  IKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
           + +I+NLR +       W+ ++       G++L+N P++      + QI   I  L  A 
Sbjct: 54  VNTIVNLRLESEYSKNGWYFKQLDYCRRHGVKLVNIPMAQDTPPTEAQIVAFIEELGRAD 113

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
              L+HC+ G  RTG+              E A  Q   LYGH
Sbjct: 114 SRCLVHCEMGVIRTGMMVVAVATRCYGVT-EMAVWQHFPLYGH 155


>gi|297599968|ref|NP_001048257.2| Os02g0771400 [Oryza sativa Japonica Group]
 gi|218191654|gb|EEC74081.1| hypothetical protein OsI_09102 [Oryza sativa Indica Group]
 gi|255671274|dbj|BAF10171.2| Os02g0771400 [Oryza sativa Japonica Group]
          Length = 204

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 64/155 (41%), Gaps = 15/155 (9%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  V    I+RS  P      +L     ++SI+ L    PE + +E  +  
Sbjct: 43  AAVLVPPLNFAEVNDG-IFRSGFPAADNFAFLLS-LKLRSIVYL---CPEPYPEENTRFL 97

Query: 95  NDLGIQLINFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVY 149
              GI+L  F +  ++E    + +E+I++ +  IL    +P+LIHCK G  RTG      
Sbjct: 98  EQNGIKLHQFGIDGSKELLVNIPEEKIREALKVILDVRNQPVLIHCKRGKHRTGCVVGCL 157

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             +   +       +    Y HF   K  + D  F
Sbjct: 158 RKL-QKWCLTSVFDE----YQHFAAAKARSTDQRF 187


>gi|49078204|gb|AAT49761.1| PA3885 [synthetic construct]
          Length = 219

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 71/145 (48%), Gaps = 12/145 (8%)

Query: 26  CAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES 85
            A +    +      + N + + P  +YRSA PN   +  L++   +K++++        
Sbjct: 31  TAATRSPAWAQAVDPSINLYRMSP-TLYRSALPNAQSVALLQR-LQVKTVVSF------- 81

Query: 86  WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTG 143
              ++        +++++ P  A R ++D ++  ++  L+ A +  P+L+HCK G +RTG
Sbjct: 82  IKDDDRAWLGQAPVRVLSLPTHADR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTG 140

Query: 144 LASAVYLYIVAHYPKEEAHRQLSML 168
           L +A+Y  +V  + K+ A  ++   
Sbjct: 141 LFAAMYRIVVQGWDKQAALEEMQHG 165


>gi|326496196|dbj|BAJ90719.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 214

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   IYRS  P      +L K   ++SI+ L    PE + +   +  +  GI+L 
Sbjct: 61  NF-AMVDDGIYRSGFPAAANFRFL-KSLNLRSIVYL---CPEPYPETNTEFLDKNGIKLH 115

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      DE+I++ + + L    +PLLIHCK G  RTG        +   + 
Sbjct: 116 QFGIEGRKEPFVEIPDEKIREALKVVLDVRNQPLLIHCKRGKHRTGCVVGCMRKL-QKWC 174

Query: 158 K 158
            
Sbjct: 175 L 175


>gi|15599080|ref|NP_252574.1| protein tyrosine phosphatase TpbA [Pseudomonas aeruginosa PAO1]
 gi|107103400|ref|ZP_01367318.1| hypothetical protein PaerPA_01004470 [Pseudomonas aeruginosa PACS2]
 gi|254236783|ref|ZP_04930106.1| hypothetical protein PACG_02796 [Pseudomonas aeruginosa C3719]
 gi|9950065|gb|AAG07272.1|AE004805_10 protein tyrosine phosphatase TpbA [Pseudomonas aeruginosa PAO1]
 gi|126168714|gb|EAZ54225.1| hypothetical protein PACG_02796 [Pseudomonas aeruginosa C3719]
          Length = 218

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 71/145 (48%), Gaps = 12/145 (8%)

Query: 26  CAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES 85
            A +    +      + N + + P  +YRSA PN   +  L++   +K++++        
Sbjct: 31  TAATRSPAWAQAVDPSINLYRMSP-TLYRSALPNAQSVALLQR-LQVKTVVSF------- 81

Query: 86  WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTG 143
              ++        +++++ P  A R ++D ++  ++  L+ A +  P+L+HCK G +RTG
Sbjct: 82  IKDDDRAWLGQAPVRVLSLPTHADR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTG 140

Query: 144 LASAVYLYIVAHYPKEEAHRQLSML 168
           L +A+Y  +V  + K+ A  ++   
Sbjct: 141 LFAAMYRIVVQGWDKQAALEEMQHG 165


>gi|156843057|ref|XP_001644598.1| hypothetical protein Kpol_1003p45 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115244|gb|EDO16740.1| hypothetical protein Kpol_1003p45 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 280

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 72/170 (42%), Gaps = 15/170 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +NF  VV  EIYRS+ P      YL+ +  +KSIL L   +PE +  E  +     GI+
Sbjct: 118 PENFSHVV-GEIYRSSFPRIENFPYLQNQLKLKSILVL---IPEEYPPENLEFLEKSGIR 173

Query: 101 LINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           L    +S  +E       + + + + I +     P+LIHC  G  RTG        +  +
Sbjct: 174 LYQVGMSGNKEPFVNIPSDLLTKALEIVINPENHPILIHCNRGKHRTGCLIGCIRKL-QN 232

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPM 204
           +       +    Y  F   K   +D  F E    +Y   V++ +T  P+
Sbjct: 233 WSLTMIFDE----YRRFAFPKARALDQQFIELYDDIYIKKVAEKNTWLPL 278


>gi|313109305|ref|ZP_07795272.1| putative protein phosphatase [Pseudomonas aeruginosa 39016]
 gi|310881774|gb|EFQ40368.1| putative protein phosphatase [Pseudomonas aeruginosa 39016]
          Length = 218

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 69/138 (50%), Gaps = 12/138 (8%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
            +      + N + + P  +YRSA PN   +  L++   +K++++           ++  
Sbjct: 38  AWAQAVDPSINLYRMSP-TLYRSALPNAQSVALLQR-LQVKTVVSF-------IKDDDRA 88

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYL 150
                 +++++ P  A R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y 
Sbjct: 89  WLGQAPVRVVSLPTHADR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYR 147

Query: 151 YIVAHYPKEEAHRQLSML 168
            +V  + K+ A  ++   
Sbjct: 148 IVVQGWDKQAALEEMQRG 165


>gi|116051921|ref|YP_789236.1| hypothetical protein PA14_13660 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296387597|ref|ZP_06877072.1| hypothetical protein PaerPAb_05562 [Pseudomonas aeruginosa PAb1]
 gi|115587142|gb|ABJ13157.1| putative protein phosphatase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 218

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 69/138 (50%), Gaps = 12/138 (8%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
            +      + N + + P  +YRSA PN   +  L++   +K++++           ++  
Sbjct: 38  AWAQAVDPSINLYRMSP-TLYRSALPNAQSVALLQR-LQVKTVVSF-------IKDDDRA 88

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYL 150
                 +++++ P  A R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y 
Sbjct: 89  WLGQAPVRVVSLPTHADR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYR 147

Query: 151 YIVAHYPKEEAHRQLSML 168
            +V  + K+ A  ++   
Sbjct: 148 IVVQGWDKQAALEEMQRG 165


>gi|152989083|ref|YP_001346608.1| hypothetical protein PSPA7_1223 [Pseudomonas aeruginosa PA7]
 gi|150964241|gb|ABR86266.1| hypothetical protein PSPA7_1223 [Pseudomonas aeruginosa PA7]
          Length = 218

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 67/128 (52%), Gaps = 12/128 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA PN   +  L++   +K++++           ++        I+++
Sbjct: 48  NLYRMSP-TLYRSALPNAQSVALLER-LQVKTVVSF-------IKDDDRAWLGQAPIRIV 98

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           + P  A R ++D ++  ++  L+ A +  P+L+HCK G +RTGL +A+Y  +V  + K+ 
Sbjct: 99  SLPTHADR-VDDTEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQA 157

Query: 161 AHRQLSML 168
           A  ++   
Sbjct: 158 ALEEMQRG 165


>gi|242066678|ref|XP_002454628.1| hypothetical protein SORBIDRAFT_04g034500 [Sorghum bicolor]
 gi|241934459|gb|EES07604.1| hypothetical protein SORBIDRAFT_04g034500 [Sorghum bicolor]
          Length = 223

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/159 (25%), Positives = 64/159 (40%), Gaps = 27/159 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P+     +L     ++SI+ L    PE + +E  +     GIQL 
Sbjct: 58  NF-AMVDDGIFRSGLPDAANFRFLLS-LNLRSIVYL---CPEPYPEENVQFLQQNGIQLH 112

Query: 103 NFPLSATRE----------------LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLA 145
            F +  ++                 + +E I++ +  IL    +P+LIHCK G  RTG  
Sbjct: 113 QFGIEGSKSGPTVPDTMLAQEPFVYIPEETIREALKVILDVRNQPVLIHCKRGKHRTGCV 172

Query: 146 SAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +   +       +    Y HF   K  + D  F
Sbjct: 173 VGCLRKL-QKWCLSSVFDE----YLHFAAAKARSTDQRF 206


>gi|224131688|ref|XP_002321153.1| predicted protein [Populus trichocarpa]
 gi|222861926|gb|EEE99468.1| predicted protein [Populus trichocarpa]
          Length = 214

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     +L+   G++SI+ L    PE + +   +   D GI+L 
Sbjct: 57  NF-AMVDNGIFRSGFPDSANFAFLQT-LGLRSIICL---CPEPYPEATTEFLKDGGIRLY 111

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      ++ I++ + + L     P+LIHCK G  RTG        +   + 
Sbjct: 112 QFGIEGYKEPFVNIPEDTIREALKVVLDAKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 170

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 171 LSSIFDE----YQRFAAAKARVSDQRFMELFDV 199


>gi|254412857|ref|ZP_05026630.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196180592|gb|EDX75583.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 150

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 63/123 (51%), Gaps = 3/123 (2%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +N   +  +    + Q     ++    + G+KS+LNLR +  E +  +E++ A   G+Q
Sbjct: 1   MENAKKINDNLTVATNQVTPEQLQQ-AAQAGVKSVLNLRSREEEGFASDEKQQAEAAGLQ 59

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            +N P+     L +E + Q++  ++  PKP LIHCKSG  R+G+ + +Y+        E+
Sbjct: 60  YVNIPVKP-DALTEELVSQVLQQIEELPKPALIHCKSGL-RSGMMALMYVATREGMTAEQ 117

Query: 161 AHR 163
           A  
Sbjct: 118 AME 120


>gi|254242576|ref|ZP_04935898.1| hypothetical protein PA2G_03330 [Pseudomonas aeruginosa 2192]
 gi|126195954|gb|EAZ60017.1| hypothetical protein PA2G_03330 [Pseudomonas aeruginosa 2192]
          Length = 218

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 71/145 (48%), Gaps = 12/145 (8%)

Query: 26  CAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES 85
            A +    +      + N + + P  +YRSA PN   +  L++   ++++++        
Sbjct: 31  TAATRSPAWAQAVDPSINLYRMSP-TLYRSALPNAQSVALLQR-LQVRTVVSF------- 81

Query: 86  WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK--PLLIHCKSGADRTG 143
              ++        +++++ P  A R ++D ++  ++  L+ A +  P+L+HCK G +RTG
Sbjct: 82  IKDDDRAWLGQAPVRVLSLPTHADR-VDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTG 140

Query: 144 LASAVYLYIVAHYPKEEAHRQLSML 168
           L +A+Y  +V  + K+ A  ++   
Sbjct: 141 LFAAMYRIVVQGWDKQAALEEMQHG 165


>gi|226506872|ref|NP_001149521.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|194689160|gb|ACF78664.1| unknown [Zea mays]
 gi|194695948|gb|ACF82058.1| unknown [Zea mays]
 gi|195627748|gb|ACG35704.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|224030357|gb|ACN34254.1| unknown [Zea mays]
          Length = 216

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF AVV   I+RS  P      +L K   ++SI+ L    PE +     +     GI+L 
Sbjct: 63  NF-AVVDDGIFRSGFPGTANFRFL-KSLNLRSIVYL---CPEPYPGTNTEFLEKNGIRLH 117

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D++I++ + + L    +PLLIHCK G  RTG        +   + 
Sbjct: 118 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTGCVVGCLRKL-QEWC 176

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 177 LSSVLDE----YHRFAAAKARITDQRFMELFDV 205


>gi|225560519|gb|EEH08800.1| tyrosine phosphatase [Ajellomyces capsulatus G186AR]
          Length = 254

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 63/147 (42%), Gaps = 15/147 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
             +NF  VV   +YRS+ P    ++ + +   +K+I+ L   + E W  +  +     GI
Sbjct: 44  LPENFAEVVQG-VYRSSFPLPVHLDSIAR-LNLKTIITL---VDEKWSPDYGEFIRKNGI 98

Query: 100 QLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           +    P+ A +        E + +++ I+      P+LIHC  G  RTG   A +  +  
Sbjct: 99  KSHVIPILANKAPQVSTPYETVIEVLKIILNPMNHPVLIHCNKGKHRTGCIIACFRRV-Q 157

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +    A ++    Y  +   K+  +D
Sbjct: 158 GWSLMAALQE----YQKYSTPKSRVLD 180


>gi|125596441|gb|EAZ36221.1| hypothetical protein OsJ_20540 [Oryza sativa Japonica Group]
          Length = 226

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +L K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 73  NF-AMVDDGIFRSGFPAAANFRFL-KSLNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 127

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D++I++ + + L    +PLLIHCK G  RTG        +   + 
Sbjct: 128 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTGCVVGCLRKL-QKWC 186

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K  + D  F ++  +
Sbjct: 187 LSSVFDE----YQGFAAAKARSTDQRFMELFDI 215


>gi|327350326|gb|EGE79183.1| tyrosine phosphatase [Ajellomyces dermatitidis ATCC 18188]
          Length = 255

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 15/147 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
             +NF  VV   +YRS+ P    ++ +     +K+I+ L   + E W ++  +   + GI
Sbjct: 44  LPENFAEVVKG-VYRSSFPLPVHLDSI-SRLNLKTIITL---VDEEWSRDYGEFIQENGI 98

Query: 100 QLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           +    P+ A +        +  I+ L+ IL     P+LIHC  G  RTG   A +  +  
Sbjct: 99  KSYVIPILANKNPLVFTPYETVIEVLMLILNPMNHPVLIHCNKGKHRTGCVIACFRRV-Q 157

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +    A ++    Y      K+  +D
Sbjct: 158 GWSLMAALQE----YQKHSTPKSRVLD 180


>gi|45187669|ref|NP_983892.1| ADL204Wp [Ashbya gossypii ATCC 10895]
 gi|44982430|gb|AAS51716.1| ADL204Wp [Ashbya gossypii ATCC 10895]
          Length = 217

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/155 (27%), Positives = 66/155 (42%), Gaps = 15/155 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +NF  VV  EIYRS+ P      +L++   ++SIL L   +PE +  E ++     GIQ
Sbjct: 55  PENFSPVV-GEIYRSSFPRPENFAFLQERVRLRSILVL---IPEEYPPENQEFVERAGIQ 110

Query: 101 LINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           L    +S  +E       + + + ++I L  A  P+LIHC  G  RTG        +  +
Sbjct: 111 LFQVGMSGNKEPFVNIPRDVLTRALAIALDPANHPILIHCNRGKHRTGCLVGCIRKL-QN 169

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITF-EKITQ 189
           +       +    Y  F   K   MD  F E    
Sbjct: 170 WSLTMIFDE----YRRFAFPKARAMDQQFIEMYED 200


>gi|240280078|gb|EER43582.1| tyrosine phosphatase [Ajellomyces capsulatus H143]
 gi|325088799|gb|EGC42109.1| tyrosine phosphatase [Ajellomyces capsulatus H88]
          Length = 254

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 63/147 (42%), Gaps = 15/147 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
             +NF  VV   +YRS+ P    ++ + +   +K+I+ L   + E W  +  +     GI
Sbjct: 44  LPENFAEVVQG-VYRSSFPLPVHLDSIAR-LNLKTIITL---VDEKWSPDYGEFIRKNGI 98

Query: 100 QLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           +    P+ A +        E + +++ I+      P+LIHC  G  RTG   A +  +  
Sbjct: 99  KSHVIPILANKAPQVSTPYETVIEVLKIILNPTNHPVLIHCNKGKHRTGCIIACFRRV-Q 157

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +    A ++    Y  +   K+  +D
Sbjct: 158 GWSLMAALQE----YQKYSTPKSRVLD 180


>gi|226493145|ref|NP_001150333.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|195638458|gb|ACG38697.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 222

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/159 (24%), Positives = 64/159 (40%), Gaps = 27/159 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P+     +L     ++S++ L    PE + +E  +     GIQL 
Sbjct: 57  NF-AMVDDGIFRSGLPDAGSFRFLLS-LNLRSVVYL---CPEPYPEENARFLQQNGIQLH 111

Query: 103 NFPLSATRE----------------LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLA 145
            F +  ++                 + +E I++ +  IL    +P+LIHCK G  RTG  
Sbjct: 112 QFGIEGSKSGSTVPDAMVVQEPFVYIPEETIREALKVILDARNQPVLIHCKRGKHRTGCV 171

Query: 146 SAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +   +       +    Y HF   K  + D  F
Sbjct: 172 VGCLRKL-QKWCLSSVFDE----YLHFAAAKARSTDQRF 205


>gi|239610794|gb|EEQ87781.1| tyrosine phosphatase [Ajellomyces dermatitidis ER-3]
          Length = 255

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/147 (23%), Positives = 62/147 (42%), Gaps = 15/147 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
             +NF  VV   +YRS+ P    ++ +     +K+I+ L   + E W  +  +   + GI
Sbjct: 44  LPENFAEVVKG-VYRSSFPLPVHLDSI-SRLNLKTIITL---VDEEWSHDYGEFIQENGI 98

Query: 100 QLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           +    P+ A +        +  I+ L+ IL     P+LIHC  G  RTG   A +  +  
Sbjct: 99  KSYVIPILANKNPLVFTPYETVIEVLMLILNPMNHPVLIHCNKGKHRTGCVIACFRRV-Q 157

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +    A ++    Y      K+  +D
Sbjct: 158 GWSLMAALQE----YQKHSTPKSRVLD 180


>gi|77554827|gb|ABA97623.1| tyrosine specific protein phosphatase family protein, putative,
           expressed [Oryza sativa Japonica Group]
          Length = 204

 Score =  111 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/163 (20%), Positives = 61/163 (37%), Gaps = 23/163 (14%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  +V   +YRS  P+     +L +  G++S++ L    PE + +   +  
Sbjct: 17  AMVVAPPSNFG-MVDTGVYRSGFPDPASFGFL-RGLGLRSVVYL---CPEPYMETNAEFL 71

Query: 95  NDLGIQLINFPLSATR------------ELNDEQIKQLIS-ILKTAPKPLLIHCKSGADR 141
              GI+L  F +   +             +  + I   +  IL     P+LIHCK G  R
Sbjct: 72  KAEGIRLFQFGIEGNKLCLTTGEEDPNVSIPVDAIMGALRVILDVRNHPVLIHCKRGKHR 131

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           TG     +  +  ++       +    Y      K+   D+ F
Sbjct: 132 TGCLVGCFRKL-QNWCLSSVFEE-YHRY---AAGKSRLSDLKF 169


>gi|50313187|gb|AAT74541.1| dual-specificity phosphatase protein [Oryza sativa]
          Length = 225

 Score =  111 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +L K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 72  NF-AMVDDGIFRSGFPAAANFRFL-KSLNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 126

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D++I++ + + L    +PLLIHCK G  RTG        +   + 
Sbjct: 127 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTGCVVGCLRKL-QKWC 185

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K  + D  F ++  +
Sbjct: 186 LSSVFDE----YQRFAAAKARSTDQRFMELFDI 214


>gi|115467010|ref|NP_001057104.1| Os06g0208700 [Oryza sativa Japonica Group]
 gi|113595144|dbj|BAF19018.1| Os06g0208700 [Oryza sativa Japonica Group]
 gi|125554494|gb|EAZ00100.1| hypothetical protein OsI_22103 [Oryza sativa Indica Group]
          Length = 226

 Score =  111 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +L K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 73  NF-AMVDDGIFRSGFPAAANFRFL-KSLNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 127

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D++I++ + + L    +PLLIHCK G  RTG        +   + 
Sbjct: 128 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTGCVVGCLRKL-QKWC 186

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K  + D  F ++  +
Sbjct: 187 LSSVFDE----YQRFAAAKARSTDQRFMELFDI 215


>gi|50308667|ref|XP_454336.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49643471|emb|CAG99423.1| KLLA0E08581p [Kluyveromyces lactis]
          Length = 274

 Score =  111 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 62/152 (40%), Gaps = 14/152 (9%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
               +NF  V   EIYRS+ P     E+L+    +KSIL L   +PE +  E  K   + 
Sbjct: 109 VIPPENFSHVC-GEIYRSSFPRPENFEFLRDRLKLKSILVL---IPEEYPAENMKFMEET 164

Query: 98  GIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           GI+L    +S  +E       + + + + + L     P+LIHC  G  RTG        +
Sbjct: 165 GIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENHPILIHCNRGKHRTGCLVGCIRKL 224

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             ++       +    Y  F   K   +D  F
Sbjct: 225 -QNWSLTMIFDE----YRRFAFPKVRALDQQF 251


>gi|238014192|gb|ACR38131.1| unknown [Zea mays]
          Length = 213

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +L K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 60  NF-AMVDDGIFRSGFPETANFRFL-KSLNLRSIVYL---CPEPYPETNTEFLEKNGIRLH 114

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D++I++ + + L    +PLLIHCK G  RTG        +   + 
Sbjct: 115 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTGCLVGCLRKL-QKWC 173

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 174 LSSVFDE----YHRFAAAKARITDQRFMELFDV 202


>gi|15220383|ref|NP_171993.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|73921030|sp|Q9ZVN4|Y1500_ARATH RecName: Full=Probable tyrosine-protein phosphatase At1g05000
 gi|4056425|gb|AAC97999.1| ESTs gb|H36249, gb|AA59732 and gb|AA651219 come from this gene
           [Arabidopsis thaliana]
 gi|28950701|gb|AAO63274.1| At1g05000 [Arabidopsis thaliana]
 gi|110736114|dbj|BAF00029.1| hypothetical protein [Arabidopsis thaliana]
 gi|332189656|gb|AEE27777.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana]
          Length = 215

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 63/153 (41%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V + I+RS  P+     +L+   G++SI+ L    PE + +   +     GI+L 
Sbjct: 58  NFS-MVDNGIFRSGFPDSANFSFLQT-LGLRSIIYL---CPEPYPESNLQFLKSNGIRLF 112

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D +I+  +  +L     P+LIHCK G  RTG        +   + 
Sbjct: 113 QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 171

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F +I  +
Sbjct: 172 LTSIFDE----YQRFAAAKARVSDQRFMEIFDV 200


>gi|297739217|emb|CBI28868.3| unnamed protein product [Vitis vinifera]
          Length = 155

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/149 (23%), Positives = 63/149 (42%), Gaps = 14/149 (9%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V + I+RS  P+     +L+   G++SI+ L    PE++ +   +     GI+L  F +
Sbjct: 1   MVDNGIFRSGFPDTANFAFLQT-LGLRSIIYL---CPETYPEANNEFLKSNGIKLFQFGI 56

Query: 107 SATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
              +E      ++ I++ + + L     PLLIHCK G  RTG        +   +     
Sbjct: 57  EGYKEPFVNIPEDTIREALKVVLDVRNHPLLIHCKRGKHRTGCVVGCLRKL-QKWCLSSI 115

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQL 190
             +    Y  F   K    D  F ++  +
Sbjct: 116 FDE----YQRFAAAKARVSDQRFMELFDV 140


>gi|226499936|ref|NP_001151744.1| LOC100285379 [Zea mays]
 gi|195649459|gb|ACG44197.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 213

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P      +L K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 60  NF-AMVDDGIFRSGFPETANFRFL-KSLNLRSIVYL---CPEPYPETNTEFLEKNGIRLH 114

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D++I++ + + L    +PLLIHCK G  RTG        +   + 
Sbjct: 115 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTGCLVGCLRKL-QKWC 173

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 174 LSSVFDE----YHRFAAAKARITDQRFMELFDV 202


>gi|56554689|pdb|1XRI|A Chain A, X-Ray Structure Of A Putative Phosphoprotein Phosphatase
           From Arabidopsis Thaliana Gene At1g05000
 gi|56554690|pdb|1XRI|B Chain B, X-Ray Structure Of A Putative Phosphoprotein Phosphatase
           From Arabidopsis Thaliana Gene At1g05000
 gi|150261477|pdb|2Q47|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of A
           Putative Phosphoprotein Phosphatase From Arabidopsis
           Thaliana Gene At1g05000
 gi|150261478|pdb|2Q47|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of A
           Putative Phosphoprotein Phosphatase From Arabidopsis
           Thaliana Gene At1g05000
          Length = 151

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 62/153 (40%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V  + I+RS  P+     +L+   G++SI+ L    PE + +   +     GI+L 
Sbjct: 7   NFSXV-DNGIFRSGFPDSANFSFLQT-LGLRSIIYL---CPEPYPESNLQFLKSNGIRLF 61

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D +I+  +  +L     P+LIHCK G  RTG        +   + 
Sbjct: 62  QFGIEGNKEPFVNIPDHKIRXALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 120

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F +I  +
Sbjct: 121 LTSIFDE----YQRFAAAKARVSDQRFXEIFDV 149


>gi|300176786|emb|CBK25355.2| unnamed protein product [Blastocystis hominis]
          Length = 264

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 48/163 (29%), Positives = 70/163 (42%), Gaps = 15/163 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             NF AV+   +YRSA P      +L K  GI+SIL L   +PE + ++  K      I+
Sbjct: 25  PTNF-AVIEKGLYRSAFPVKRNFPFL-KHLGIRSILVL---VPEDYPEDSLKFMKRFDIK 79

Query: 101 LINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           L  FPL   +E      +E + Q++ I L T   PLLIHC SG  RTG        I   
Sbjct: 80  LFKFPLEGNKEPFTEIPEEMVIQIMHIVLDTRNLPLLIHCNSGKHRTGSVVGCIRRI-QG 138

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
           +        +   Y  +   K   MD  + ++  +   N  + 
Sbjct: 139 WSLSS----IFWEYRFYAEPKPRFMDQQYIELFDINKVNPDRE 177


>gi|115478090|ref|NP_001062640.1| Os09g0135700 [Oryza sativa Japonica Group]
 gi|47848431|dbj|BAD22288.1| putative tyrosine specific protein phosphatase protein [Oryza
           sativa Japonica Group]
 gi|113630873|dbj|BAF24554.1| Os09g0135700 [Oryza sativa Japonica Group]
 gi|215768452|dbj|BAH00681.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218201709|gb|EEC84136.1| hypothetical protein OsI_30482 [Oryza sativa Indica Group]
 gi|222641097|gb|EEE69229.1| hypothetical protein OsJ_28466 [Oryza sativa Japonica Group]
          Length = 222

 Score =  111 bits (277), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 71/153 (46%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V H +YRS  P+ + + +++    ++S+L L    PE + +  ++     GI+L 
Sbjct: 68  NF-AMVDHGVYRSGFPDISNLPFVES-LRLRSVLCL---CPEPYPEANQEFLRAHGIRLF 122

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +  ++E      +++I++ + + L  A  P+LIHCK G  RTG        +   + 
Sbjct: 123 QFGIDGSKEPFVNIPEDRIREALKVVLDVANHPVLIHCKRGKHRTGCVVGCLRKL-QRWC 181

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D+ F ++  +
Sbjct: 182 LTSIFDE----YQRFAAAKARVSDLRFMELFDI 210


>gi|71744982|ref|XP_827121.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70831286|gb|EAN76791.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 321

 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 11/123 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF  V P  +YRS  P      +++   G+++I+ L    PE + +   K   + GI 
Sbjct: 18  TINFAMVCPG-VYRSGYPTRKNYRFIRA-LGLRTIIYL---CPEDYAESNVKFCEESGIT 72

Query: 101 LINFPLSATREL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           +  F     +E     ++  + +++ +++ T   P+LIHC  G  RTG  +A    +   
Sbjct: 73  IRRFATEGNKEPFMDISEPLMHRILSALIDTRLHPVLIHCNKGKHRTGTVAACLRLL-QG 131

Query: 156 YPK 158
           +  
Sbjct: 132 WSL 134


>gi|168053205|ref|XP_001779028.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669590|gb|EDQ56174.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 182

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 67/163 (41%), Gaps = 15/163 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   +YRS  PN   + +L+K   ++S++ L    PE + +   +     GI++ 
Sbjct: 13  NF-AMVDKGVYRSGYPNKKNLPFLQK-LRLRSVVYL---CPEPYPEANIEFMEKNGIKMF 67

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +F +   +E      +  I+  +  +L    +P+LIHC  G  RTG         V ++ 
Sbjct: 68  HFGIEGNKEPFVDIPENVIRDALKVLLDVKNQPILIHCNKGKHRTGCLVGCLR-KVQNWS 126

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
                 +    Y  F   K   +D  F ++  +     +    
Sbjct: 127 LTSIFDE----YRRFAGAKVRMLDQQFMELFDISTFKQTGRTW 165


>gi|328871698|gb|EGG20068.1| putative protein tyrosine phosphatase [Dictyostelium fasciculatum]
          Length = 313

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/154 (27%), Positives = 64/154 (41%), Gaps = 15/154 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN     +LKK  G+KSIL L    PE + +         GI+L+
Sbjct: 158 NFSMVSSG-VYRSGYPNKKNHPFLKK-LGLKSILYL---CPEEYSESNTNFIRKNGIKLL 212

Query: 103 NFPLSATREL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           ++ +   +E      DE I+  +  +L     P+LIHC  G  RTG        +   + 
Sbjct: 213 HYRIVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCVVGCLRKL-QKWS 271

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLY 191
                 +    Y  F   K   +D  F ++ +L 
Sbjct: 272 YTYIFDE----YRRFAGSKVRVLDQQFIELFKLE 301


>gi|195642742|gb|ACG40839.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 220

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/159 (24%), Positives = 64/159 (40%), Gaps = 27/159 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   I+RS  P+     +L     ++SI+ L    PE + +E  +     GI+L 
Sbjct: 54  NF-AMVDDGIFRSGLPDAANFRFLLS-LNLRSIVYL---CPEPYPEENARFLRTNGIRLH 108

Query: 103 NFPLSATR----------------ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLA 145
            F +  ++                 + +E I++ + + L    +P+LIHCK G  RTG  
Sbjct: 109 QFAVEGSKSGPTVLDTMSAQEPFVHIPEETIREALKVVLDVRNQPVLIHCKRGKHRTGCV 168

Query: 146 SAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +   +       +    Y HF   K  T D  F
Sbjct: 169 VGCLRKL-QKWCLSSVFDE----YLHFAAAKARTTDQRF 202


>gi|303316502|ref|XP_003068253.1| Putative tyrosine phosphatase family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240107934|gb|EER26108.1| Putative tyrosine phosphatase family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320038022|gb|EFW19958.1| tyrosine-protein phosphatase SIW14 [Coccidioides posadasii str.
           Silveira]
          Length = 274

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 61/150 (40%), Gaps = 15/150 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P     E +KK   +K+I+ L   +     ++ +K   D GI
Sbjct: 60  LPANFAEVVSG-IYRSSFPLPDHFESIKK-LNLKTIVTL---VENEHSRQFKKFIKDNGI 114

Query: 100 QLINFPLSATRELND----EQIKQLISILKTA-PKPLLIHCKSGADRTGLASAVYLYIVA 154
                P+ A ++         + +++ IL      P+L+HC  G  RTG   A +     
Sbjct: 115 TSYVIPIIANKDPKVFTSQNTVLEVLRILFNLDNHPVLVHCNKGKHRTGCIIACFRRA-Q 173

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
            +    A  +    Y  +   KT  +D  F
Sbjct: 174 GWSNTAAVAE----YIKYSAPKTRVLDRKF 199


>gi|297843300|ref|XP_002889531.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297335373|gb|EFH65790.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 215

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 60/147 (40%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V + I+RS  P+     +L+   G++SI+ L    PE + +   +     GI+L 
Sbjct: 58  NFS-MVDNGIFRSGFPDSANFSFLQT-LGLRSIIYL---CPEPYTESNLQFLKSNGIRLF 112

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      D +I+  +  +L     P+LIHCK G  RTG        +   + 
Sbjct: 113 QFGIEGNKEPFVNIPDRKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 171

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +    Y  F   K    D  F
Sbjct: 172 LTSIFDE----YQRFAAAKARVSDQRF 194


>gi|50294460|ref|XP_449641.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528955|emb|CAG62617.1| unnamed protein product [Candida glabrata]
          Length = 280

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 72/181 (39%), Gaps = 15/181 (8%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE 89
           L L   +  T  +NF  VV  EIYRS+ P      +L+K   +KSIL L   +PE + +E
Sbjct: 107 LLLSCDSEVTPPENFSHVV-GEIYRSSFPRTENFAFLQKRLKLKSILVL---IPEEYPQE 162

Query: 90  EEKAANDLGIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGL 144
                    I+L    +S  +E       + + + + + L    +P+LIHC  G  RTG 
Sbjct: 163 NLDFMEKANIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCNRGKHRTGC 222

Query: 145 ASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQP 203
                  +   +       +    Y  F   K   +D  F E        +++  +   P
Sbjct: 223 LIGCIRKL-QSWSLTMIFDE----YRRFAFPKARALDQQFIEMYDDDKIKSIATQNKWLP 277

Query: 204 M 204
           +
Sbjct: 278 L 278


>gi|261331354|emb|CBH14348.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 321

 Score =  109 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 11/123 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF  V P  +YRS  P      +++   G+++I+ L    PE + +   K   + GI 
Sbjct: 18  TINFAMVCPG-VYRSGYPTRKNYRFIRA-LGLRTIIYL---CPEDYAESNVKFCEESGIT 72

Query: 101 LINFPLSATREL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           +  F     +E     ++  + +++ +++ T   P+LIHC  G  RTG  +A    +   
Sbjct: 73  IRRFATEGNKEPFMDISEPLMHRILSALIDTRLHPVLIHCNKGKHRTGTVAACLRLL-QG 131

Query: 156 YPK 158
           +  
Sbjct: 132 WSL 134


>gi|255587792|ref|XP_002534397.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
 gi|223525370|gb|EEF27985.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
          Length = 212

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 62/153 (40%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V + I+RS  P+     +L+    ++SI+ L    PE + +   +     GI L 
Sbjct: 55  NFS-MVDNGIFRSGFPDSANFSFLQT-LELRSIICL---CPEPYPELNTEFLKANGITLF 109

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      ++ I++ + + L     P+L+HCK G  RTG        +   + 
Sbjct: 110 QFGIEGYKEPFVNIPEDMIREALKVVLDVRNHPVLVHCKRGKHRTGCVVGCLRKL-QRWC 168

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 169 LTSIFDE----YQRFAAAKARVSDQRFMELFDV 197


>gi|328771796|gb|EGF81835.1| hypothetical protein BATDEDRAFT_34606 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 263

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 72/167 (43%), Gaps = 17/167 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF+ V P  IYRSA P      +LKK  G++SIL L   + E +  +  K  +D  I L
Sbjct: 98  ENFNLVAPG-IYRSAFPKKRNFSFLKK-LGLRSILTL---ILEDYPDQNRKFLDDNNIHL 152

Query: 102 INFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F ++  +E      +E +   +S I+     PLLIHC  G  RTG         + H+
Sbjct: 153 FQFGVAGNKEPFVDIPEETVCAALSVIMDERNHPLLIHCNKGKHRTGCLVGCLR-KMQHW 211

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
                  +    Y  F   K+ +MD  F  I     +NVS      P
Sbjct: 212 SMTSIFDE----YRRFSHPKSRSMDQQF--IELFETHNVSIDIAHLP 252


>gi|18412419|ref|NP_567261.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|17981661|gb|AAL51114.1|AF458342_1 AT4g03960/T24M8_4 [Arabidopsis thaliana]
 gi|15810022|gb|AAL06938.1| AT4g03960/T24M8_4 [Arabidopsis thaliana]
 gi|21555065|gb|AAM63767.1| contains similarity to C3HC4-type zinc fingers [Arabidopsis
           thaliana]
 gi|26452426|dbj|BAC43298.1| unknown protein [Arabidopsis thaliana]
 gi|332656961|gb|AEE82361.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
          Length = 198

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 67/153 (43%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P      +L+    +KSI+ L    PE++ +   + A   GIQ+ 
Sbjct: 34  NF-AMVDNGIFRSGFPEPVSFSFLQS-LRLKSIIYL---CPEAYPEVNREFAKSNGIQVF 88

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      DE I++ +  +L T   P+LIHCKSG  RTG        I   + 
Sbjct: 89  QFGIERCKEPFVNIPDEVIREALQVLLDTENHPVLIHCKSGKHRTGCLVGCVRKI-QRWC 147

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 148 LSSIFDE----YQRFAAAKARISDQRFMELFDI 176


>gi|169603942|ref|XP_001795392.1| hypothetical protein SNOG_04979 [Phaeosphaeria nodorum SN15]
 gi|111066250|gb|EAT87370.1| hypothetical protein SNOG_04979 [Phaeosphaeria nodorum SN15]
          Length = 278

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 8/118 (6%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             N+ AV+P  IYRS+ P     E++ K+  IKSIL L   +PE    E +   +  GIQ
Sbjct: 95  PSNYGAVLPGLIYRSSYPEQKNYEFI-KDLKIKSILTL---VPEPISAEYQDFMDKSGIQ 150

Query: 101 LINFPLSAT----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                + A     R  + E  + L  I+     P+LIHC  G  RTG   A +  I+ 
Sbjct: 151 HFQVHIKANKGEVRVESCEMSRALRLIMDRTNHPILIHCNKGKHRTGCTVACFRRIIG 208


>gi|224064882|ref|XP_002301598.1| predicted protein [Populus trichocarpa]
 gi|222843324|gb|EEE80871.1| predicted protein [Populus trichocarpa]
          Length = 208

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     +L+   G++SI+ L    PE + +   +   D GI+L 
Sbjct: 51  NF-AMVDNGIFRSGFPDSVNFSFLQT-LGLRSIICL---CPEPYTEATTEFLKDGGIRLY 105

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F + + +E       + I++ + + L     P+LIHCK G  RTG        +   + 
Sbjct: 106 QFGIESYKEPFVNIPQDTIREALQVVLDVKNHPILIHCKRGKHRTGCLVGCLRKL-QKWC 164

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F V K    D  F ++  +
Sbjct: 165 LSSIFDE----YQRFAVAKARISDQRFMELFDV 193


>gi|154315986|ref|XP_001557315.1| hypothetical protein BC1G_04565 [Botryotinia fuckeliana B05.10]
 gi|150846961|gb|EDN22154.1| hypothetical protein BC1G_04565 [Botryotinia fuckeliana B05.10]
          Length = 314

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  + P+ IYRS+ P     EYL    G+KSI+ L   + + +  E        GI+  
Sbjct: 128 NFGVIAPNAIYRSSFPQQEDFEYL-GTLGLKSIVTL---VKKDFPPEFLAFMEAHGIRHY 183

Query: 103 NFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
              +  T+  ++ +  + Q++ I L     PLLIHC  G  RTG A+A+  ++ + +  +
Sbjct: 184 VIEMQGTKKVDIPEHIMNQIMRISLDKENHPLLIHCNHGKHRTGCAAAIIRHV-SGWNVQ 242

Query: 160 EAHRQ 164
               +
Sbjct: 243 SIVEE 247


>gi|224118160|ref|XP_002331572.1| predicted protein [Populus trichocarpa]
 gi|222873796|gb|EEF10927.1| predicted protein [Populus trichocarpa]
          Length = 207

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     +L+   G++SIL L    PE + +   +   D GI++ 
Sbjct: 46  NF-AMVDNGIFRSGFPDSANFSFLQS-LGLRSILYL---CPEPYPEANYEFLKDNGIRIF 100

Query: 103 NFPLSATRE----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E    + +E I++ +  IL     P+L+HCK G  RTG        +   + 
Sbjct: 101 QFGIEMCKESFANIPEETIREALKVILDVKNHPVLVHCKRGKHRTGCLVGCLRKL-QRWC 159

Query: 158 K 158
            
Sbjct: 160 L 160


>gi|156059848|ref|XP_001595847.1| hypothetical protein SS1G_03937 [Sclerotinia sclerotiorum 1980]
 gi|154701723|gb|EDO01462.1| hypothetical protein SS1G_03937 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 303

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  + P+ IYRS+ P     EYL +  G+KSI+ L   + + +           GI+  
Sbjct: 117 NFGVIAPNAIYRSSFPQQEDFEYL-RSLGLKSIVTL---VKKEYPPGFLAFIEAQGIRHY 172

Query: 103 NFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
              +  T+  ++ +  + Q++ I L     PLLIHC  G  RTG A+A+  ++ + +  +
Sbjct: 173 VIEMQGTKKVDIPEHIMNQIMRISLDKENHPLLIHCNHGKHRTGCAAAIIRHV-SGWDVK 231

Query: 160 EAHRQ 164
               +
Sbjct: 232 SIVEE 236


>gi|50408578|ref|XP_456793.1| DEHA2A10582p [Debaryomyces hansenii CBS767]
 gi|49652457|emb|CAG84762.1| DEHA2A10582p [Debaryomyces hansenii]
          Length = 270

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/172 (27%), Positives = 77/172 (44%), Gaps = 16/172 (9%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P  +   ++KK   +KSIL L   +PE + +E E+      
Sbjct: 106 TPPENFAPVI-NKIYRSSFPQPSNFPFVKK-LKLKSILCL---IPEDYPEEHEQFLEKEN 160

Query: 99  IQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           I+L    +S  +E     +   I + I I L  A +P+LIHC  G  RTG    V   + 
Sbjct: 161 IKLFQLGMSGNKEPFVKISHNLITEAIKIVLNPANQPILIHCNRGKHRTGCLVGVLRRL- 219

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPM 204
             +       +    Y  F   K   MD  F E   ++     +K ++  P+
Sbjct: 220 QKWSLTIIFDE----YRKFAAPKERPMDQQFIELYNEVELEEYAKENSLLPI 267


>gi|2702271|gb|AAB91974.1| unknown protein [Arabidopsis thaliana]
          Length = 218

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 17/149 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V + I+RS  P+     ++ K  G++SI++L    PE + +   +     GI L 
Sbjct: 59  NFS-MVDNGIFRSGFPDSANFSFI-KTLGLRSIISL---CPEPYPENNMQFLKSNGISLF 113

Query: 103 NFPLSATR------ELNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            F +  ++      ++ D++I++ +  +L     PLLIHCK G  RTG        +   
Sbjct: 114 QFGIEGSKSKEPFVDILDQKIREALKVLLDEKNHPLLIHCKRGKHRTGCLVGCMRKL-QK 172

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           +       +    Y  F   K    D  F
Sbjct: 173 WCITSILDE----YKRFAAAKARVSDQRF 197


>gi|302661320|ref|XP_003022329.1| tyrosine phosphatase family protein [Trichophyton verrucosum HKI
           0517]
 gi|291186269|gb|EFE41711.1| tyrosine phosphatase family protein [Trichophyton verrucosum HKI
           0517]
          Length = 267

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/164 (25%), Positives = 65/164 (39%), Gaps = 18/164 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E      D GI
Sbjct: 55  MPNNFAEVVKG-IYRSSFPLPVHLSSL-AQLNLKTIVTL---VDEEWSPEYSSFVRDNGI 109

Query: 100 QLINFPLSATRELND----EQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                P+ A ++ N       I ++++IL  T   P+++HC  G  RTG   A +     
Sbjct: 110 TSRIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACFRKA-Q 168

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
            +    A  +    Y +    KT T+D       Q +  N    
Sbjct: 169 GWTSVAAIAE----YIYHSAPKTRTLD---RNYIQEFDENTVAD 205


>gi|297809583|ref|XP_002872675.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297318512|gb|EFH48934.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 198

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/153 (27%), Positives = 67/153 (43%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P      +L+    ++SI+ L    PE++ +   + A   GIQ+ 
Sbjct: 34  NF-AMVDNGIFRSGFPEPVSFSFLQS-LRLRSIIYL---CPEAYPEVNREFAKSNGIQVF 88

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      DE I++ +  +L T   P+LIHCKSG  RTG        I   + 
Sbjct: 89  QFGIERCKEPFVNIPDEVIREALQVLLDTKNHPVLIHCKSGKHRTGCLVGCVRKI-QRWC 147

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 148 LSSIFDE----YQRFAAAKARISDQRFMELFDI 176


>gi|296414265|ref|XP_002836823.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295631662|emb|CAZ81014.1| unnamed protein product [Tuber melanosporum]
          Length = 188

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 54/138 (39%), Gaps = 14/138 (10%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             +YRS+ P      YL+ E  +KSI+ L   + E+   E  +     GI+     +   
Sbjct: 6   GFVYRSSFPKPENFPYLQ-ELKLKSIITL---VSETHPAENNEFMRQNGIKHFQIGMPGN 61

Query: 110 REL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           +      +DE+I   + I+      P+LIHC  G  RTG         V  +       +
Sbjct: 62  KVPFVNFSDEKISTALRIILDRRNHPILIHCNKGKHRTGCVVGCLR-KVQAWSLTLILDE 120

Query: 165 LSMLYGHFPVLKTITMDI 182
               Y HF   K+  +D 
Sbjct: 121 ----YRHFAGPKSRALDQ 134


>gi|225430987|ref|XP_002278743.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147766881|emb|CAN67527.1| hypothetical protein VITISV_002127 [Vitis vinifera]
 gi|297735279|emb|CBI17641.3| unnamed protein product [Vitis vinifera]
          Length = 202

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 65/166 (39%), Gaps = 15/166 (9%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP 83
           +   +  G+    +     NF  +V   I+RS  P+     +L+    ++SI+ L    P
Sbjct: 1   MGLMLENGVANDAVYVPPSNFS-MVEENIFRSGLPSPINFPFLET-LNLRSIIYL---CP 55

Query: 84  ESWHKEEEKAANDLGIQLINFPLSATRELND----EQIKQLIS-ILKTAPKPLLIHCKSG 138
           E + +E  K      I+L  F +   +E       + I + +  ++     P+LIHCK G
Sbjct: 56  EPYPEENCKFLQSQNIRLFQFGIEGKKEPPVAMSTDTISEALKVLMDVRNHPILIHCKRG 115

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             RTG        +  ++       +    Y  F   K+   D+ F
Sbjct: 116 KHRTGCLVGCLRKL-QNWCLSSVVEE----YQRFAGAKSRINDLKF 156


>gi|154278639|ref|XP_001540133.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150413718|gb|EDN09101.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 264

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 63/147 (42%), Gaps = 15/147 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
             +NF  VV   +YRS+ P    ++ + +   +K+I+ L   + E W  +  +     GI
Sbjct: 54  LPENFAEVVQG-VYRSSFPLPVHLDSIAR-LNLKTIVTL---VDEKWSPDYGEFIRKNGI 108

Query: 100 QLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           +    P+ A +        E + +++ I+      P+LIHC  G  RTG   A +  +  
Sbjct: 109 KSHVIPILANKAPQVSTPYETVIEVLKIILNPTNHPVLIHCNKGKHRTGCIIACFRRV-Q 167

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +    + ++    Y  +   K+  +D
Sbjct: 168 GWSLMASLQE----YQKYSTPKSRVLD 190


>gi|79387510|ref|NP_186929.2| phosphatase/ phosphoprotein phosphatase/ protein tyrosine
           phosphatase [Arabidopsis thaliana]
 gi|51969092|dbj|BAD43238.1| unknown protein [Arabidopsis thaliana]
 gi|332640340|gb|AEE73861.1| tyrosine specific protein phosphatase-like protein [Arabidopsis
           thaliana]
          Length = 203

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 49/133 (36%), Gaps = 11/133 (8%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +     NF  V    IYRS  P      +L K   ++SI+ L    PE + +E  K    
Sbjct: 14  VLAPPSNFSMVEDG-IYRSGFPRPENFSFL-KTLNLRSIIYL---CPEPYPEENLKFLEA 68

Query: 97  LGIQLINFPLSATRELN----DEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLY 151
             I+L  F +    +       + +   + +L      P+LIHCK G  RTG        
Sbjct: 69  NNIKLYQFGIEGKTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTGCLVGCLR- 127

Query: 152 IVAHYPKEEAHRQ 164
            V  +       +
Sbjct: 128 KVQSWCLSSVLEE 140


>gi|6728982|gb|AAF26980.1|AC018363_25 unknown protein [Arabidopsis thaliana]
 gi|34365627|gb|AAQ65125.1| At3g02800 [Arabidopsis thaliana]
          Length = 199

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 49/133 (36%), Gaps = 11/133 (8%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +     NF  V    IYRS  P      +L K   ++SI+ L    PE + +E  K    
Sbjct: 10  VLAPPSNFSMVEDG-IYRSGFPRPENFSFL-KTLNLRSIIYL---CPEPYPEENLKFLEA 64

Query: 97  LGIQLINFPLSATRELN----DEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLY 151
             I+L  F +    +       + +   + +L      P+LIHCK G  RTG        
Sbjct: 65  NNIKLYQFGIEGKTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTGCLVGCLR- 123

Query: 152 IVAHYPKEEAHRQ 164
            V  +       +
Sbjct: 124 KVQSWCLSSVLEE 136


>gi|154331856|ref|XP_001561745.1| tyrosine phosphatase [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134059065|emb|CAM41538.1| putative tyrosine phosphatase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 287

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 11/123 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + G+ 
Sbjct: 14  TINFSMVCPG-VYRSGYPTKKNFSFLSA-LRLRSILYL---CPEDYAESNLKFCEENGVH 68

Query: 101 LINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           ++ FP    +E     ++  + +++S +  T   PLLIHC  G  RTG   A   ++   
Sbjct: 69  VLRFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QG 127

Query: 156 YPK 158
           +  
Sbjct: 128 WSL 130


>gi|66808551|ref|XP_637998.1| hypothetical protein DDB_G0285909 [Dictyostelium discoideum AX4]
 gi|60466434|gb|EAL64489.1| hypothetical protein DDB_G0285909 [Dictyostelium discoideum AX4]
          Length = 181

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 11/120 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V   +YRS  PN     +LKK  G+KSIL L    PE + +         GI+L+
Sbjct: 24  NFS-MVSRGVYRSGYPNKKNHPFLKK-LGLKSILYL---CPEEYSESNTNFIRKHGIKLL 78

Query: 103 NFPLSATREL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           ++ +   +E      DE I+  +  +L     P+LIHC  G  RTG        +   + 
Sbjct: 79  HYRIVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCLVGCLRKL-QKWS 137


>gi|281204785|gb|EFA78980.1| putative protein tyrosine phosphatase [Polysphondylium pallidum
           PN500]
          Length = 178

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/154 (27%), Positives = 65/154 (42%), Gaps = 15/154 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V   +YRS  PN     +LKK  G+KSIL L    PE + +         GI+L+
Sbjct: 23  NFS-MVSRGVYRSGYPNKKNHPFLKK-LGLKSILYL---CPEEYSESNTNFIRKHGIKLL 77

Query: 103 NFPLSATREL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           ++ +   +E      DE I+  +  +L     P+LIHC  G  RTG        +   + 
Sbjct: 78  HYRIVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCLVGCLRKL-QKWS 136

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLY 191
                 +    Y  F   K   +D  F ++ +L 
Sbjct: 137 YTYIFDE----YRRFAGSKVRVLDQQFIELFKLE 166


>gi|225469129|ref|XP_002273080.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 210

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 64/153 (41%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   ++RS  P+     +L+   G++SI+ L    PE + +   +     GI+L 
Sbjct: 50  NF-AMVDCGVFRSGFPDTANFTFLQT-LGLRSIIYL---CPEPYPEPNIEFLKCNGIRLF 104

Query: 103 NFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      ++ I++ + + L     PLLIHCK G  RTG        +   + 
Sbjct: 105 QFGIDGCKEPFVNIPEDTIREALKVVLDKRNHPLLIHCKRGKHRTGCLVGCLRKL-QRWC 163

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 164 LSSIFDE----YQRFAAAKARISDQRFMELFDI 192


>gi|149194664|ref|ZP_01871759.1| hypothetical protein CMTB2_04767 [Caminibacter mediatlanticus TB-2]
 gi|149135087|gb|EDM23568.1| hypothetical protein CMTB2_04767 [Caminibacter mediatlanticus TB-2]
          Length = 166

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 71/129 (55%), Gaps = 3/129 (2%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
              +E + K+Y IKS+LNLRG+     +  EE+    LG++     +S+    + E++++
Sbjct: 2   PWNLEKIIKKYDIKSVLNLRGRGNY-LYDLEEEICKKLGVEYKVITISSRVLPSYEKLEE 60

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTI 178
           L++ LK + KPLL HCK+GADRTG  + ++ +++     + A  ++L +   +  + K  
Sbjct: 61  LVNYLKNSKKPLLFHCKAGADRTGFVAVLW-HVLQGRDVKWAVKKELKLSKAYISLSKAG 119

Query: 179 TMDITFEKI 187
            +   F K 
Sbjct: 120 RVKKMFLKY 128


>gi|326469879|gb|EGD93888.1| hypothetical protein TESG_01419 [Trichophyton tonsurans CBS 112818]
 gi|326479102|gb|EGE03112.1| tyrosine phosphatase [Trichophyton equinum CBS 127.97]
          Length = 265

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 40/147 (27%), Positives = 62/147 (42%), Gaps = 15/147 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E      D GI
Sbjct: 53  MPNNFAEVVKG-IYRSSFPMPVHLSSL-AQLNLKTIVTL---VEEEWSPEYSAFVRDKGI 107

Query: 100 QLINFPLSATRELND----EQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                P+ A ++ N       I ++++IL  T   P+++HC  G  RTG   A +     
Sbjct: 108 TSRIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACFRKA-Q 166

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +    A  +    Y +    KT T+D
Sbjct: 167 GWTSVAAIAE----YIYHSAPKTRTLD 189


>gi|327294633|ref|XP_003232012.1| hypothetical protein TERG_07628 [Trichophyton rubrum CBS 118892]
 gi|326465957|gb|EGD91410.1| hypothetical protein TERG_07628 [Trichophyton rubrum CBS 118892]
          Length = 265

 Score =  107 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 64/164 (39%), Gaps = 18/164 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E      D GI
Sbjct: 53  MPNNFAEVVKG-IYRSSFPMPVHLSSL-AQLNLKTIVTL---VEEEWSPEYSAFVRDKGI 107

Query: 100 QLINFPLSATRELND----EQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                P+ A ++ N       I ++++IL  T   P+++HC  G  RTG   A +     
Sbjct: 108 TSRIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCIMACFRKA-Q 166

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
            +    A  +    Y +    KT T+D       Q +       
Sbjct: 167 GWTSVAAIAE----YIYHSAPKTRTLD---RNYIQEFDEGTVAD 203


>gi|87162589|gb|ABD28384.1| Tyrosine specific protein phosphatase and dual specificity protein
           phosphatase; Putative tyrosine phosphatase [Medicago
           truncatula]
          Length = 202

 Score =  107 bits (268), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 66/147 (44%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V   IYRS+ P  +   +L+    ++SI+ L    PE + +E      +  I+L 
Sbjct: 22  NFS-MVEDCIYRSSLPKPSSFPFLQT-LNLRSIIYL---CPEPYPEENLDFLKEQNIRLF 76

Query: 103 NFPLSATRELN----DEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    E++     + I + + +L      P+L+HCK G  RTG     +  +  ++ 
Sbjct: 77  QFGIEGKTEVSLPALRDSIMEALKVLVDVRNHPILVHCKQGKHRTGCLVGCFRKL-QNWC 135

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
              A  +    Y  F  +K+   D+TF
Sbjct: 136 LSSAFEE----YQRFAGVKSRAADLTF 158


>gi|320165898|gb|EFW42797.1| protein tyrosine phosphatase [Capsaspora owczarzaki ATCC 30864]
          Length = 232

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/147 (27%), Positives = 60/147 (40%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L K  G+KSIL L    PE +  +  +   D  + L+
Sbjct: 76  NFAIVAPG-VYRSGYPGKKNFPFLNK-LGLKSILYL---CPEPYVGDNAQFIGDQTLSLL 130

Query: 103 NFPLSATREL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +FP+   +E         ++  + ++L +   PLLIHC  G  RTG        I   + 
Sbjct: 131 HFPIHGNKEPFTHIPAATLRAALVALLDSRNHPLLIHCNKGKHRTGCLVGCLRKI-QKWT 189

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +    Y  F   K   +D  F
Sbjct: 190 VTSIFDE----YQRFAGTKARILDQQF 212


>gi|302500224|ref|XP_003012106.1| tyrosine phosphatase family protein [Arthroderma benhamiae CBS
           112371]
 gi|291175662|gb|EFE31466.1| tyrosine phosphatase family protein [Arthroderma benhamiae CBS
           112371]
          Length = 366

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/147 (26%), Positives = 61/147 (41%), Gaps = 15/147 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E        GI
Sbjct: 154 MPNNFAEVVKG-IYRSSFPLPVHLSSL-AQLNLKTIVTL---VDEEWSPEYSAFVRGNGI 208

Query: 100 QLINFPLSATRELND----EQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                P+ A ++ N       I ++++IL  T   P+++HC  G  RTG   A +     
Sbjct: 209 TSRIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACFRKA-Q 267

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +    A  +    Y +    KT T+D
Sbjct: 268 GWTSVAAIAE----YIYHSAPKTRTLD 290


>gi|255547596|ref|XP_002514855.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
 gi|223545906|gb|EEF47409.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
          Length = 200

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/165 (22%), Positives = 64/165 (38%), Gaps = 14/165 (8%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP 83
           +   +  G     +     NF  V    I+RSA P      +L     ++S++ L     
Sbjct: 1   MGLILEAGEGNDDVLIPPANFSMVEDG-IFRSAFPQPANFSFLHS-LNLRSVIYL---CL 55

Query: 84  ESWHKEEEKAANDLGIQLINFPLS---ATRELNDEQIKQLIS-ILKTAPKPLLIHCKSGA 139
           E + +E  +      IQL  F +    ++  +  + I   +  +L     P+LIHCK G 
Sbjct: 56  EPYPEENMEFLRAHNIQLFQFGIEGKTSSVSIPKDAILGALKVLLDVRNHPILIHCKRGK 115

Query: 140 DRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
            RTG     +  +  H+       +    Y HF  +K+   D+ F
Sbjct: 116 HRTGTLVGCFRKL-QHWCLSSVFEE----YQHFAGVKSRAADLKF 155


>gi|255718429|ref|XP_002555495.1| KLTH0G10626p [Lachancea thermotolerans]
 gi|238936879|emb|CAR25058.1| KLTH0G10626p [Lachancea thermotolerans]
          Length = 303

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 62/152 (40%), Gaps = 14/152 (9%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
               +NF  VV  EIYRS+ P      +L++   +KSI+ L   +PE + +E  +     
Sbjct: 138 VIPPENFSHVV-GEIYRSSFPRPENFSFLQQRIKLKSIMVL---IPEEYPQENLEFMARA 193

Query: 98  GIQLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           GI+L  F +S  +E      +D     L   +     P+LIHC  G  RTG        +
Sbjct: 194 GIKLFQFGMSGNKEPFVNIPSDLLTSALEVAINPENHPVLIHCNRGKHRTGCLVGCIRRL 253

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             ++       +    Y  F   K   +D  F
Sbjct: 254 -QNWSLTMIFDE----YRRFAFPKARALDQQF 280


>gi|71656659|ref|XP_816873.1| tyrosine phosphatase [Trypanosoma cruzi strain CL Brener]
 gi|70882030|gb|EAN95022.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 340

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L+    +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNFRFLRA-LRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F     +E     ++  + +++S L  T   P+LIHC  G  RTG   A    +   + 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVACLRLL-QGWS 142

Query: 158 K 158
            
Sbjct: 143 L 143


>gi|224116022|ref|XP_002317187.1| predicted protein [Populus trichocarpa]
 gi|222860252|gb|EEE97799.1| predicted protein [Populus trichocarpa]
          Length = 211

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     +L+    ++SIL L    PE + +       D G+QL 
Sbjct: 54  NF-AMVDNGIFRSGFPDIANFTFLQS-LSLRSILYL---CPEPYPEANSDFLKDNGVQLF 108

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +E I++ +  +L     P+LIHCK G  RTG        +   + 
Sbjct: 109 QFGMEMCKEPFVNIPEETIREALKVLLDVRNHPILIHCKRGKHRTGCLVGCLRKL-QRWC 167

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                 +    Y  F   K    D  F ++  +
Sbjct: 168 LSSIFDE----YQRFAAAKARVSDQRFMELFDI 196


>gi|255647936|gb|ACU24425.1| unknown [Glycine max]
          Length = 200

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 67/160 (41%), Gaps = 15/160 (9%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
            +     NF A+V   ++RS+ P  +   +L+    ++SI+ L    PE + +   +   
Sbjct: 14  AVLVPPPNF-AMVEDCVFRSSFPTPSNFPFLQT-LNLRSIIYL---CPEPYPEGNLEFLR 68

Query: 96  DLGIQLINFPLSATRELN----DEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYL 150
              I+L  F +    +++     + I   +  ++     P+L+HCK G  RTG       
Sbjct: 69  SQNIRLFQFGIEGKTDVSIPVLKDSIMDALKVLIDVRNHPILVHCKRGKHRTGCLVGCLR 128

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
            +  ++       +    Y  F   K+ T D+TF ++  +
Sbjct: 129 KL-QNWCLSSVFEE----YQRFAGAKSRTTDLTFIEMFDV 163


>gi|254569786|ref|XP_002492003.1| Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis [Pichia pastoris GS115]
 gi|238031800|emb|CAY69723.1| Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis [Pichia pastoris GS115]
 gi|328351503|emb|CCA37902.1| hypothetical protein PP7435_Chr2-0205 [Pichia pastoris CBS 7435]
          Length = 201

 Score =  106 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/172 (25%), Positives = 68/172 (39%), Gaps = 16/172 (9%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V    IYRS+ P     E+L K   +KS++ L   +PE + +E  +   +  
Sbjct: 38  TPPKNFSPVC-GNIYRSSFPTIENFEFL-KRINLKSVICL---IPEDYPEENREFLEEQH 92

Query: 99  IQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           IQ     LS  +E       + I+Q + I L     P+LIHC  G  RTG  S     + 
Sbjct: 93  IQFFQVGLSGNKEPFVKIKPQLIEQALKIVLNPENHPILIHCNRGKHRTGCLSGCIRKL- 151

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPM 204
             +       +    Y  F   K   +D  F E         ++  +   P+
Sbjct: 152 QKWSLTMIFDE----YRKFAAPKERALDQQFIEMFDDTEVEKMAIENKWLPI 199


>gi|60459387|gb|AAX20039.1| tyrosine specific protein phosphatase family protein [Capsicum
           annuum]
          Length = 225

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/147 (23%), Positives = 61/147 (41%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V + I+RS  P+     +L+   G++SI+ L    PE + +   +      I+L 
Sbjct: 68  NFS-MVDNGIFRSGFPDVANFSFLQT-LGLRSIIYL---CPELYPESNMEFLKANDIRLF 122

Query: 103 NFPLSATREL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +E+I++ +  ++     P+LIHCK G  RTG        +   + 
Sbjct: 123 QFGIKNCKEPFVNIPEEKIREALGVLIDVRNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 181

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +    Y  F   K    D  F
Sbjct: 182 LTSVFDE----YQRFAAAKARVSDQRF 204


>gi|322488043|emb|CBZ23288.1| putative tyrosine phosphatase [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 292

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 11/123 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + GI 
Sbjct: 14  TINFSMVCPG-VYRSGYPTKKNYAFLCA-LRLRSILYL---CPEDYAESNLKFCEENGIH 68

Query: 101 LINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           ++ FP    +E     ++  + +++  +  T   PLLIHC  G  RTG   A   ++   
Sbjct: 69  VLRFPTEGNKEPFCDISEPLMHRILGAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QG 127

Query: 156 YPK 158
           +  
Sbjct: 128 WSL 130


>gi|297832916|ref|XP_002884340.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297330180|gb|EFH60599.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 203

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 49/135 (36%), Gaps = 11/135 (8%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  V    IYRS  P      +L K   +++I+ L    PE + +E  +  
Sbjct: 12  AVVLAPPSNFSMVEDG-IYRSGFPRPENFSFL-KTLNLRAIIYL---CPEPYPEENLQFL 66

Query: 95  NDLGIQLINFPLSATRELN----DEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVY 149
               I+L  F +    +       + +   + +L      P+LIHCK G  RTG      
Sbjct: 67  EANNIKLYQFGIEGKTDPPTLMPKDTVLDALRVLVDVRNHPILIHCKRGKHRTGCLVGCL 126

Query: 150 LYIVAHYPKEEAHRQ 164
              V  +       +
Sbjct: 127 R-KVQSWCLSSVLEE 140


>gi|225680208|gb|EEH18492.1| tyrosine-protein phosphatase SIW14 [Paracoccidioides brasiliensis
           Pb03]
 gi|226287848|gb|EEH43361.1| tyrosine phosphatase family protein [Paracoccidioides brasiliensis
           Pb18]
          Length = 256

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 66/161 (40%), Gaps = 18/161 (11%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   +YRS+ P    ++ + K   +K+I+ L   + E W  +  +     GI
Sbjct: 45  LPDNFAEVVKG-VYRSSFPLPVHLDSIAK-LHLKTIIIL---VDEEWSPDYGEFIRKNGI 99

Query: 100 QLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                P+ A +        E + +++ I+      PLLIHC  G  RTG   A +  +  
Sbjct: 100 TSYIIPILANKVPQVSTPYETVVEVLKIILNPKNHPLLIHCNKGKHRTGCIVACFRRV-Q 158

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNV 195
            +    A ++    Y  + + K+  +D       + +  +V
Sbjct: 159 GWSIMAALQE----YQKYSIPKSRALD---RNYIEEFSADV 192


>gi|322496322|emb|CBZ31393.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 309

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 55/123 (44%), Gaps = 11/123 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + GI 
Sbjct: 14  TINFSMVCPG-VYRSGYPTKKNYSFLCA-LRLRSILYL---CPEDYAESNLKFCEEKGIH 68

Query: 101 LINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           ++ FP    +E     ++  + +++S +  T   PLLIHC  G  RTG   A   ++   
Sbjct: 69  VLRFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QG 127

Query: 156 YPK 158
           +  
Sbjct: 128 WSL 130


>gi|146076301|ref|XP_001462893.1| tyrosine phosphatase [Leishmania infantum JPCM5]
 gi|134066974|emb|CAM65079.1| putative tyrosine phosphatase [Leishmania infantum JPCM5]
          Length = 309

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 55/123 (44%), Gaps = 11/123 (8%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + GI 
Sbjct: 14  TINFSMVCPG-VYRSGYPTKKNYSFLCA-LRLRSILYL---CPEDYAESNLKFCEEKGIH 68

Query: 101 LINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           ++ FP    +E     ++  + +++S +  T   PLLIHC  G  RTG   A   ++   
Sbjct: 69  VLRFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QG 127

Query: 156 YPK 158
           +  
Sbjct: 128 WSL 130


>gi|76363712|ref|XP_888539.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|15027525|emb|CAC44917.1| putative tyrosine phosphatase [Leishmania major strain Friedlin]
          Length = 300

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + GI ++
Sbjct: 16  NFSMVCPG-VYRSGYPTKKNYSFLCA-LRLRSILYL---CPEDYAESNLKFCEENGIHVL 70

Query: 103 NFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            FP    +E     ++  + +++S +  T   PLLIHC  G  RTG   A   ++   + 
Sbjct: 71  RFPTEGNKEPFCDVSEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QGWS 129

Query: 158 K 158
            
Sbjct: 130 L 130


>gi|322816108|gb|EFZ24541.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 340

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L+    +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNFRFLRA-LRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F     +E     ++  + +++S L  T   P+LIHC  G  RTG   A    +   + 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVACLRLL-QGWS 142

Query: 158 K 158
            
Sbjct: 143 L 143


>gi|255645646|gb|ACU23317.1| unknown [Glycine max]
          Length = 203

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 66/160 (41%), Gaps = 15/160 (9%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
            +     NF  +V   I+RS  PN +   +L+    ++SI+ L    PE + +E      
Sbjct: 17  AVLVPPPNFS-MVEDCIFRSGLPNPSNFPFLQT-LNLRSIIYL---CPEPYPEENLDFLR 71

Query: 96  DLGIQLINFPLSATRELN----DEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYL 150
              I+L  F +    +++     + I   +  ++     P+LIHCK G  RTG       
Sbjct: 72  SQNIRLFQFGIEGKTDISMPILKDSIMDALEVLIDVRNHPVLIHCKRGKHRTGCLVGCLR 131

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
            +  ++       +    Y  F   K+ TMD+ F ++  +
Sbjct: 132 KL-QNWCLSSVFEE----YQRFAGAKSRTMDLAFIEMFDV 166


>gi|71419804|ref|XP_811280.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70875926|gb|EAN89429.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 340

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L+    +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNFRFLRA-LRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F     +E     ++  + +++S L  T   P+LIHC  G  RTG   A    +   + 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVACLRLL-QGWS 142

Query: 158 K 158
            
Sbjct: 143 L 143


>gi|320594044|gb|EFX06447.1| tyrosine phosphatase family protein [Grosmannia clavigera kw1407]
          Length = 343

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 58/125 (46%), Gaps = 9/125 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   +YRS+ P      YL K  G+K+I+ L   + +++ +  +K  +   IQ  
Sbjct: 144 NFGQVVSG-LYRSSYPQPENYAYL-KSLGLKTIVTL---VDKNFTEGYQKFMSANNIQHH 198

Query: 103 NFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+  E+    ++ ++ + L     PLLIHC  G  RTG   AV   I   +  E
Sbjct: 199 VFGMKGTKKEEIPLSTMEAILRLVLNRQNYPLLIHCNHGKHRTGCVVAVVRKI-CGWNNE 257

Query: 160 EAHRQ 164
               +
Sbjct: 258 RIVHE 262


>gi|119489654|ref|ZP_01622413.1| hypothetical protein L8106_13055 [Lyngbya sp. PCC 8106]
 gi|119454391|gb|EAW35540.1| hypothetical protein L8106_13055 [Lyngbya sp. PCC 8106]
          Length = 150

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 6/124 (4%)

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q   T ++    + G KS+LN R    E +  +EEK A   G++ +N P+ A   + DE
Sbjct: 16  NQVTPTQLQE-AAQAGFKSVLNFRSPQEEGFLSDEEKQAEAAGLEYVNIPVKANG-ITDE 73

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE---EAHRQLSMLYGHF 172
             +++I  +   PKP+L+HCKSG  R+G  + +Y+ I      +   E  +++      F
Sbjct: 74  LAEKIIEQIDQLPKPILLHCKSGL-RSGAMALMYIAIKEKISADIILEQGKEMGFDCNKF 132

Query: 173 PVLK 176
           P +K
Sbjct: 133 PEMK 136


>gi|217075344|gb|ACJ86032.1| unknown [Medicago truncatula]
          Length = 186

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 66/147 (44%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V   IYRS+ P  +   +L+    ++SI+ L    PE + +E      +  I+L 
Sbjct: 22  NFS-MVEDCIYRSSLPKPSSFPFLQT-LNLRSIIYL---CPEPYPEENLDFLKEQNIRLF 76

Query: 103 NFPLSATRELN----DEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    E++     + I + + +L      P+L+HCK G  RTG     +  +  ++ 
Sbjct: 77  QFGIEGKTEVSLPALRDSIMEALKVLVDVRNHPILVHCKQGKHRTGRLVGCFRKL-QNWC 135

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
              A  +    Y  F  +K+   D+TF
Sbjct: 136 LSSAFEE----YQRFAGVKSRAADLTF 158


>gi|6324296|ref|NP_014366.1| Siw14p [Saccharomyces cerevisiae S288c]
 gi|1730719|sp|P53965|SIW14_YEAST RecName: Full=Tyrosine-protein phosphatase SIW14
 gi|1301872|emb|CAA95895.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285814619|tpg|DAA10513.1| TPA: Siw14p [Saccharomyces cerevisiae S288c]
          Length = 281

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 62/152 (40%), Gaps = 14/152 (9%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
               +NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        
Sbjct: 116 VIPPENFSHVV-GEIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLT 171

Query: 98  GIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           GI+L    +S  +E         + + + I L  A +P+LIHC  G  RTG        +
Sbjct: 172 GIKLYQVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIRKL 231

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             ++       +    Y  F   K   +D  F
Sbjct: 232 -QNWSLTMIFDE----YRRFAFPKARALDQQF 258


>gi|50550115|ref|XP_502530.1| YALI0D07414p [Yarrowia lipolytica]
 gi|49648398|emb|CAG80718.1| YALI0D07414p [Yarrowia lipolytica]
          Length = 290

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 44/150 (29%), Positives = 62/150 (41%), Gaps = 15/150 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
             +NF  VV  +IYRS+ P     EYL K   +KSIL L   +PE +  E  +   +  I
Sbjct: 128 VPENFSIVV-GQIYRSSFPRPENFEYL-KRLKLKSILVL---IPEIYPDENLQFMKENNI 182

Query: 100 QLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           Q     +S  +E       + I + + I +  A  PLLIHC  G  RTG  S     +  
Sbjct: 183 QFFQVGMSGNKEPFVHVPHDVITRALEIAINPANHPLLIHCNRGKHRTGCLSGCIRRL-Q 241

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
            +       +    Y  F   K   +D  F
Sbjct: 242 DWSLTMIFDE----YRRFAYPKARPLDQQF 267


>gi|151944512|gb|EDN62790.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gi|190409013|gb|EDV12278.1| tyrosine-protein phosphatase SIW14 [Saccharomyces cerevisiae
           RM11-1a]
 gi|256269491|gb|EEU04779.1| Siw14p [Saccharomyces cerevisiae JAY291]
 gi|290771004|emb|CAY82175.2| Siw14p [Saccharomyces cerevisiae EC1118]
 gi|323303183|gb|EGA56982.1| Siw14p [Saccharomyces cerevisiae FostersB]
 gi|323306527|gb|EGA59920.1| Siw14p [Saccharomyces cerevisiae FostersO]
 gi|323331999|gb|EGA73411.1| Siw14p [Saccharomyces cerevisiae AWRI796]
          Length = 281

 Score =  104 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 62/152 (40%), Gaps = 14/152 (9%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
               +NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        
Sbjct: 116 VIPPENFSHVV-GEIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLT 171

Query: 98  GIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           GI+L    +S  +E         + + + I L  A +P+LIHC  G  RTG        +
Sbjct: 172 GIKLYQVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIRKL 231

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             ++       +    Y  F   K   +D  F
Sbjct: 232 -QNWSLTMIFDE----YRRFAFPKARALDQQF 258


>gi|296090655|emb|CBI41055.3| unnamed protein product [Vitis vinifera]
          Length = 158

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 61/149 (40%), Gaps = 14/149 (9%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V   ++RS  P+     +L+   G++SI+ L    PE + +   +     GI+L  F +
Sbjct: 1   MVDCGVFRSGFPDIANFTFLQT-LGLRSIIYL---CPEPYPEPNIEFLKCNGIRLFQFGI 56

Query: 107 SATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
              +E      ++ I++ + + L     PLLIHCK G  RTG        +   +     
Sbjct: 57  DGCKEPFVNIPEDTIREALKVVLDKRNHPLLIHCKRGKHRTGCLVGCLRKL-QRWCLSSI 115

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQL 190
             +    Y  F   K    D  F ++  +
Sbjct: 116 FDE----YQRFAAAKARISDQRFMELFDI 140


>gi|315056643|ref|XP_003177696.1| tyrosine-protein phosphatase SIW14 [Arthroderma gypseum CBS 118893]
 gi|311339542|gb|EFQ98744.1| tyrosine-protein phosphatase SIW14 [Arthroderma gypseum CBS 118893]
          Length = 265

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 67/164 (40%), Gaps = 18/164 (10%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   +YRS+ P    +  L  +  +K+I+ L   + E W  E      + GI
Sbjct: 53  MPNNFAEVVKG-VYRSSFPMSVHLSSL-AQLNLKTIVTL---VEEEWSPEYSAFVREKGI 107

Query: 100 QLINFPLSATRELND----EQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                P+ A ++ +       I ++++IL  T   P+L+HC  G  RTG   A +     
Sbjct: 108 TSRIIPILANKQPDVFTPFSTIVEVLTILLDTRNHPILVHCNKGKHRTGCVMACFRKA-Q 166

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
            +    A  +    Y ++   KT T+D       Q +  ++   
Sbjct: 167 GWNSVSAIAE----YIYYSAPKTRTLD---RNYIQEFDESLVAD 203


>gi|297811789|ref|XP_002873778.1| hypothetical protein ARALYDRAFT_488502 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297319615|gb|EFH50037.1| hypothetical protein ARALYDRAFT_488502 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 203

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 49/127 (38%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  P      +L     ++S++ L    PE + ++  K+     I+L 
Sbjct: 18  NFSMVEDG-IYRSGFPQLENFGFL-STLNLRSVIYL---CPEPYPEDNLKSLQSNNIKLF 72

Query: 103 NFPLSATRELN----DEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    +       + +   + +L      P+LIHCK G  RTG         V ++ 
Sbjct: 73  QFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQNWC 131

Query: 158 KEEAHRQ 164
                 +
Sbjct: 132 LSSVLEE 138


>gi|71019803|ref|XP_760132.1| hypothetical protein UM03985.1 [Ustilago maydis 521]
 gi|46099762|gb|EAK84995.1| hypothetical protein UM03985.1 [Ustilago maydis 521]
          Length = 569

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/156 (24%), Positives = 60/156 (38%), Gaps = 15/156 (9%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           F        NF  V  H +YRS+ P      +L +  G++S+L L   + E + +     
Sbjct: 357 FQEDLLPPDNFAMVNSH-VYRSSFPKKKHFPFL-RTLGLRSVLTL---ILEEYPETNSTF 411

Query: 94  ANDLGIQLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            +  GI    F +   +E       D+    L++IL     P+LIHC  G  RTG     
Sbjct: 412 LDQNGITFFQFGIPGNKEPFVSIPTDKITSALVTILDRRNHPILIHCNKGKHRTGCLIGC 471

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
              +   +       +    Y  F   K+ +MD  F
Sbjct: 472 LRKLQQ-WSLTTIFDE----YRRFSWPKSRSMDQEF 502


>gi|21553927|gb|AAM63010.1| unknown [Arabidopsis thaliana]
          Length = 204

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 49/127 (38%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  P      +L     ++SI+ L    PE + ++  K+     I+L 
Sbjct: 19  NFSMVEDG-IYRSGFPELENFGFL-STLNLRSIIYL---CPEPYPEDNLKSLASNNIKLF 73

Query: 103 NFPLSATRELN----DEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    +       + +   + +L      P+LIHCK G  RTG         V ++ 
Sbjct: 74  QFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQNWC 132

Query: 158 KEEAHRQ 164
                 +
Sbjct: 133 LSSVLEE 139


>gi|15237359|ref|NP_197152.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|9759130|dbj|BAB09615.1| unnamed protein product [Arabidopsis thaliana]
 gi|107738251|gb|ABF83668.1| At5g16480 [Arabidopsis thaliana]
 gi|332004915|gb|AED92298.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
          Length = 204

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 51/127 (40%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V  EIYRS  P      +L     ++SI+ L    PE + ++  K+     I+L 
Sbjct: 19  NFS-MVEDEIYRSGFPELENFGFL-STLNLRSIIYL---CPEPYPEDNLKSLASNNIKLF 73

Query: 103 NFPLSATRELN----DEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    +       + +   + +L      P+LIHCK G  RTG         V ++ 
Sbjct: 74  QFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQNWC 132

Query: 158 KEEAHRQ 164
                 +
Sbjct: 133 LSSVLEE 139


>gi|290973482|ref|XP_002669477.1| predicted protein [Naegleria gruberi]
 gi|284083025|gb|EFC36733.1| predicted protein [Naegleria gruberi]
          Length = 142

 Score =  101 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 61/149 (40%), Gaps = 15/149 (10%)

Query: 51  EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATR 110
            ++RS  PN     +LKK  G+KSI  L    PE +     +    +GI++  F +   +
Sbjct: 3   GVFRSGYPNKKNFPFLKK-IGLKSICYL---CPEQYAHNNMEFCRKVGIRIFQFGIEGNK 58

Query: 111 EL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
           E      ++ I++ I  +L     P+LIHC  G  RTG+          ++       + 
Sbjct: 59  EPFVHIPEDAIRKAITELLNPKNHPILIHCNKGKHRTGVLVGCLR-KTQNWSLTSIFDE- 116

Query: 166 SMLYGHFPVLKTITMDITF-EKITQLYPN 193
              Y  F   K   +D  F E  + +  N
Sbjct: 117 ---YRRFAGSKVRMLDQQFIELYSNITSN 142


>gi|145256757|ref|XP_001401506.1| tyrosine phosphatase [Aspergillus niger CBS 513.88]
 gi|134058415|emb|CAK47902.1| unnamed protein product [Aspergillus niger]
          Length = 225

 Score =  101 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 57/137 (41%), Gaps = 12/137 (8%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P    +  LKK  G+K+I+ L   + E +         + GI
Sbjct: 37  LPANFGEVVKG-IYRSSFPYPWNLTALKK-LGLKTIITL---VDEPYPPSHVMFVKENGI 91

Query: 100 QLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                 + A ++      D  + +++ +L   +  P+L+HC  G  RTG   A +  +  
Sbjct: 92  AHHRILVQANKDPAVKIPDSVMCRILELLLDKSNHPILVHCNKGKHRTGCVVACFRKL-Q 150

Query: 155 HYPKEEAHRQLSMLYGH 171
            +   +   +  + Y  
Sbjct: 151 AWDSCDVIEE-YLRYAF 166


>gi|76057138|emb|CAH19234.1| putative tyrosine phosphatase [Aspergillus niger]
          Length = 203

 Score =  101 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 57/137 (41%), Gaps = 12/137 (8%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P    +  LKK  G+K+I+ L   + E +         + GI
Sbjct: 15  LPANFGEVVKG-IYRSSFPYPWNLTALKK-LGLKTIITL---VDEPYPPSHVMFVKENGI 69

Query: 100 QLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                 + A ++      D  + +++ +L   +  P+L+HC  G  RTG   A +  +  
Sbjct: 70  AHHRILVQANKDPAVKIPDSVMCRILELLLDKSNHPILVHCNKGKHRTGCVVACFRKL-Q 128

Query: 155 HYPKEEAHRQLSMLYGH 171
            +   +   +  + Y  
Sbjct: 129 AWDSCDVIEE-YLRYAF 144


>gi|260943213|ref|XP_002615905.1| hypothetical protein CLUG_04787 [Clavispora lusitaniae ATCC 42720]
 gi|238851195|gb|EEQ40659.1| hypothetical protein CLUG_04787 [Clavispora lusitaniae ATCC 42720]
          Length = 278

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 44/173 (25%), Positives = 71/173 (41%), Gaps = 16/173 (9%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           +  +NF  V+ + IYRS+ P      +L K   +KS+L L   +PE + +         G
Sbjct: 114 SPPENFAPVI-NNIYRSSFPQPPSFAFL-KTLNLKSVLCL---IPEEYPQTHTDFFAREG 168

Query: 99  IQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           IQL    +S  +E     + + I +   I L  A +P+LIHC  G  RTG    +   + 
Sbjct: 169 IQLFQLGMSGNKEPFVIISSDLITEAAKIVLNPANQPILIHCNRGKHRTGCLVGILRRL- 227

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPMN 205
             +       +    Y  F   K   MD  F E   +      ++ +   P+N
Sbjct: 228 QGWSLTIIFDE----YRKFAAPKERPMDQQFIELYDETNLVKYAEDNNFVPLN 276


>gi|302907190|ref|XP_003049591.1| hypothetical protein NECHADRAFT_30066 [Nectria haematococca mpVI
           77-13-4]
 gi|256730527|gb|EEU43878.1| hypothetical protein NECHADRAFT_30066 [Nectria haematococca mpVI
           77-13-4]
          Length = 299

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 8/133 (6%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  VVP  +YRS+ P     +Y+ K   +K+I++L     E +  + E   
Sbjct: 97  APLNGRPHNFGVVVPG-VYRSSFPKSHDFDYI-KGLKLKTIVSL--VKKEEFDHDLEMFV 152

Query: 95  NDLGIQLINFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLY 151
              GI+ + F +  T+   +  + +K ++SI L     PLLIHC  G  RTG    V   
Sbjct: 153 AQEGIRQVVFNMKGTKKEAIPLKTMKSILSIVLNKENYPLLIHCNHGKHRTGCVVGVVR- 211

Query: 152 IVAHYPKEEAHRQ 164
            VA +  +    +
Sbjct: 212 KVAGWDVDNVVAE 224


>gi|46109578|ref|XP_381847.1| hypothetical protein FG01671.1 [Gibberella zeae PH-1]
          Length = 304

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 8/135 (5%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
           +  ++     NF  V+P  +YRS+ P     +Y+ K  G+K+I++L  K         E 
Sbjct: 98  HVASLDGRPFNFGIVIPG-VYRSSFPKSHDFDYI-KGLGLKTIVSLVKKDDLDHDL--ET 153

Query: 93  AANDLGIQLINFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVY 149
                GI+ + F +  T+   +  + +K ++++ L  +  PLLIHC  G  RTG    V 
Sbjct: 154 FITSEGIRQVVFNMKGTKKEAIPLDTMKGILNVVLDQSNYPLLIHCNHGKHRTGCVVGVV 213

Query: 150 LYIVAHYPKEEAHRQ 164
             I   +       +
Sbjct: 214 RKI-TGWDVARVVAE 227


>gi|194697854|gb|ACF83011.1| unknown [Zea mays]
          Length = 164

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 60/155 (38%), Gaps = 26/155 (16%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V   I+RS  P+     +L     ++SI+ L    PE + +E  +     GI+L  F +
Sbjct: 1   MVDDGIFRSGLPDAANFRFLLS-LNLRSIVYL---CPEPYAEENARFLRTNGIRLHQFAV 56

Query: 107 SATR----------------ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVY 149
             ++                 + +E I++ + + L    + +LIHCK G  RTG      
Sbjct: 57  EGSKSGPTVLDTMSAQEPFVHIPEETIREALKVVLDVRNQLVLIHCKRGKHRTGCVVGCL 116

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             +   +       +    Y HF   K  T D  F
Sbjct: 117 RKL-QKWCLSSVFDE----YLHFAAAKARTTDQRF 146


>gi|194364100|ref|YP_002026710.1| hypothetical protein Smal_0322 [Stenotrophomonas maltophilia
           R551-3]
 gi|194346904|gb|ACF50027.1| protein of unknown function DUF442 [Stenotrophomonas maltophilia
           R551-3]
          Length = 166

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
            + V P  +Y   QP+ T ++ L  + G++++++LR    E    +E + A  LG++ + 
Sbjct: 26  LNEVRPG-LYAGGQPSATQLQALAAQ-GVRTVIDLRQP-DEDRGFDETRVAESLGLRYVR 82

Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
            P++    L+   I+ +   L+ +  P+L+HC SG +R G    +      H   E+A  
Sbjct: 83  IPVAGADGLDAANIRAVHQALQQSQGPVLLHCASG-NRAGAVLGLINARYEHASPEQAL- 140

Query: 164 QLSMLYG 170
           QL    G
Sbjct: 141 QLGQRAG 147


>gi|325192716|emb|CCA27129.1| tyrosine phosphatase putative [Albugo laibachii Nc14]
          Length = 154

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V   +YRS  PN     +L ++ G++SIL L     +    +      + GIQ+ 
Sbjct: 13  NFS-MVDAGVYRSGYPNKKNHSFL-RQLGLRSILYL---CHQPLRADNLLFFQENGIQIF 67

Query: 103 NFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           + P+   +E     + E +   +  +L  +  P+L+HC  G  RTG     Y   + ++ 
Sbjct: 68  HCPIDGNKEPFIGIDPEAMAGALRHLLDPSNHPILVHCTKGTHRTGCVIGCYR-KIQYWS 126

Query: 158 K 158
            
Sbjct: 127 L 127


>gi|328857605|gb|EGG06721.1| hypothetical protein MELLADRAFT_77769 [Melampsora larici-populina
           98AG31]
          Length = 329

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/155 (30%), Positives = 70/155 (45%), Gaps = 15/155 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  IYRS+ PN    E+L K  G+KS+L L   + E +  E  K  N  GI+ +
Sbjct: 167 NFGLVAPG-IYRSSFPNHLHFEFL-KTLGLKSVLTL---VQEKYSPECLKFYNQEGIKFM 221

Query: 103 NFPLSATREL----NDEQIK-QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +E+++  LI +L     P+LIHC  G  RTG        +  H+ 
Sbjct: 222 QFSIPGNKEPFVHIPEEKVRLALIHVLDVRNHPMLIHCNKGKHRTGCLVGCLRKL-QHWS 280

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
                 +    Y  FP  +   MD  F ++  L P
Sbjct: 281 STSIFDEYR-RYA-FPKSRN--MDQQFIELFDLAP 311


>gi|70994698|ref|XP_752126.1| tyrosine phosphatase family protein [Aspergillus fumigatus Af293]
 gi|66849760|gb|EAL90088.1| tyrosine phosphatase family protein [Aspergillus fumigatus Af293]
 gi|159124960|gb|EDP50077.1| tyrosine phosphatase family protein [Aspergillus fumigatus A1163]
          Length = 241

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/151 (22%), Positives = 64/151 (42%), Gaps = 15/151 (9%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
               NF  VV   +YRS+ P     + LKK  G++ I+ L   +   + ++ +    + G
Sbjct: 43  KLPPNFGDVVKG-VYRSSFPQPWHFQALKK-LGLRMIVTL---VEGDYTQDHQVFLKENG 97

Query: 99  IQLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           I+     + A ++      D  + +++ I+      PLL+HC  G  RTG     +   V
Sbjct: 98  IEHRRILILANKDPTIRTPDHVVNRVLEIMLNKTNHPLLLHCNKGKHRTGCIVGCFR-KV 156

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             +      ++    Y +F + K+  +D  F
Sbjct: 157 QGWDMPAIRKE----YLNFSLPKSRPLDERF 183


>gi|302780857|ref|XP_002972203.1| hypothetical protein SELMODRAFT_412771 [Selaginella moellendorffii]
 gi|302791497|ref|XP_002977515.1| hypothetical protein SELMODRAFT_107045 [Selaginella moellendorffii]
 gi|300154885|gb|EFJ21519.1| hypothetical protein SELMODRAFT_107045 [Selaginella moellendorffii]
 gi|300160502|gb|EFJ27120.1| hypothetical protein SELMODRAFT_412771 [Selaginella moellendorffii]
          Length = 223

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 61/166 (36%), Gaps = 17/166 (10%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP 83
           +   +  G           NF  +V   IYRS+ P    + +LKK   ++SI+ L    P
Sbjct: 13  LAALLGDGGKGSPKVIPPPNFG-MVDWGIYRSSYPTAENLPFLKK-LRLRSIVYL---CP 67

Query: 84  ESWHKEEEKAANDLGIQLINFPLSATRELNDE----QIKQLISI-LKTAPKPLLIHCKSG 138
           E +     +   +  I+L  F +    E   E     I+  + + L     PLLIHC  G
Sbjct: 68  EPY--LNHEFVAENKIKLFQFGIEGKCEPAVEIPEGVIRDALRVVLDVENYPLLIHCNRG 125

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             RTG+    Y  +   +       +    Y  +   K    D  F
Sbjct: 126 KHRTGVLVGCYRKVH-KWSLASILDE----YDRYAGAKARLRDKQF 166


>gi|186683839|ref|YP_001867035.1| hypothetical protein Npun_R3702 [Nostoc punctiforme PCC 73102]
 gi|186466291|gb|ACC82092.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
          Length = 159

 Score =   99 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 66/134 (49%), Gaps = 8/134 (5%)

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT-RELND 114
            Q     +E   +E G KS+LNLR      + K+E+K A  LG+   N PL    + LN+
Sbjct: 15  GQVIPKQLEQAIQE-GFKSVLNLRSPDELGFSKDEQKVAEALGLHYKNVPLKVDLKNLNE 73

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF-- 172
           E I ++++ L+  PKP ++HC +G   TG+A           P+E   R  ++ +G F  
Sbjct: 74  EAITKILTTLEEIPKPAVVHCAAGMRSTGIALLSIAIQEGLTPEETLARAKNLGFGFFEH 133

Query: 173 ----PVLKTITMDI 182
               P L+ + +D 
Sbjct: 134 AGVSPRLRQLFVDY 147


>gi|320582458|gb|EFW96675.1| Tyrosine phosphatase [Pichia angusta DL-1]
          Length = 236

 Score =   99 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/151 (25%), Positives = 62/151 (41%), Gaps = 15/151 (9%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF A+V   IYRS+ P     E++ K   +KS+L L   +PE +  E  +   +  
Sbjct: 73  TPPENF-ALVCGSIYRSSFPRIENFEFMLK-LKLKSVLCL---IPEEYPSENMEFLREND 127

Query: 99  IQLINFPLSATREL----NDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIV 153
           IQ     LS  +E       +Q+ + + I+      P+L+HC  G  RTG        + 
Sbjct: 128 IQFFQVGLSGNKEPFVKIKPDQVNEALKIIANPEHHPILVHCNRGKHRTGCIVGCIRKL- 186

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             +       +    Y  F   K   +D  F
Sbjct: 187 QKWSLSMIFDE----YRRFAYPKERPLDQQF 213


>gi|17549688|ref|NP_523028.1| putative tyrosine specific protein phosphatase [Ralstonia
           solanacearum GMI1000]
 gi|17431943|emb|CAD18620.1| probable tyrosine phosphatase protein [Ralstonia solanacearum
           GMI1000]
          Length = 214

 Score = 99.2 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 67/173 (38%), Gaps = 22/173 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPH--EIYRSAQPNGTFIEYL 66
           +  +   I  ++ +L  C+  +      +     NF  V      IYR  +P        
Sbjct: 19  RTTVFLSIATVMTLLAGCSTPMHEPGKPV-----NFGVVSEGVISIYRGGEPVDEQEWQF 73

Query: 67  KKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI-------------NFPLSATRELN 113
            K+  IK+I+ L          EE+  A   GI++I             +  +      +
Sbjct: 74  LKDSKIKTIVKLNQYSKAVSESEEDHLAEKYGIKVIKVFMGPEDCILGKHCNIDLDEMPD 133

Query: 114 DEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
              +++ I+ +  A    P+ +HC  G DRTGL  A+Y   V  Y +++A  +
Sbjct: 134 PNLVEKAINEITAAAGNGPVYVHCSHGQDRTGLVVALYRMRVQGYCRKKADDE 186


>gi|190345908|gb|EDK37876.2| hypothetical protein PGUG_01974 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 296

 Score = 99.2 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 11/126 (8%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
            T  +NF  V+ + IYRS+ P      +L +   +KSIL L   +PE + +  +    + 
Sbjct: 126 VTPPENFAPVI-NNIYRSSFPQIHSFSFL-RTLKLKSILCL---IPEEYPQMHKDFFEEE 180

Query: 98  GIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           GI+L    +S  +E       + + + + + L    +P+LIHC  G  RTG    V   +
Sbjct: 181 GIKLFQMGMSGNKEPFVKIPPDLVTEAVKVVLDPRNQPILIHCNRGKHRTGCLVGVIRRL 240

Query: 153 VAHYPK 158
              +  
Sbjct: 241 -QRWSL 245


>gi|150866081|ref|XP_001385557.2| tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
 gi|149387337|gb|ABN67528.2| tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
          Length = 242

 Score = 99.2 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 11/132 (8%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
            +     T  +NF  ++ ++IYRS+ P      +L+K   +KS+L L   +PE + +   
Sbjct: 71  FHISQPLTPPENFAPII-NKIYRSSFPQPNNFTFLRK-LKLKSVLCL---IPEEYPQLHL 125

Query: 92  KAANDLGIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLAS 146
           +      I+L    +S  +E     + + I +   I L    +P+LIHC  G  RTG   
Sbjct: 126 EFLEHENIKLFQLGMSGNKEPFVKISSDLITEAAKIVLNPENQPILIHCNRGKHRTGCLV 185

Query: 147 AVYLYIVAHYPK 158
            V   +   +  
Sbjct: 186 GVLRRL-QKWSL 196


>gi|213403272|ref|XP_002172408.1| tyrosine-protein phosphatase SIW14 [Schizosaccharomyces japonicus
           yFS275]
 gi|212000455|gb|EEB06115.1| tyrosine-protein phosphatase SIW14 [Schizosaccharomyces japonicus
           yFS275]
          Length = 244

 Score = 99.2 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 75/206 (36%), Gaps = 40/206 (19%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH 87
           ++         +   NF  V P  +YRS  P+     +L  +  I+SIL+LR    E + 
Sbjct: 50  MATSAEAAATISDPPNFGVVCPGLVYRSGCPSLQAFPFLH-QLHIRSILSLR---QEEYT 105

Query: 88  KEEEKAANDLGIQLINFPLSATR---------------------------ELN-DEQIKQ 119
            EE        IQ  +  +  ++                           +++ D  + +
Sbjct: 106 DEELAYMRQNNIQYFHIAMPGSKLRKNGSSTSSSSATSTSNSTEVAGEFNDIDIDALVHK 165

Query: 120 LIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTI 178
            +S +L +   P+L+HC  G  RTG+    +  ++  +  E+   + S  Y H       
Sbjct: 166 ALSVLLDSKNLPILVHCSGGKHRTGIVIGCFRALL-GWQPEKRLEEYS-RYSHPK----- 218

Query: 179 TMDITFEKITQLYPNNVSKGDTEQPM 204
             DI  E I    P+    G    P+
Sbjct: 219 ERDIDEEYIRNFTPDWSKHGYRRAPL 244


>gi|158333648|ref|YP_001514820.1| Rieske iron-sulfur (cyt b6f) fusion protein [Acaryochloris marina
           MBIC11017]
 gi|158303889|gb|ABW25506.1| rieske iron-sulfur (cyt b6f) fusion protein [Acaryochloris marina
           MBIC11017]
          Length = 343

 Score = 98.8 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/139 (22%), Positives = 61/139 (43%), Gaps = 11/139 (7%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
           QP    I+    + G KS+LNLR    + +   E +  +  G+   N P++   +L++  
Sbjct: 208 QPTPDQIQD-AAQLGFKSVLNLRSPQEDGFLINESQLVHSAGMNYANLPINPA-DLSEAT 265

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ---LSMLYGHFP 173
            +Q+++I+    KP+L+HCK G  R+G  + +Y  +   +  ++   Q   L +     P
Sbjct: 266 AEQVLTIIDQLSKPILLHCKGGL-RSGAMALLYEAVHQQWTTDQLLAQVHKLDLPLAAHP 324

Query: 174 VLKTITMDITFEKITQLYP 192
                 +    +      P
Sbjct: 325 Q-----LLHFIQDYVDAQP 338


>gi|301111440|ref|XP_002904799.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
 gi|262095129|gb|EEY53181.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
          Length = 172

 Score = 98.8 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 47/121 (38%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN     +L+ + G+KS+L L     +    E      +  I++ 
Sbjct: 13  NFSMVASG-VYRSGFPNRKNHAFLQ-QLGLKSVLYL---CHQGHQPENVAFFEENNIEVF 67

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+   +E       D     L  +L     P+L+HC  G  RTG         + ++ 
Sbjct: 68  QCPIDGNKEPFISINPDAMADALRHLLDVRNHPILVHCTKGTHRTGCVIGCMR-KMENWS 126

Query: 158 K 158
            
Sbjct: 127 L 127


>gi|322704326|gb|EFY95922.1| tyrosine phosphatase [Metarhizium anisopliae ARSEF 23]
          Length = 365

 Score = 98.4 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 8/125 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS+ P     ++L    G+K+++ L  K  E  H  E       GI+ +
Sbjct: 204 NFGVVFPG-VYRSSYPKPEGYDFL-GSLGLKTVVTL-VKKDEPDHDLE-SFLATNGIRQV 259

Query: 103 NFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+   +    ++ ++ + L     PLL+HC  G  RTG   A    + + +  +
Sbjct: 260 IFNMKGTKKEAIPMSTMRSILELVLDQKNYPLLLHCNHGKHRTGCVVAAIRKL-SGWQLD 318

Query: 160 EAHRQ 164
               +
Sbjct: 319 AVVDE 323


>gi|224128928|ref|XP_002329001.1| predicted protein [Populus trichocarpa]
 gi|222839235|gb|EEE77586.1| predicted protein [Populus trichocarpa]
          Length = 202

 Score = 98.4 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 11/120 (9%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +     NF  V    I+RS  P  +   +L+    ++SI+ L    PE++ +E     + 
Sbjct: 14  VLVPPTNFSMVEDG-IFRSGLPQPSNFGFLET-LNLRSIIYL---CPEAYPQENMDFVDA 68

Query: 97  LGIQLINFPLSATRE-----LNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYL 150
             I+L  F +    E     + +  I   +  ++     P+LIHCK G  RTG     + 
Sbjct: 69  HDIKLFQFGIEGKTESSSTSIPNHTITGALKVLIDVRNHPVLIHCKRGKHRTGCLVGCFR 128


>gi|150024972|ref|YP_001295798.1| hypothetical protein FP0882 [Flavobacterium psychrophilum JIP02/86]
 gi|149771513|emb|CAL42982.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86]
          Length = 193

 Score = 98.4 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 13/132 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL----------PESWHKEEE 91
            NF  +   ++Y+S       IE   K+Y IKSI++LR             P     E+E
Sbjct: 31  HNFETITEGKVYKSGVIPPDEIESYVKKYNIKSIVDLRFPGTTDLVNNPEIPTELTAEKE 90

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYL 150
             A   G+   N    + +    E +K  + I+   +  P+LIHC  G  R  L SA+Y 
Sbjct: 91  AIAKIKGVNYFNNG--SDQVPTPENVKTFLKIMDNKSNYPVLIHCYHGIGRAELYSAIYR 148

Query: 151 YIVAHYPKEEAH 162
               ++  ++A 
Sbjct: 149 IEYENFTNKDAR 160


>gi|254521540|ref|ZP_05133595.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
 gi|219719131|gb|EED37656.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
          Length = 166

 Score = 97.6 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 61/127 (48%), Gaps = 5/127 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
            + V P  +Y   QP+GT +  L  + G++++++LR    E    +E   A  LG++ + 
Sbjct: 26  LNEVRPG-LYAGGQPSGTQLRALAAQ-GVRTVIDLRQP-DEDRGFDEAGVAESLGLRYVR 82

Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
            P++    L+   ++ +   L+ +  P+L+HC SG +R G    +      H   E+A  
Sbjct: 83  IPVAGADGLDAANLRAVHQALQQSAGPVLLHCASG-NRAGAVLGLVTAHYEHASPEQAL- 140

Query: 164 QLSMLYG 170
           QL    G
Sbjct: 141 QLGQRAG 147


>gi|58269578|ref|XP_571945.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57228181|gb|AAW44638.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 279

 Score = 97.6 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 63/157 (40%), Gaps = 15/157 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +NF A+V   +YR   P     ++++    +K++L L   + E + K   +      IQ
Sbjct: 82  PENF-ALVSSGVYRCGFPKKRNFKFMET-LRLKTVLTL---VLEEYPKANLEWCQSQDIQ 136

Query: 101 LINFPLSATREL----NDEQI-KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            + F +   +E      ++ I   L++IL     P+LIHC  G  RTG        +   
Sbjct: 137 FMQFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTGCLIGCIRRL-QA 195

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
           +       +    Y  F   K+  +D  F  +  + P
Sbjct: 196 WSLTSIFDE----YRRFSAPKSRAVDQQFIDLFDIMP 228


>gi|134113933|ref|XP_774214.1| hypothetical protein CNBG1960 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256849|gb|EAL19567.1| hypothetical protein CNBG1960 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 279

 Score = 97.6 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 63/157 (40%), Gaps = 15/157 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +NF A+V   +YR   P     ++++    +K++L L   + E + K   +      IQ
Sbjct: 82  PENF-ALVSSGVYRCGFPKKRNFKFMET-LRLKTVLTL---VLEEYPKANLEWCQSQDIQ 136

Query: 101 LINFPLSATREL----NDEQI-KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            + F +   +E      ++ I   L++IL     P+LIHC  G  RTG        +   
Sbjct: 137 FMQFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTGCLIGCIRRL-QA 195

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
           +       +    Y  F   K+  +D  F  +  + P
Sbjct: 196 WSLTSIFDE----YRRFSAPKSRAVDQQFIDLFDIMP 228


>gi|310799951|gb|EFQ34844.1| tyrosine phosphatase [Glomerella graminicola M1.001]
          Length = 328

 Score = 97.6 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 51/119 (42%), Gaps = 8/119 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VVP  +YRS+ P      ++ +  G+KSI+ L     +   +      +  GI+  
Sbjct: 135 NFGVVVPG-VYRSSYPKPEDFGFI-RNLGLKSIVTL--VQKDGVDEPYTAFMSGNGIRHH 190

Query: 103 NFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
            F +  T+   +    +K ++ + L     PLLIHC  G  RTG    V    V  +  
Sbjct: 191 VFNMKGTKKEAIPIRTMKAILRLVLNREHHPLLIHCNHGKHRTGCVVGVVR-KVTGWEL 248


>gi|146420698|ref|XP_001486303.1| hypothetical protein PGUG_01974 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 296

 Score = 97.6 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 18/140 (12%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
            T  +NF  V+ + IYRS+ P      +L +   +KSIL L   +PE + +  +    + 
Sbjct: 126 VTPPENFAPVI-NNIYRSSFPQIHSFSFL-RTLKLKSILCL---IPEEYPQMHKDFFEEE 180

Query: 98  GIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYL-- 150
           GI+L    +S  +E       + + + + + L    +P+LIHC  G  RTG    V    
Sbjct: 181 GIKLFQMGMSGNKEPFVKIPPDLVTEAVKVVLDPRNQPILIHCNRGKHRTGCLVGVIRRL 240

Query: 151 ------YIVAHYPKEEAHRQ 164
                  I   Y K  A ++
Sbjct: 241 QRWLLTIIFDEYRKFAAPKE 260


>gi|238478343|ref|NP_001154304.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|332189657|gb|AEE27778.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana]
          Length = 247

 Score = 97.6 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/185 (20%), Positives = 63/185 (34%), Gaps = 47/185 (25%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V + I+RS  P+     +L+   G++SI+ L    PE + +   +     GI+L 
Sbjct: 58  NFS-MVDNGIFRSGFPDSANFSFLQT-LGLRSIIYL---CPEPYPESNLQFLKSNGIRLF 112

Query: 103 NFPLSATR------------------------------------ELNDEQIKQLIS-ILK 125
            F +   +                                     + D +I+  +  +L 
Sbjct: 113 QFGIEGNKCVPDLDNEISLHLWNSKHQKQGPLTNGLSKTLEPFVNIPDHKIRMALKVLLD 172

Query: 126 TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFE 185
               P+LIHCK G  RTG        +   +       +    Y  F   K    D  F 
Sbjct: 173 EKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWCLTSIFDE----YQRFAAAKARVSDQRFM 227

Query: 186 KITQL 190
           +I  +
Sbjct: 228 EIFDV 232


>gi|164658257|ref|XP_001730254.1| hypothetical protein MGL_2636 [Malassezia globosa CBS 7966]
 gi|159104149|gb|EDP43040.1| hypothetical protein MGL_2636 [Malassezia globosa CBS 7966]
          Length = 287

 Score = 97.6 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 15/149 (10%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             NF A+V   +YRS+ P     ++L K  G++S+L L   + E + ++  +  ++ GI+
Sbjct: 94  PDNF-AMVNSWVYRSSFPKKKHFQFL-KTLGLRSVLTL---ILEDYPEQNIQFLDENGIR 148

Query: 101 LINFPLSATREL----NDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
              + +   +E       E I   ++ IL     P+LIHC  G  RTG        +   
Sbjct: 149 FFQYGIPGNKEPFVQIPSETITAALATILDRRNHPMLIHCNKGKHRTGCLIGCLRKLQQ- 207

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           +       +    Y  F   K+ +MD  F
Sbjct: 208 WSLTTIFDE----YRRFSFPKSRSMDQEF 232


>gi|321261553|ref|XP_003195496.1| tyrosine phosphatase; Siw14p [Cryptococcus gattii WM276]
 gi|317461969|gb|ADV23709.1| Tyrosine phosphatase, putative; Siw14p [Cryptococcus gattii WM276]
          Length = 281

 Score = 97.3 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 61/157 (38%), Gaps = 15/157 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +NF  V    +YR   P     ++++    +K++L L   + E + K   +      IQ
Sbjct: 84  PENFALVSSG-VYRCGFPKKRNFKFMET-LRLKTVLTL---VLEEYPKANLEWCQSQDIQ 138

Query: 101 LINFPLSATREL----NDEQI-KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            + F +   +E      ++ I   L++IL     P+LIHC  G  RTG        +   
Sbjct: 139 FMQFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTGCLIGCIRRL-QA 197

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
           +       +    Y  F   K+  +D  F  +  + P
Sbjct: 198 WSLTSIFDE----YRRFSAPKSRAVDQQFIDLFDIMP 230


>gi|121706671|ref|XP_001271591.1| tyrosine phosphatase family protein [Aspergillus clavatus NRRL 1]
 gi|119399739|gb|EAW10165.1| tyrosine phosphatase family protein [Aspergillus clavatus NRRL 1]
          Length = 233

 Score = 97.3 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 15/155 (9%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           L   T   NF  VV   IYRS+ P    +  LKK   +K I+     +   + ++ +   
Sbjct: 36  LDAETLPLNFGEVVQG-IYRSSFPQPWHLPALKK-LNLKMIVTF---VEGEYTRDHQVFL 90

Query: 95  NDLGIQLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVY 149
            + GI+     + A ++      D  +  ++ IL   A  P+L+HC  G  RTG     +
Sbjct: 91  KENGIEHRRILVQANKDPAVRTPDHIVNYILEILLNKANHPMLVHCNKGRHRTGCIIGCF 150

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             +   +       +    Y +F   K+ ++D  F
Sbjct: 151 RKL-QGWDMAAIIEE----YLNFSWPKSRSLDEIF 180


>gi|302413737|ref|XP_003004701.1| tyrosine-protein phosphatase SIW14 [Verticillium albo-atrum
           VaMs.102]
 gi|261357277|gb|EEY19705.1| tyrosine-protein phosphatase SIW14 [Verticillium albo-atrum
           VaMs.102]
          Length = 362

 Score = 97.3 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 10/126 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEEKAANDLGIQL 101
           NF  VVP  +YRS+ P      ++ K  G+++I+ L R   P+ ++           I+ 
Sbjct: 126 NFGIVVPG-VYRSSYPKPEDFGFV-KNLGLRTIVTLGRRDEPDEFYAN---FLASNSIRH 180

Query: 102 INFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +  T+   +    ++ ++ I L     PL+IHC  G  RTG   AV   + + +  
Sbjct: 181 HIIEMKGTKKQSIPLMTMRDILRIVLDKQQYPLMIHCNHGKHRTGCVVAVVRKL-SGWDV 239

Query: 159 EEAHRQ 164
                +
Sbjct: 240 SNVLDE 245


>gi|19112377|ref|NP_595585.1| phosphoprotein phosphatase (predicted) [Schizosaccharomyces pombe
           972h-]
 gi|5679722|emb|CAB51762.1| phosphoprotein phosphatase (predicted) [Schizosaccharomyces pombe]
          Length = 263

 Score = 97.3 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 68/177 (38%), Gaps = 28/177 (15%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           F        NF  V P  IYRSA P  +   +L+    I++I++LR    E + +E+   
Sbjct: 52  FSNSPLVPDNFGVVYPGIIYRSACPRASNFNFLES-LHIRTIISLR---QEEYSEEDLHY 107

Query: 94  ANDLGIQLINFPLSATRE-----------LNDEQIKQLIS-----ILKTAPKPLLIHCKS 137
                I   +  +  ++             +   +  L+      +L     P+L+HC  
Sbjct: 108 FTKHHINYYHIAMPGSKHRKNDCISSSSNPDISDVDDLVRKTLQLLLNKENWPVLLHCSR 167

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
           G  RTG+       ++ ++P     ++    Y  F   K   +D   E+  Q + ++
Sbjct: 168 GKHRTGIVIGCLRALM-NWPVGNRLQE----YISFSHPKEREVD---EEYIQNFSSD 216


>gi|166228733|sp|Q9UUF3|YNF3_SCHPO RecName: Full=Probable tyrosine-protein phosphatase C17A3.03c
 gi|2257529|dbj|BAA21423.1| HYPOTHETICAL 32.8KD PROTEIN IN NCE3-HHT2 INTERGENIC REGION
           [Schizosaccharomyces pombe]
          Length = 295

 Score = 97.3 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 68/177 (38%), Gaps = 28/177 (15%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           F        NF  V P  IYRSA P  +   +L+    I++I++LR    E + +E+   
Sbjct: 84  FSNSPLVPDNFGVVYPGIIYRSACPRASNFNFLES-LHIRTIISLR---QEEYSEEDLHY 139

Query: 94  ANDLGIQLINFPLSATRE-----------LNDEQIKQLIS-----ILKTAPKPLLIHCKS 137
                I   +  +  ++             +   +  L+      +L     P+L+HC  
Sbjct: 140 FTKHHINYYHIAMPGSKHRKNDCISSSSNPDISDVDDLVRKTLQLLLNKENWPVLLHCSR 199

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
           G  RTG+       ++ ++P     ++    Y  F   K   +D   E+  Q + ++
Sbjct: 200 GKHRTGIVIGCLRALM-NWPVGNRLQE----YISFSHPKEREVD---EEYIQNFSSD 248


>gi|148908507|gb|ABR17366.1| unknown [Picea sitchensis]
          Length = 416

 Score = 97.3 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   +YRS  PN     +L K   ++SI+ L    PE + +   K      IQ+ 
Sbjct: 271 NF-AMVDKGVYRSGFPNHANFPFL-KTLKLRSIIYL---CPEPYSEVNMKFLRAEEIQIF 325

Query: 103 NFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E     +++ I+  + IL      P+LIHCK+G   T         I  ++ 
Sbjct: 326 QFGIIGYKEPIIGISEDDIRDALKILLDIRNHPVLIHCKTGKHPTSCLVGCLRKI-QNWC 384

Query: 158 KEEAHRQ 164
                 +
Sbjct: 385 LATVFDE 391


>gi|85079914|ref|XP_956442.1| hypothetical protein NCU03333 [Neurospora crassa OR74A]
 gi|28917507|gb|EAA27206.1| predicted protein [Neurospora crassa OR74A]
          Length = 331

 Score = 96.9 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 54/127 (42%), Gaps = 9/127 (7%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +NF  VVP  +YRS+ P      +++    +K+++ L   + + +    +   +  GI+
Sbjct: 131 PKNFGVVVPG-VYRSSFPQTEDYPFIE-GLKLKTMVTL---VQKDFPVGYDAFLSRNGIK 185

Query: 101 LINFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              F +  T+   +    +K ++ + L  A  PLLIHC  G  RTG    +       + 
Sbjct: 186 HHVFDMKGTKKEAIPITTMKAILRLVLNQANHPLLIHCNHGKHRTGCVVGIVR-RTLGWD 244

Query: 158 KEEAHRQ 164
                 +
Sbjct: 245 VSNILEE 251


>gi|42569581|ref|NP_180855.2| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|30102538|gb|AAP21187.1| At2g32960 [Arabidopsis thaliana]
 gi|110743267|dbj|BAE99524.1| hypothetical protein [Arabidopsis thaliana]
 gi|330253673|gb|AEC08767.1| phosphotyrosine protein phosphatase-like protein [Arabidopsis
           thaliana]
          Length = 257

 Score = 96.5 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 64/181 (35%), Gaps = 49/181 (27%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V + I+RS  P+     ++ K  G++SI++L    PE + +   +     GI L 
Sbjct: 66  NFS-MVDNGIFRSGFPDSANFSFI-KTLGLRSIISL---CPEPYPENNMQFLKSNGISLF 120

Query: 103 NFPLSATR--------------------------------------ELNDEQIKQLIS-I 123
            F +  ++                                      ++ D++I++ +  +
Sbjct: 121 QFGIEGSKSKCLPGLENEVWLHIWSSKHQKEDFYTNGNSKTSEPFVDILDQKIREALKVL 180

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDIT 183
           L     PLLIHCK G  RTG        +   +       +    Y  F   K    D  
Sbjct: 181 LDEKNHPLLIHCKRGKHRTGCLVGCMRKL-QKWCITSILDE----YKRFAAAKARVSDQR 235

Query: 184 F 184
           F
Sbjct: 236 F 236


>gi|115398235|ref|XP_001214709.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114192900|gb|EAU34600.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 236

 Score = 96.1 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 60/145 (41%), Gaps = 16/145 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-KEEEKAANDLGIQL 101
           NF  VV   +YRS  P+   +  L K   ++S+L L   + E +          D GI  
Sbjct: 52  NFGEVVRG-VYRSGFPSVWHLPSL-KTLNLRSVLTL---VEEPYTIPNYTNILRDNGINH 106

Query: 102 INFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
               +   ++     + + + +++ I+   A  P+L+HC  G  RTG   A +  +   +
Sbjct: 107 FCIKVLPNKDPAIKTSQQTMNEILEIILNKANHPILVHCNKGKHRTGCVIACFRKL-QGW 165

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMD 181
             ++   +    Y  +   K+  +D
Sbjct: 166 KHDDVINE----YLKYACPKSRVLD 186


>gi|119472119|ref|ZP_01614350.1| hypothetical protein ATW7_11085 [Alteromonadales bacterium TW-7]
 gi|119445139|gb|EAW26432.1| hypothetical protein ATW7_11085 [Alteromonadales bacterium TW-7]
          Length = 175

 Score = 95.7 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF A   + +Y +AQP+   ++ L K   +K ++NLRG   + W  +E +    LG+  
Sbjct: 39  KNFAA-HSNLVYSAAQPSKEQLKQLSKAD-VKHVINLRGANEQDW--DEGEFVQALGMDY 94

Query: 102 INFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
              P+S  +++  E  + L S+LK     P+L+HC S ++R G   A+  +       +E
Sbjct: 95  HALPISGAQDITVENARNLASLLKKLNGEPVLVHCAS-SNRVGALIAISAHE-DGLSVDE 152

Query: 161 AHR 163
           A  
Sbjct: 153 ALE 155


>gi|294464817|gb|ADE77914.1| unknown [Picea sitchensis]
          Length = 462

 Score = 95.7 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   +YRS  PN     +L K   ++SI+ L    PE +     +      I+  
Sbjct: 317 NF-AMVDKGVYRSGFPNHANFPFL-KTLKLRSIIYL---CPEPYPGVNMEFLRAEEIRFF 371

Query: 103 NFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +F +   +E     +++ ++  + IL      P+LIHC++G   T         I  ++ 
Sbjct: 372 HFGIKEYKEPIMGISEDDVRDALKILLDIRNHPVLIHCRTGKRPTSCLVGCLRKI-QNWC 430

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +    Y  F   KT   D+ F
Sbjct: 431 LASVFDE----YQRFAGTKTQVSDLQF 453


>gi|320102657|ref|YP_004178248.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319749939|gb|ADV61699.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 256

 Score = 95.3 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 66/181 (36%), Gaps = 12/181 (6%)

Query: 3   KIKK-PRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGT 61
           +    PR   L  ++ +     VL       +       +Q F  + P  +YR A     
Sbjct: 49  RWLSLPRSIRLTAWLALA----VLAGWQAWRHGHDYVLLSQ-FAEIEPGRVYRGAWQKPW 103

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND-----EQ 116
            +  L  +Y IK+++ L           E+      G + ++ P+   R         +Q
Sbjct: 104 PMSRLLNDYDIKTVVALAHPADHPLAIREKAQVEAHGARWVHLPIVDDRRFMQGRDLFDQ 163

Query: 117 IKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL 175
           I + + ++   A +P+  HC  G +R  +    Y   V  +  +EA  ++   +G     
Sbjct: 164 IDEAVKVVGDPANQPVFFHCHHGINRASMVQMAYRMKVCGWSFDEAVAEIDRTFGLVAAS 223

Query: 176 K 176
           +
Sbjct: 224 R 224


>gi|300698028|ref|YP_003748689.1| tyrosine phosphatase protein [Ralstonia solanacearum CFBP2957]
 gi|299074752|emb|CBJ54312.1| putative tyrosine phosphatase protein [Ralstonia solanacearum
           CFBP2957]
          Length = 216

 Score = 95.3 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/165 (22%), Positives = 66/165 (40%), Gaps = 24/165 (14%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  V      IYR  QP         KE  +K+I+ L          +E+K A    I+
Sbjct: 48  NFGVVSEGPISIYRGGQPVDDKEWGFLKEKKVKTIVKLNKYSDAVSEYDEDKFAEKYNIK 107

Query: 101 LINFPLSATR---------ELNDEQIKQ---LISILKTA-----PKPLLIHCKSGADRTG 143
           +I   +             + + +++     + + ++         P+ +HC  G DRTG
Sbjct: 108 VIKVFMGPEDCVPGVHCSIDPDLDEMPAKNSVATAIEEITVAAGNGPVYVHCSHGQDRTG 167

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLYGHFP--VLKTITMDITFEK 186
           L  A+Y   V  Y K++A  + +    + P  +L+ I  +   E+
Sbjct: 168 LVVALYRMRVQGYCKKKADDERNQ---YHPNTLLRGIKKEFDQER 209


>gi|123409707|ref|XP_001303489.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121884873|gb|EAX90559.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 179

 Score = 94.9 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 50/121 (41%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYR + PN     +L +  G+K+IL L    PE + +  ++  +   I+LI
Sbjct: 19  NFSLVAKG-IYRGSYPNQRNFSFL-RHLGLKTILFL---CPEDYSQSNQEFLDANNIKLI 73

Query: 103 NFPLSATREL----NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+   +E       E + + +  +      P+ IHC  G  RTG        I   + 
Sbjct: 74  RVPMEGNKEPFKIIPTELMNEAMCHLADRRSHPIYIHCNKGKHRTGSVVGCLRKIQQ-WT 132

Query: 158 K 158
            
Sbjct: 133 L 133


>gi|308811847|ref|XP_003083231.1| ATP-NAD kinase family protein (ISS) [Ostreococcus tauri]
 gi|116055110|emb|CAL57506.1| ATP-NAD kinase family protein (ISS) [Ostreococcus tauri]
          Length = 721

 Score = 94.9 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 51/120 (42%), Gaps = 9/120 (7%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE------EEKAANDLGIQLINFP 105
            YR  QP      +L +    K++++LRG   ++   +       +       + +++ P
Sbjct: 177 FYRGGQPTAEGRAWLVRN-NFKTVIDLRGSDRDNQWLQAFGGGSGQGTYGPSALNIVHIP 235

Query: 106 LSATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           +       DE + + I  +     +P+L+HCK+G  RTG   A +  +      +EA  Q
Sbjct: 236 IHDMEPPTDEDVDRFIEAVNNESMRPVLVHCKAGIGRTGALVACWR-VHQGMDVDEALSQ 294


>gi|238880096|gb|EEQ43734.1| tyrosine-protein phosphatase SIW14 [Candida albicans WO-1]
          Length = 277

 Score = 94.6 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 60/125 (48%), Gaps = 11/125 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  
Sbjct: 113 TPPENFAPVI-NKIYRSSFPQPNNFAFLKKLK-LKSILCL---IPEDYPHLQQEFIKNEN 167

Query: 99  IQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           I+L    +S  +E     + + I + + I L    +P+LIHC  G  RTG    V     
Sbjct: 168 IKLFQLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIR-KF 226

Query: 154 AHYPK 158
            ++  
Sbjct: 227 QNWSL 231


>gi|322699333|gb|EFY91095.1| tyrosine phosphatase [Metarhizium acridum CQMa 102]
          Length = 194

 Score = 94.6 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 52/125 (41%), Gaps = 8/125 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS+ P     ++L    G+K+++ L  K         +      GI+ +
Sbjct: 35  NFGVVFPG-VYRSSYPKPEDYDFL-GSLGLKTVVTLVKKDELDHDL--QSFLTTNGIRQV 90

Query: 103 NFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+   +    ++ ++ + L     PL++HC  G  RTG   A    + + +   
Sbjct: 91  IFNMKGTKKEAIPMSTMRSILELVLDQKNYPLMLHCNHGKHRTGCVVAAIRKL-SGWQLG 149

Query: 160 EAHRQ 164
               +
Sbjct: 150 AVLDE 154


>gi|116199785|ref|XP_001225704.1| hypothetical protein CHGG_08048 [Chaetomium globosum CBS 148.51]
 gi|88179327|gb|EAQ86795.1| hypothetical protein CHGG_08048 [Chaetomium globosum CBS 148.51]
          Length = 306

 Score = 94.2 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 8/119 (6%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           L   +   NF  VVP  +YRS+ P      +++    +K+I+ L   + + + +  +   
Sbjct: 105 LPAESRPANFGIVVPG-VYRSSFPQAEDYAFIQ-GLKLKTIVTL---VHKEFPRGYDAFL 159

Query: 95  NDLGIQLINFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYL 150
           +  GIQ   F +  T+   +    ++ ++ + L     PLLIHC  G  RTG    V  
Sbjct: 160 HRNGIQHAIFDMKGTKKESIPVATMESILRVVLDRRNHPLLIHCNHGKHRTGCVIGVIR 218


>gi|297823087|ref|XP_002879426.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297325265|gb|EFH55685.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 254

 Score = 93.8 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 64/181 (35%), Gaps = 49/181 (27%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P+     ++ K  G++SI++L    PE + +   +     GI L 
Sbjct: 63  NF-AIVDNGIFRSGFPDIANFSFI-KTLGLRSIISL---CPEPYPENNMQFLKSNGISLF 117

Query: 103 NFPLSATR--------------------------------------ELNDEQIKQLIS-I 123
            F +  ++                                      ++ D +I++ +  +
Sbjct: 118 QFGIEGSKSKCLPGLENEVWLHIWSSKHQKEGSYTNGNSKTSEPLVDILDHKIREALKVL 177

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDIT 183
           L     PLLIHCK G  RTG        +   +       +    Y  F   K    D  
Sbjct: 178 LDEKNHPLLIHCKRGKHRTGCLVGCMRKL-QKWCITSIFDE----YQRFAAAKARVSDQR 232

Query: 184 F 184
           F
Sbjct: 233 F 233


>gi|91203414|emb|CAJ71067.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 151

 Score = 93.8 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 9/138 (6%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPES---WHKEEEKAANDLGIQLINFPLSATRE 111
           ++QP+   I+ L ++ G KS++NLR    E      KEE       G++ ++ P+S   E
Sbjct: 14  ASQPSEEEIKKLPQQ-GFKSVVNLRASGEEDQPLSPKEEGDLVKKTGMKYLHIPVSTKEE 72

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
           +  E + +    ++  P P+ +HC +G  R G  + +Y  +      EEA  Q +   G 
Sbjct: 73  IKPELVDRFRKEIELLPAPVFVHCHTGK-RAGAFTMMYQALKEGVTGEEAI-QKAESMGF 130

Query: 172 ---FPVLKTITMDITFEK 186
               P LK   +D   + 
Sbjct: 131 ACDVPQLKAFFIDYINQH 148


>gi|254576957|ref|XP_002494465.1| ZYRO0A02134p [Zygosaccharomyces rouxii]
 gi|238937354|emb|CAR25532.1| ZYRO0A02134p [Zygosaccharomyces rouxii]
          Length = 170

 Score = 93.8 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/149 (28%), Positives = 63/149 (42%), Gaps = 14/149 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +NF  VV  EIYRS+ P      +LK    +KS+L L   +PE    E E+   + GIQ
Sbjct: 8   PENFSHVV-GEIYRSSFPRVENFYFLKHRLKLKSVLVL---IPEELPPENEEFLQEAGIQ 63

Query: 101 LINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           L    +S  +E       DE  + +  +L    +P+LIHC  G  RTG        +  +
Sbjct: 64  LFQVGMSGNKEPFVNIPGDELTRAMEIVLNPQHQPILIHCNRGKHRTGCLIGCIRKL-QN 122

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           +       +    Y  F   K   +D  F
Sbjct: 123 WSLTMIFDE----YRRFAFPKARALDQQF 147


>gi|68490198|ref|XP_711079.1| hypothetical protein CaO19.1850 [Candida albicans SC5314]
 gi|68490289|ref|XP_711035.1| hypothetical protein CaO19.9408 [Candida albicans SC5314]
 gi|46432307|gb|EAK91796.1| hypothetical protein CaO19.9408 [Candida albicans SC5314]
 gi|46432354|gb|EAK91840.1| hypothetical protein CaO19.1850 [Candida albicans SC5314]
          Length = 281

 Score = 93.4 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  
Sbjct: 117 TPPENFAPVI-NKIYRSSFPQPNNFAFLKKLK-LKSILCL---IPEDYPHLQQEFIKNEN 171

Query: 99  IQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           I+L    +S  +E     + + I + + I L    +P+LIHC  G  RTG    V   + 
Sbjct: 172 IKLFQLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIRKL- 230

Query: 154 AHYPK 158
            ++  
Sbjct: 231 QNWSL 235


>gi|241958954|ref|XP_002422196.1| tyrosine-protein phosphatase, putative [Candida dubliniensis CD36]
 gi|223645541|emb|CAX40200.1| tyrosine-protein phosphatase, putative [Candida dubliniensis CD36]
          Length = 280

 Score = 93.4 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  
Sbjct: 116 TPPENFAPVI-NKIYRSSFPQPNNFAFLKKLK-LKSILCL---IPEDYPHLQQEFIKNEN 170

Query: 99  IQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           I+L    +S  +E     + + I + + I L    +P+LIHC  G  RTG    V   + 
Sbjct: 171 IKLFQLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIRKL- 229

Query: 154 AHYPK 158
            ++  
Sbjct: 230 QNWSL 234


>gi|207725072|ref|YP_002255469.1| tyrosine phosphatase protein [Ralstonia solanacearum MolK2]
 gi|206590302|emb|CAQ37263.1| tyrosine phosphatase protein [Ralstonia solanacearum MolK2]
          Length = 216

 Score = 93.4 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/165 (22%), Positives = 65/165 (39%), Gaps = 24/165 (14%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  V      IYR  QP         KE  +K I+ L          +E+K A    I+
Sbjct: 48  NFGVVSEGPISIYRGGQPVDDKEWQFLKEKKVKDIVKLNKYSEAVSESDEDKFAEKYNIK 107

Query: 101 LINFPLSATR---------ELNDEQIKQ---LISILKTA-----PKPLLIHCKSGADRTG 143
           +I   +             + + +++     + + ++         P+ +HC  G DRTG
Sbjct: 108 VIKVFMGPEDCVPGVHCSIDPDLDEMPAKNSVATAIEEITVAAGNGPVYVHCSHGQDRTG 167

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLYGHFP--VLKTITMDITFEK 186
           L  A+Y   V  Y K++A  + +    + P  +L+ I  +   E+
Sbjct: 168 LVVALYRMRVQGYCKKKADDERNQ---YHPNTLLRGIKKEFDQER 209


>gi|89891746|ref|ZP_01203249.1| hypothetical protein BBFL7_01008 [Flavobacteria bacterium BBFL7]
 gi|89516081|gb|EAS18745.1| hypothetical protein BBFL7_01008 [Flavobacteria bacterium BBFL7]
          Length = 99

 Score = 92.6 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           +I+ P+  +R L + +I   +  ++ A KP+LIHC  G+DRTG+  A Y  +  ++  E 
Sbjct: 1   MIHLPMRTSR-LTEAEIIVALMEIQRAQKPVLIHCWHGSDRTGVVVAAYRIVFENWTIEN 59

Query: 161 AHRQLSML-YGHFPVL 175
           A  +     YG+    
Sbjct: 60  AIAEFRQKEYGYHESW 75


>gi|325187341|emb|CCA21879.1| hypothetical protein ALNC14_080220 [Albugo laibachii Nc14]
          Length = 169

 Score = 92.6 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 11/121 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            +NF A++   +YRS  P      +L+   G++SIL L   + E +     +      IQ
Sbjct: 31  PENF-AMIERGLYRSGFPKKKNFAFLES-LGLRSILTL---VLEEYPFANTEFNKTNRIQ 85

Query: 101 LINFPLSATRELNDE-----QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           L+ F +   +E   +      +  L ++L     P+LIHC  G  RTG         V  
Sbjct: 86  LLQFGVPGNKEPFVDIPEAGMLSALKAVLDIRNHPMLIHCNKGKHRTGCLVGSLR-KVQR 144

Query: 156 Y 156
           +
Sbjct: 145 W 145


>gi|298705570|emb|CBJ28821.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 194

 Score = 91.9 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 61/153 (39%), Gaps = 19/153 (12%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             NF  +V   IYRS+ P      +L+K  G+++IL L   + E             GI+
Sbjct: 29  PDNFS-MVDAGIYRSSFPMKKHFPFLRK-LGLRTILTL---VIEELPPANLDFVQAHGIR 83

Query: 101 LINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           L  F     + +  E++K  +  +   +  P+L+HC  G  RTG     +      +   
Sbjct: 84  LEPF-----KYIPLEEVKFAVREMSDASNHPMLVHCNKGKHRTGCLIGCFR-RTQGWAVS 137

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
               +    Y HF   K   +D   ++  +L+ 
Sbjct: 138 SIFEE----YSHFASPKARLVD---QRYIELFE 163


>gi|145354251|ref|XP_001421404.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581641|gb|ABO99697.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 363

 Score = 91.1 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 51/117 (43%), Gaps = 9/117 (7%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE------EEKAANDLGIQLINFPL 106
           YR  QP      +L +    K++++LRG   ++   +       +       + +++ P+
Sbjct: 175 YRGGQPTAEGRAWLVRN-NFKTVIDLRGSDRDNQWLQAFGGGSGQGTFGASALNIVHIPI 233

Query: 107 SATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
                  +E +K+ I  +     +P+L+HCK+G  RTG   A +  +      +EA 
Sbjct: 234 PDMEPPTEEDVKRFIETVNDDKMRPILVHCKAGIGRTGSLVACWR-VHQGMDVDEAL 289


>gi|77361300|ref|YP_340875.1| hypothetical protein PSHAa2384 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876211|emb|CAI87433.1| conserved protein of unknown function; putative membrane protein
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 177

 Score = 90.7 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 71/160 (44%), Gaps = 17/160 (10%)

Query: 15  YIKILLGVLVLCAV-SLGLYFLTITTFT---------QNFHAVVPHEIYRSAQPNGTFIE 64
           +IK+    L + A+ + G  F    +           +N   +  ++   +AQP    ++
Sbjct: 3   HIKLFANALFITALLTTGAAFAKEQSINITAVKTSDVRNL-VIHENQTLSAAQPTSEQLK 61

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
            L    G+K ++NLRG+  + W  +E +    LG+Q    P++  ++++ E  + L  I+
Sbjct: 62  QL-ANAGVKHVINLRGENEQDW--DEAQLVASLGMQYHALPIAGAQDVSVENAQNLAKIM 118

Query: 125 KTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
                 P+L+HC S ++R G   A+  +       E A  
Sbjct: 119 AELNGEPVLLHCAS-SNRVGALMAISAHA-EGLDIESALA 156


>gi|319411970|emb|CBQ74013.1| related to SIW14-Tyrosine phosphatase involved in actin
           filamentorganization [Sporisorium reilianum]
          Length = 233

 Score = 90.7 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 63/179 (35%), Gaps = 17/179 (9%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP 83
           +L + S       +     NF  +V   IYRS  PN    E+L +   +KS+L L     
Sbjct: 67  LLTSTSPTASSAQLIVPPLNFS-MVSRGIYRSGHPNERNFEFL-RRLNLKSVLYL---GT 121

Query: 84  ESWHKEEEKAANDLGIQLINFPLSATRELNDE----QIKQLIS-ILKTAPKPLLIHCKSG 138
           E +            I+  +  L+  +E   E     + Q +  IL+    P+LIHC  G
Sbjct: 122 EDYRANMTAWTAAQHIRTFHLRLAINKEPTAEMDEADVVQALQLILRPENWPILIHCNKG 181

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
             R G    +   +   +       +      +     T   D+ F ++  L    +  
Sbjct: 182 KYRVGCVVGLLRRL-QGWSHTSIFEE------YSRFAGTKISDLEFIEVFDLDKVTLGG 233


>gi|255721925|ref|XP_002545897.1| hypothetical protein CTRG_00678 [Candida tropicalis MYA-3404]
 gi|240136386|gb|EER35939.1| hypothetical protein CTRG_00678 [Candida tropicalis MYA-3404]
          Length = 284

 Score = 90.3 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 11/124 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ ++IYRS+ P      +LKK    KSIL L   +PE +   +++   +  
Sbjct: 120 TPPENFAPVI-NQIYRSSFPQPNNFTFLKKLKL-KSILCL---IPEDYPHLQQEFIKNEN 174

Query: 99  IQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           I+L    +S  +E     + + I + + I L    +P+LIHC  G  RTG    V   + 
Sbjct: 175 IKLFQLGMSGNKEPFVKISSDLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIRRL- 233

Query: 154 AHYP 157
            ++ 
Sbjct: 234 QNWS 237


>gi|121997594|ref|YP_001002381.1| dual specificity protein phosphatase [Halorhodospira halophila SL1]
 gi|121588999|gb|ABM61579.1| dual specificity protein phosphatase [Halorhodospira halophila SL1]
          Length = 182

 Score = 90.3 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/170 (19%), Positives = 68/170 (40%), Gaps = 8/170 (4%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           ++   +++  +    L+  A   G      T        + P  +YR+ +     +  L 
Sbjct: 2   KRIRKLWHATVD---LLEGAFLNGWQAFFQTVGYYRLIPIEPGVLYRTTEMPPQRLVALC 58

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT- 126
           +  G++++++LR K   +  +    A    GI+ ++ P  + +  +   +   + ++   
Sbjct: 59  RAQGVRTVIDLRRKAHRAEAE--AAALEPAGIRHVHLP--SAQVPDASTVAAFLELMDDP 114

Query: 127 APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLK 176
           A  P++IHC  G  RTG   AVYL        E A R    + G     +
Sbjct: 115 ANGPVVIHCVHGVGRTGALMAVYLMEYRGLDNESARRAAKRIGGFQSFGR 164


>gi|254569370|ref|XP_002491795.1| Putative protein with similarity to predicted tyrosine phosphatases
           Oca1p and Siw14p [Pichia pastoris GS115]
 gi|238031592|emb|CAY69515.1| Putative protein with similarity to predicted tyrosine phosphatases
           Oca1p and Siw14p [Pichia pastoris GS115]
 gi|328351704|emb|CCA38103.1| Putative tyrosine-protein phosphatase OCA1 [Pichia pastoris CBS
           7435]
          Length = 207

 Score = 90.3 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 67/166 (40%), Gaps = 18/166 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V   IYRS  P      YL+K   +K+I+ L G   +++  +  +   D GI   
Sbjct: 49  NF-AIVEDGIYRSGHPQAFNFPYLQK-LNLKTIIYL-GDKTDNY--DYYRWLRDQGIDFH 103

Query: 103 NFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              + +  E     +D  I+Q + ++      P+LIH   G  R G+   +   ++  + 
Sbjct: 104 YLNMQSCVEPFMFKDDSVIQQALKLIVHKENYPMLIHSNKGKHRVGVLVGIMRKLLQGWC 163

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
                 +    YG F   K    D+   +  + +  ++      +P
Sbjct: 164 ISGIFDE----YGRFAGGK-GEGDV---EYIETFKTDLLIDKNTKP 201


>gi|71019627|ref|XP_760044.1| hypothetical protein UM03897.1 [Ustilago maydis 521]
 gi|74701239|sp|Q4P7L6|OCA1_USTMA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|46099837|gb|EAK85070.1| hypothetical protein UM03897.1 [Ustilago maydis 521]
          Length = 158

 Score = 89.9 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 10/125 (8%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           + +V    YRS QP+     +L+K  G+KS++ L  + PE    +      D  I+L + 
Sbjct: 8   YGMVEENFYRSGQPDQLNFPFLEK-LGLKSVIWLAPEEPEPGFLD---FCVDQNIELHHL 63

Query: 105 PL----SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            +    +A   + +E + Q + +L + A  P+L+ C  G  RTG     +  +   +   
Sbjct: 64  GVLYSTNAWDPITEEVVLQALHLLVQPATYPVLVMCNLGRHRTGTVVGCFRKL-QRWNLS 122

Query: 160 EAHRQ 164
               +
Sbjct: 123 AILEE 127


>gi|328772409|gb|EGF82447.1| hypothetical protein BATDEDRAFT_9641 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 170

 Score = 89.9 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P+ IYRS  PN     +L K  G+KS++       + + +E         + + 
Sbjct: 14  NFAMVEPN-IYRSGYPNKKNFPFLLK-LGLKSVMY---ICEDDYTQETLDFWRINNVCVF 68

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  ++  +E        +    L+ +L    +P+L+HC  G  R G        +   + 
Sbjct: 69  HMRIAGNKEPFGEIEQKDIADALLKVLDEKNQPILLHCNKGKHRVGCLIGCLRKL-QKWS 127

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                 +    Y  F   KT   D  F ++
Sbjct: 128 MASIFDE----YRRFAGTKTHIADQEFIEV 153


>gi|163744309|ref|ZP_02151669.1| hypothetical protein OIHEL45_01960 [Oceanibulbus indolifex HEL-45]
 gi|161381127|gb|EDQ05536.1| hypothetical protein OIHEL45_01960 [Oceanibulbus indolifex HEL-45]
          Length = 152

 Score = 89.9 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/138 (23%), Positives = 59/138 (42%), Gaps = 15/138 (10%)

Query: 58  PNGTFIEYLKKEYGIKSILNLRGKLPES--WHKEEEKAANDLGIQLINFPLSATRELNDE 115
           P+   +E      G+K+++N R    +      EE   A  LG+  ++ P++    L  E
Sbjct: 22  PDAKALEQ-AASAGMKTVINFRAADEKGGLSPDEERLVAEKLGLNYLHHPVTP-DTLGPE 79

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL 175
            + +    L   P+P+ +HC SG  R G  + + L     +  + A ++           
Sbjct: 80  TVDEFRRSLDDLPQPVFLHCASGK-RAGAMTLMALAADKGWDGDTALQE----------G 128

Query: 176 KTITMDITFEKITQLYPN 193
           KT  +D+T EKI Q   +
Sbjct: 129 KTRGIDLTEEKIGQFVKS 146


>gi|149239280|ref|XP_001525516.1| hypothetical protein LELG_03444 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451009|gb|EDK45265.1| hypothetical protein LELG_03444 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 369

 Score = 89.9 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 57/125 (45%), Gaps = 11/125 (8%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           T  +NF  V+ + IYRS+ P  T   +LK              +PE +   +E+     G
Sbjct: 205 TPPENFALVI-NAIYRSSFPQPTNFSFLKLLKLKSV----LCLIPEDYPLLQEQFLASQG 259

Query: 99  IQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           I+L   P+S  +E     + + I Q I I L  + +P+LIHC  G  RTG    V   + 
Sbjct: 260 IKLFQLPMSGNKEPFVKISSDLITQAIQIVLDPSNQPILIHCNRGKHRTGCLVGVLRRL- 318

Query: 154 AHYPK 158
            ++ K
Sbjct: 319 QNWSK 323


>gi|75910356|ref|YP_324652.1| hypothetical protein Ava_4158 [Anabaena variabilis ATCC 29413]
 gi|75704081|gb|ABA23757.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 157

 Score = 89.5 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q     +E    + G KS+LNLR      +   E++ A  LG++ +N PL    +LN+E
Sbjct: 15  GQVIPEQLEQ-ASQEGFKSVLNLRSPDELGFSHNEQQVAEALGLKYVNVPLKL-EDLNEE 72

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            I +++  LKT PKP L+HC +    TG+A  + + +      E+
Sbjct: 73  LITEVLKALKTLPKPTLVHCAAAMRSTGIAL-LSIAVEEGLTPEQ 116


>gi|223940783|ref|ZP_03632617.1| hypothetical protein Cflav_PD0102 [bacterium Ellin514]
 gi|223890540|gb|EEF57067.1| hypothetical protein Cflav_PD0102 [bacterium Ellin514]
          Length = 334

 Score = 89.2 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTF-IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           +NF  +     Y  + P G      LK   GIK+I+ + G  P      + + A+  GI+
Sbjct: 56  ENFFQL-SDRFYSGSAPEGESAFAELKNR-GIKTIITVDGAKP------DVETAHRFGIR 107

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            ++ P+       ++ I+ L+   +T P P+ IHC  G  R    +AV       +  E+
Sbjct: 108 YVHLPIGYDGVPTNQAIR-LVKAAETLPGPIYIHCHHGMHRGPAGAAVICMATEGWSAEQ 166

Query: 161 AHRQLSM 167
           A   L +
Sbjct: 167 ADSWLRL 173


>gi|75909256|ref|YP_323552.1| hypothetical protein Ava_3047 [Anabaena variabilis ATCC 29413]
 gi|75702981|gb|ABA22657.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 127

 Score = 89.2 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           + Q      + + ++ G KS+LNLR          E++    LG++ INFP+    E+N+
Sbjct: 14  AGQITPDQFQKITED-GYKSVLNLRSPDERGLLDNEQEKLEFLGLRYINFPMKF-EEINN 71

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
               Q++  +   PKPLLIHC + + R+ + + +Y+        E+A  +LS
Sbjct: 72  RTTLQILQTINELPKPLLIHCDN-SIRSSVLALLYVATKQGITFEKAL-ELS 121


>gi|255718337|ref|XP_002555449.1| KLTH0G09592p [Lachancea thermotolerans]
 gi|238936833|emb|CAR25012.1| KLTH0G09592p [Lachancea thermotolerans]
          Length = 169

 Score = 89.2 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 52/119 (43%), Gaps = 7/119 (5%)

Query: 43  NFHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV  E+  YRS  P      ++  +  +++I+       +   ++  +      IQ
Sbjct: 8   NFAPVVSTEVSLYRSGYPMPLNYAFIADQLHLRTIIY---VGDKELSEDYNEFLTQHNIQ 64

Query: 101 LINFPLSATRELND-EQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
                +++ R+ N  EQ+ +++ ++   A  P+LIH   G  R G+   +   ++  + 
Sbjct: 65  YHFVHMNSCRDKNVQEQMDKVLRLIVDRANYPILIHSNKGKHRVGVVVGIIRKLLQGWS 123


>gi|50291433|ref|XP_448149.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527460|emb|CAG61100.1| unnamed protein product [Candida glabrata]
          Length = 186

 Score = 89.2 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 57/135 (42%), Gaps = 10/135 (7%)

Query: 43  NFHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  +V  ++  YRS  P      +++ +  +K+I+ +          E  +      I 
Sbjct: 13  NFAPIVSTDVSLYRSGYPMPLNYSFIRGQLHLKTIIYV--GDKSEPMPEYAEFLERERIN 70

Query: 101 LINFPLSATRELN-DEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + + R+ + D Q+ +++ + L+    P+LIH   G  R G+   +   ++  +  
Sbjct: 71  YHHIHMDSCRDPDIDAQMDRVLQLVLRADNYPILIHSNKGKHRVGVVVGIIRKLLQGWSI 130

Query: 159 EEAHRQLSMLYGHFP 173
              +++    YG F 
Sbjct: 131 AGIYQE----YGLFS 141


>gi|50551653|ref|XP_503301.1| YALI0D26125p [Yarrowia lipolytica]
 gi|49649169|emb|CAG81507.1| YALI0D26125p [Yarrowia lipolytica]
          Length = 168

 Score = 88.8 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 60/147 (40%), Gaps = 13/147 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  P      +L  +  +KSI+   G      +++  + A   GI L 
Sbjct: 8   NFAFVADG-IYRSGHPLPINYPFL-NQLDLKSIIYF-GDRDIGDNQDYIEWAKSEGITLH 64

Query: 103 NFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +++ +E     + E I+Q + IL      P+L+H   G  R G+   V   I+  + 
Sbjct: 65  YFHVNSAKEPFVENDPEAIRQALQILLDRRNFPILVHSNKGKHRIGVLVGVMRKILQGWC 124

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                 +    Y  F   K   +D+ F
Sbjct: 125 LAGIFDE----YSRFAAGK-GDLDVEF 146


>gi|190572508|ref|YP_001970353.1| hypothetical protein Smlt0440 [Stenotrophomonas maltophilia K279a]
 gi|190010430|emb|CAQ44038.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 166

 Score = 88.8 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
            + V P  +Y   QP+   ++      G++++++LR    E    +E + A  LG++ + 
Sbjct: 26  LNEVRPG-LYAGGQPSAAQLQA-LAAQGVRTVIDLRQPG-EDRGFDETRVAESLGLRYVR 82

Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
            P++    L+   ++ +   L+ +  P+L+HC SG +R G    +      H   E+A  
Sbjct: 83  IPVAGADGLDTANVRAVHLALQQSQGPVLLHCASG-NRAGAVLGLVNARYEHASPEQAL- 140

Query: 164 QLSMLYG 170
           QL    G
Sbjct: 141 QLGQRAG 147


>gi|145606989|ref|XP_001407418.1| hypothetical protein MGG_12093 [Magnaporthe oryzae 70-15]
 gi|145014610|gb|EDJ99178.1| hypothetical protein MGG_12093 [Magnaporthe oryzae 70-15]
          Length = 326

 Score = 88.0 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 69/168 (41%), Gaps = 15/168 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEEKAANDLGIQL 101
           NF  +VP  +YRS  P      ++ K+  +K+++ L   + PE +    +       I+ 
Sbjct: 138 NFGMIVPG-VYRSGYPQQEHHAFM-KDLKLKTVVTLVEKEPPEGF----KPFLTSNNIKH 191

Query: 102 INFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +  T+   ++   ++ ++++ L     PLL+HC  G  RTG  + V    V  +  
Sbjct: 192 HIIAMKGTKKESISLGTMQSILNVVLNPKNHPLLVHCNHGKHRTGCVAGVVR-KVTGWET 250

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
           +    +    Y  F   K    DI +  +  +    +S     +P+ A
Sbjct: 251 DAIIDE----YRKFADPKERECDIDYITMFDIADAKLSSMFARKPLYA 294


>gi|296120715|ref|YP_003628493.1| hypothetical protein Plim_0444 [Planctomyces limnophilus DSM 3776]
 gi|296013055|gb|ADG66294.1| hypothetical protein Plim_0444 [Planctomyces limnophilus DSM 3776]
          Length = 242

 Score = 88.0 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 77/169 (45%), Gaps = 6/169 (3%)

Query: 7   PRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYL 66
           P  + L F   ++L  +V  A+  G +        ++     P ++ R A      +  L
Sbjct: 14  PAASRLRFRWILILATIV--AMGAGGWAYRQNHRYKHVAIHDPGKVIRCAWVEADVMAEL 71

Query: 67  KKEYGIKSILNL-R-GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
            +++ +K++LNL R G++     ++E  A    G +LI   L    + +   I   I++L
Sbjct: 72  VQKHQVKTVLNLCRPGEMGPDRARQERMAVEAAGAKLIELSLPDIDDPSSPLIAPHIAVL 131

Query: 125 KT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF 172
           K  A  PL++HC+ G +RTG    +Y  +      EEA  ++  L+G  
Sbjct: 132 KDPANYPLIVHCQHGFNRTGRVLTMYDVMFRGKTGEEALSKM-PLFGRH 179


>gi|32476832|ref|NP_869826.1| hypothetical protein RB11176 [Rhodopirellula baltica SH 1]
 gi|32447378|emb|CAD77204.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 153

 Score = 88.0 bits (217), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 57/111 (51%), Gaps = 6/111 (5%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEE-KAANDLGIQLINFPLSATRELN 113
           QP+   ++ L  + G +S++N R  G+  +    EEE +A    G++ ++ P+S    ++
Sbjct: 16  QPSQDELKSLPDD-GFRSVINFRTAGEDEQPLSPEEEGEAVRATGLKYLHVPVSMDG-MD 73

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++++ Q     ++ PKP+  HCKSG  R G    ++  +      ++A  Q
Sbjct: 74  EKKVDQFREQYQSLPKPVFAHCKSGK-RAGAMMMMHTAVEQGLSGDQALEQ 123


>gi|327542372|gb|EGF28856.1| Beta-lactamase hydrolase-like protein [Rhodopirellula baltica WH47]
          Length = 153

 Score = 87.6 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 57/111 (51%), Gaps = 6/111 (5%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEE-KAANDLGIQLINFPLSATRELN 113
           QP+   ++ L  + G +S++N R  G+  +    EEE +A    G++ ++ P+S    ++
Sbjct: 16  QPSQDELKSLPDD-GFRSVINFRTAGEDEQPLSPEEEGEAVRATGLKYLHVPVSMDG-MD 73

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++++ Q     ++ PKP+  HCKSG  R G    ++  +      ++A  Q
Sbjct: 74  EKKVDQFREQYQSLPKPVFAHCKSGK-RAGAMMMMHTAVEQGISGDQALEQ 123


>gi|253582031|ref|ZP_04859255.1| protein tyrosine/serine phosphatase [Fusobacterium varium ATCC
           27725]
 gi|251836380|gb|EES64917.1| protein tyrosine/serine phosphatase [Fusobacterium varium ATCC
           27725]
          Length = 132

 Score = 87.6 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLKTIT 179
           +  L      +LIHC  GADR G+  A+Y  +  ++ +EE   ++ +  YG+  + K I 
Sbjct: 54  LDNLSANEDTILIHCYHGADRIGMMGALYRMVYQNWEREETLSEMLNDGYGYHSMWKDIV 113

Query: 180 MDITFEKITQLYPNN 194
             I    + QL  ++
Sbjct: 114 AFIKEVNVEQLKKDS 128


>gi|261206472|ref|XP_002627973.1| tyrosine phosphatase [Ajellomyces dermatitidis SLH14081]
 gi|239593032|gb|EEQ75613.1| tyrosine phosphatase [Ajellomyces dermatitidis SLH14081]
          Length = 231

 Score = 87.2 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 44/109 (40%), Gaps = 10/109 (9%)

Query: 78  LRGKLPESWHKEEEKAANDLGIQLINFPLSATREL-----NDEQIKQLISILKTAPKPLL 132
           LR    E W ++  +   + GI+    P+ A +        +  I+ L+ IL     P+L
Sbjct: 53  LRPLFDEEWSRDYGEFIQENGIKSYVIPILANKNPLVFTPYETVIEVLMLILNPMNHPVL 112

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMD 181
           IHC  G  RTG   A +  +   +    A ++    Y      K+  +D
Sbjct: 113 IHCNKGKHRTGCVIACFRRV-QGWSLMAALQE----YQKHSTPKSRVLD 156


>gi|151944476|gb|EDN62754.1| oxidant-induced cell cycle arrest [Saccharomyces cerevisiae YJM789]
 gi|190409047|gb|EDV12312.1| hypothetical protein SCRG_03193 [Saccharomyces cerevisiae RM11-1a]
 gi|207341667|gb|EDZ69656.1| YNL056Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256273270|gb|EEU08211.1| Oca2p [Saccharomyces cerevisiae JAY291]
 gi|259149303|emb|CAY82545.1| Oca2p [Saccharomyces cerevisiae EC1118]
 gi|323335830|gb|EGA77109.1| Oca2p [Saccharomyces cerevisiae Vin13]
          Length = 197

 Score = 87.2 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/163 (19%), Positives = 65/163 (39%), Gaps = 14/163 (8%)

Query: 43  NFHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV  ++  YRS  P      ++K +  +K+I+ +     +   +E +       I+
Sbjct: 8   NFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIK 65

Query: 101 LINFPL-SATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + S+  E   E++ Q++ + L     P+L+H   G  R G+   +   ++  +  
Sbjct: 66  YYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWST 125

Query: 159 EEAHRQLSMLYGHFPVL-KTITMDIT---FEKITQLYPNNVSK 197
              +++    YG F    K          FE   ++  N +  
Sbjct: 126 AGIYQE----YGLFSGGMKDGVDLEFITMFETNLKIPRNVIPG 164


>gi|242044034|ref|XP_002459888.1| hypothetical protein SORBIDRAFT_02g013070 [Sorghum bicolor]
 gi|241923265|gb|EER96409.1| hypothetical protein SORBIDRAFT_02g013070 [Sorghum bicolor]
          Length = 129

 Score = 86.9 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 50/117 (42%), Gaps = 10/117 (8%)

Query: 79  RGKLPESWHKEEEKAANDLGIQLINFPLSATREL----NDEQIKQLIS-ILKTAPKPLLI 133
           R   PE + +   +     GI+L  F +  ++E      +++I++ +  IL  +  P+LI
Sbjct: 6   RCLCPEPYPEANLEFLRAHGIKLFQFGIDGSKEPFVNIPEDRIREALKVILDASNHPVLI 65

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           HCK G  RTG     +  +   +       +    Y  F   KT   D+ F ++  +
Sbjct: 66  HCKRGKHRTGCVVGCFRKL-QRWCLTSIFDE----YQRFAAAKTRVSDLRFMELFDV 117


>gi|6324272|ref|NP_014342.1| Oca2p [Saccharomyces cerevisiae S288c]
 gi|1730735|sp|P53949|OCA2_YEAST RecName: Full=Tyrosine-protein phosphatase-like protein OCA2;
           AltName: Full=Oxidant-induced cell-cycle arrest protein
           2
 gi|1301927|emb|CAA95929.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|1314218|gb|AAA99655.1| Ynl2439p [Saccharomyces cerevisiae]
 gi|285814594|tpg|DAA10488.1| TPA: Oca2p [Saccharomyces cerevisiae S288c]
          Length = 197

 Score = 86.9 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/163 (19%), Positives = 64/163 (39%), Gaps = 14/163 (8%)

Query: 43  NFHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV  ++  YRS  P      ++K +  +K+I+ +     +   +E +       I+
Sbjct: 8   NFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIK 65

Query: 101 LINFPL-SATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + S+  E   E++ Q++ + L     P+L+H   G  R G+   +   ++  +  
Sbjct: 66  YYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWST 125

Query: 159 EEAHRQLSMLYGHFPVL-KTITMDIT---FEKITQLYPNNVSK 197
               ++    YG F    K          FE   ++  N +  
Sbjct: 126 AGICQE----YGLFSGGMKDGVDLEFITMFETNLKIPRNVIPG 164


>gi|282901585|ref|ZP_06309504.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193511|gb|EFA68489.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 150

 Score = 86.9 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 6/122 (4%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             NF  +   + +   QP+   +  L  + G+KSI+NLR          E++ +    ++
Sbjct: 1   MSNFRQI-SEKFWAGGQPSPEDLAQLAHQ-GVKSIVNLRSPDETGSLSNEQELSKSNSLE 58

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            +N PL +    N E+I  L++ +   P P+  HC +G  R  + + + L    ++  E+
Sbjct: 59  YVNLPLESNSS-NGEKIDYLLTEIVDLPTPIYFHCGAGG-RASVTALIALADQENW--ED 114

Query: 161 AH 162
           A 
Sbjct: 115 AV 116


>gi|51012717|gb|AAT92652.1| YNL056W [Saccharomyces cerevisiae]
          Length = 197

 Score = 86.5 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/163 (19%), Positives = 65/163 (39%), Gaps = 14/163 (8%)

Query: 43  NFHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF +VV  ++  YRS  P      ++K +  +K+I+ +     +   +E +       I+
Sbjct: 8   NFSSVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIK 65

Query: 101 LINFPL-SATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + S+  E   E++ Q++ + L     P+L+H   G  R G+   +   ++  +  
Sbjct: 66  YYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWST 125

Query: 159 EEAHRQLSMLYGHFPVL-KTITMDIT---FEKITQLYPNNVSK 197
               ++    YG F    K          FE   ++  N +  
Sbjct: 126 AGICQE----YGLFSGGMKDGVDLEFITMFETNLKIPRNVIPG 164


>gi|17228604|ref|NP_485152.1| hypothetical protein alr1109 [Nostoc sp. PCC 7120]
 gi|17130455|dbj|BAB73066.1| alr1109 [Nostoc sp. PCC 7120]
          Length = 130

 Score = 86.1 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           + Q      + + ++ G KS+LNLR    +     E+     LG++ INFP+    E+N+
Sbjct: 17  AGQITPIQFQKITED-GYKSVLNLRSPDEKGLLDNEQDKLEFLGLRYINFPMKF-EEINN 74

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
               Q++  +   PKPLLIHC + + R+ + + +Y+        E+A  +LS
Sbjct: 75  LTTLQILQTINELPKPLLIHCDN-SIRSSVLALLYVATKQGITFEKAL-ELS 124


>gi|303284104|ref|XP_003061343.1| NAD k-like protein [Micromonas pusilla CCMP1545]
 gi|226457694|gb|EEH54993.1| NAD k-like protein [Micromonas pusilla CCMP1545]
          Length = 836

 Score = 86.1 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 56/123 (45%), Gaps = 14/123 (11%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-----------KEEEKAANDLGIQ 100
            YR  QP      +L +  G K++++LR +  ++             K   + A+D G +
Sbjct: 153 FYRGGQPTAEGRAWLAER-GFKTVIDLRFEDRDNQWTKPFGGGVGVGKRAPRLADDAGFE 211

Query: 101 LINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +++ P++       E +++ I +    A +P+L+HCK+G  RTG   + +         +
Sbjct: 212 VVHMPVTDMEPPTFELVERFIEVANDRARRPMLVHCKAGIGRTGSMVSCWRISR-GMDVD 270

Query: 160 EAH 162
           EA 
Sbjct: 271 EAR 273


>gi|50310437|ref|XP_455238.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644374|emb|CAG97946.1| KLLA0F03487p [Kluyveromyces lactis]
          Length = 180

 Score = 86.1 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 17/112 (15%), Positives = 49/112 (43%), Gaps = 5/112 (4%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
              ++YRS  P      ++K +  +K+++       +    E +    +  I+  + P+ 
Sbjct: 15  TDVDLYRSGYPMPLNYSFIKHQLHLKTVIY---VGDKDILPEYKAFLEEESIKFHHIPMK 71

Query: 108 ATRELN-DEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +T++    ++++ ++ + L     P+L+H   G  R G+   +   ++  + 
Sbjct: 72  STKDPEIQKEMETVLKLVLDVNNYPILVHSNKGKHRVGVVVGIIRKLLLGWS 123


>gi|150865371|ref|XP_001384559.2| putative tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
 gi|149386627|gb|ABN66530.2| putative tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
          Length = 172

 Score = 85.7 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 50/125 (40%), Gaps = 12/125 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V  +IYRS  P      +L K+  +K+I+ L          + ++      I+  
Sbjct: 7   NF-ALVEDKIYRSGFPMPINYPFL-KQLKLKTIIYLDKHGTAEIMAQYQEWLTTTDIKFH 64

Query: 103 NFPLSATREL----------NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           N  + A++E            +     L  +L     P+LIH   G  RTG+   +   +
Sbjct: 65  NLLMEASQEPFNRPDEHQQAQESLTIALSLMLDKQNFPMLIHSNKGKHRTGVLVGLMRKL 124

Query: 153 VAHYP 157
           +  + 
Sbjct: 125 LQGWS 129


>gi|255089443|ref|XP_002506643.1| nad-k like protein [Micromonas sp. RCC299]
 gi|226521916|gb|ACO67901.1| nad-k like protein [Micromonas sp. RCC299]
          Length = 988

 Score = 85.7 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/161 (17%), Positives = 62/161 (38%), Gaps = 12/161 (7%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN---------DLGIQLI 102
            YR  QP      ++    G K+I++LR +  ++         +         +  ++++
Sbjct: 261 FYRGGQPTAEGRAWMVSR-GFKTIVDLRFEDRDNQWTRPLGGVDGKGGKVGHVESQLEVV 319

Query: 103 NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P++     + E +++ I I      +P+L+HCK+G  RTG   + +         EEA
Sbjct: 320 HIPVTDMEPPSFEAVERFIEIANDETKRPMLVHCKAGIGRTGSMVSCWRISR-GMDVEEA 378

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
               S+      + +   +    ++  Q           E+
Sbjct: 379 LALESLNCDFGSIAQEAFVRSFADRFVQKRKTAEEMKREEE 419


>gi|207341642|gb|EDZ69639.1| YNL032Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 219

 Score = 85.3 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 49/107 (45%), Gaps = 9/107 (8%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
               +NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        
Sbjct: 116 VIPPENFSHVV-GEIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLT 171

Query: 98  GIQLINFPLSATREL----NDEQIKQLISI-LKTAPKPLLIHCKSGA 139
           GI+L    +S  +E         + + + I L  A +P+LIHC  G 
Sbjct: 172 GIKLYQVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGQ 218


>gi|325918698|ref|ZP_08180796.1| hypothetical protein XVE_4827 [Xanthomonas vesicatoria ATCC 35937]
 gi|325535090|gb|EGD06988.1| hypothetical protein XVE_4827 [Xanthomonas vesicatoria ATCC 35937]
          Length = 144

 Score = 85.3 bits (210), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
           Y S QP    +  L  +  +++++NLR    E    EE   A+ LG++ +  P++   +L
Sbjct: 12  YASGQPTRLQLAELASKD-VRTVINLR-PPEEPVDYEEAGEADRLGLRYVTLPIANAGDL 69

Query: 113 NDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           +  +++    +L  A     +LIHC S A+R G   A+   +    P   A  
Sbjct: 70  DHARVQTFGRLLDQARTEGAVLIHCAS-ANRVGAMVALDQVLNRGTPLATALE 121


>gi|226502498|ref|NP_001142818.1| hypothetical protein LOC100275198 [Zea mays]
 gi|195610178|gb|ACG26919.1| hypothetical protein [Zea mays]
          Length = 149

 Score = 84.9 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 65/133 (48%), Gaps = 8/133 (6%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            +    +Y S QP+   ++  K++ GI S+LNLR    +++ KEE   A  LG+Q  N  
Sbjct: 9   EITKDLLYAS-QPDAESLKQTKEQKGIASVLNLRDTEEQTFMKEEGDVAQQLGLQYKNVC 67

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ- 164
           + +  EL +    Q+I  ++T PKP+LIHC  G       +AV   +V    ++ ++ Q 
Sbjct: 68  VKSLGELKNA-ASQIIEAIETMPKPILIHCIQGQR-----AAVGGLLVEAKKQKMSYEQI 121

Query: 165 LSMLYGHFPVLKT 177
           L     H     T
Sbjct: 122 LEWGKAHNFHFDT 134


>gi|186685041|ref|YP_001868237.1| hypothetical protein Npun_F4949 [Nostoc punctiforme PCC 73102]
 gi|186467493|gb|ACC83294.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
          Length = 127

 Score = 84.9 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           + Q     ++ +  E G KS+LNLR         +E++    LG+  +NFP   T ++N 
Sbjct: 14  AGQITPDQLKQIADE-GYKSVLNLRLPDETGLLADEQEKTEFLGLYYVNFPTK-TEDINH 71

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           + + Q+   +   PKP LIHC + + R+     +Y+ I      E+A +
Sbjct: 72  QSMLQIYQTIVELPKPTLIHCDN-SIRSAAIVLLYIAIKQGITFEKALQ 119


>gi|45187623|ref|NP_983846.1| ADL250Wp [Ashbya gossypii ATCC 10895]
 gi|44982361|gb|AAS51670.1| ADL250Wp [Ashbya gossypii ATCC 10895]
          Length = 181

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 49/120 (40%), Gaps = 7/120 (5%)

Query: 43  NFHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV  ++  YRS  P      ++K      +++       +   +E +       I+
Sbjct: 7   NFALVVSRDVSLYRSGYPMPLNYPFIKTRLQAGTVIY---VGDKDISEEYKAFLESEQIR 63

Query: 101 LINFPLSATRELN-DEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + + R+ N  E ++Q++ + L     P+LIH   G  R G+   +   ++  +  
Sbjct: 64  YHHIYMQSCRDDNIQESMEQVLRLVLNVDNYPILIHSNKGKHRVGVVVGIIRKLLQGWSV 123


>gi|301108377|ref|XP_002903270.1| putative tyrosine-protein phosphatase OCA1, putative [Phytophthora
           infestans T30-4]
 gi|262097642|gb|EEY55694.1| putative tyrosine-protein phosphatase OCA1, putative [Phytophthora
           infestans T30-4]
          Length = 744

 Score = 83.4 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 14/121 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI-- 102
           + ++  ++YRS QPN     +L++   +++I+ L  + P       +    +  IQL+  
Sbjct: 582 YGMIEEDLYRSGQPNELNFPFLER-LNLRTIIYLALEEPNPQF---QSFVEEQEIQLVFL 637

Query: 103 --NFPLSATR----ELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
             N  + + R     L++E +   + I+   +  PL I C  G DRTG        I   
Sbjct: 638 GGNTRMESRRKAWEPLSEETVLAALDIILDRSNYPLYITCHLGRDRTGAVVGCLRKI-QG 696

Query: 156 Y 156
           +
Sbjct: 697 W 697


>gi|320101897|ref|YP_004177488.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319749179|gb|ADV60939.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 506

 Score = 83.0 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/137 (24%), Positives = 56/137 (40%), Gaps = 9/137 (6%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE---EEKA 93
                  F  V    +Y SA P    +E     +G K+I+NL  +     H +   E++ 
Sbjct: 281 HHRPLGRFKEVEAGRLYMSAMPTAEGLELAHARHGFKTIINLFPEATLGRHPDSEAEQRF 340

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYI 152
           A   GI+ +  P     ELN   +++ + + +  A  P+L+HC +  DRT      + Y 
Sbjct: 341 ARTHGIRYLESP--GRVELNGAFLRETLDLTRDPAAWPILVHCHACMDRTPAWVGFFRYR 398

Query: 153 VAHYPKEE---AHRQLS 166
              +  +E   A  Q  
Sbjct: 399 EKGWELKEVWKAIEQHR 415


>gi|254576919|ref|XP_002494446.1| ZYRO0A01650p [Zygosaccharomyces rouxii]
 gi|238937335|emb|CAR25513.1| ZYRO0A01650p [Zygosaccharomyces rouxii]
          Length = 187

 Score = 83.0 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 51/121 (42%), Gaps = 6/121 (4%)

Query: 43  NFHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV  ++  YRS  P      +++ +  +++I+++     +    E  +      IQ
Sbjct: 24  NFSPVVSTDVSLYRSGYPMPLNYPFIRDQLHLRTIIHV--GDKQDLSPEYAEFLEQGNIQ 81

Query: 101 LINFPLSATRELN-DEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             N  + + R+    +++ Q++ I L     P+LIH   G  R G    +   ++  +  
Sbjct: 82  FHNIYMDSCRDDGFKDRMNQILEIVLNVDNYPMLIHSGKGKHRVGTVVGIIRKLLQGWSI 141

Query: 159 E 159
            
Sbjct: 142 A 142


>gi|156843003|ref|XP_001644571.1| hypothetical protein Kpol_1003p18 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115217|gb|EDO16713.1| hypothetical protein Kpol_1003p18 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 184

 Score = 82.6 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 60/145 (41%), Gaps = 10/145 (6%)

Query: 44  FHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           F  VV  ++  YRS  P      ++K +  +++I+ +     +   +E  K   D  I  
Sbjct: 15  FSPVVSTDVSIYRSGYPMPLNYPFIKDQLNLRTIIYI--GDRKDISEEYSKFLEDEKISY 72

Query: 102 INFPLSA-TRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            +  + +   E  ++++ +++++ L     P+LIH   G  R G+   +   ++  +   
Sbjct: 73  HHIFMDSCRDEGIEDRMNEVLNLVLDVGNYPILIHSNKGKHRVGVVVGIIRKLLQGWSTA 132

Query: 160 EAHRQLSMLYGHFPVLKTITMDITF 184
             +++    Y  F        D+ F
Sbjct: 133 GIYQE----YNIFSGGLKGDADLEF 153


>gi|300114244|ref|YP_003760819.1| hypothetical protein Nwat_1611 [Nitrosococcus watsonii C-113]
 gi|299540181|gb|ADJ28498.1| protein of unknown function DUF442 [Nitrosococcus watsonii C-113]
          Length = 147

 Score = 82.2 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 9/119 (7%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPES---WHKEEEKAANDLGIQLINFPLSATRE 111
             QP    ++ LK+E G ++++NLR    +       +E    ++LG++  + P+S    
Sbjct: 14  GGQPFKEDLQQLKQE-GFQTVINLRATGEKDQPLSPSDEGAIVSELGMEYAHLPVSM-DA 71

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH---RQLSM 167
           LN+  + Q    L+ APKP+ +HC SG  R G  + +   +      E A    R++  
Sbjct: 72  LNETLVDQFRERLEAAPKPVFVHCASGK-RAGAFAMMATAVEQGMNGETALQKAREMGF 129


>gi|328860709|gb|EGG09814.1| hypothetical protein MELLADRAFT_30357 [Melampsora larici-populina
           98AG31]
          Length = 136

 Score = 82.2 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/131 (22%), Positives = 56/131 (42%), Gaps = 11/131 (8%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
           A+V   IYRS  PN     +L+    + SI+ L     +++       A D G+++ ++ 
Sbjct: 11  AMVSPGIYRSGHPNYRNFAFLE-GLKLTSIMYL---CADNYRPHTFNWAQDRGLKIFHYR 66

Query: 106 LSATRELNDEQI------KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +  +++ N          + L  IL T   P+LIHC  G +R G   A+       +  +
Sbjct: 67  IDLSKDPNSPITPHSIYSEALTDILDTRNHPILIHCNKGKNRVGTICAILR-RYQAWNLD 125

Query: 160 EAHRQLSMLYG 170
               + +  +G
Sbjct: 126 SIQDEWNKFFG 136


>gi|171688968|ref|XP_001909424.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944446|emb|CAP70557.1| unnamed protein product [Podospora anserina S mat+]
          Length = 294

 Score = 81.1 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             NF  VVP  +YRS+ P      +++    +K+I+ L   + + + +  +K     GI 
Sbjct: 131 PSNFGVVVPG-VYRSSFPQSEDYGFIE-GLKLKTIVTL---VQKEFPQGYDKFIERNGIN 185

Query: 101 LINFPLSATR--ELNDEQIKQLISI-LKTAPKPLLIHCKSGADR 141
              F +  T+   +    ++ ++ + L     PLLIHC  G  R
Sbjct: 186 HCVFDMKGTKKQAIPIATMRSILRLVLDRRNHPLLIHCNHGKVR 229


>gi|283778166|ref|YP_003368921.1| hypothetical protein Psta_0371 [Pirellula staleyi DSM 6068]
 gi|283436619|gb|ADB15061.1| protein of unknown function DUF442 [Pirellula staleyi DSM 6068]
          Length = 335

 Score = 80.7 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 58/134 (43%), Gaps = 10/134 (7%)

Query: 50  HEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
             IY  ++P+       L K  GIK+I+++ G  P          A   G+  I+ P+  
Sbjct: 59  ERIYSGSEPSTEEHFAELAKR-GIKTIVSVDGAEP------NLALAQKYGLSYIHLPM-G 110

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML 168
              +  EQ  ++   ++ A  P+++HC  G  R   A+AV       +  ++A + L  +
Sbjct: 111 YGGMGREQTLKIARAMEIAQGPVMLHCHHGKHRGPSAAAVACIAEKKWTNDQAAQWLKQV 170

Query: 169 YGHFPVLKTITMDI 182
            G  P  + +  D+
Sbjct: 171 -GTSPSYRQMIADV 183


>gi|186682265|ref|YP_001865461.1| hypothetical protein Npun_F1861 [Nostoc punctiforme PCC 73102]
 gi|186464717|gb|ACC80518.1| protein of unknown function DUF442 [Nostoc punctiforme PCC 73102]
          Length = 149

 Score = 80.7 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 2/88 (2%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V  ++  + QP    ++   +E G KS+LNLR      +  +E++ A   G+Q  N PL 
Sbjct: 7   VSEDLSAAGQPTPEELKQAAQE-GFKSVLNLRSPDEPGFLSDEQQQAQAAGLQYANIPLK 65

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHC 135
            +   N E  +  I  ++  PKP+LIHC
Sbjct: 66  PSEA-NQELTEAAIQEIENLPKPILIHC 92


>gi|325983146|ref|YP_004295548.1| beta-lactamase hydrolase-family protein [Nitrosomonas sp. AL212]
 gi|325532665|gb|ADZ27386.1| Beta-lactamase hydrolase-family protein [Nitrosomonas sp. AL212]
          Length = 170

 Score = 79.9 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 5/94 (5%)

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKP 130
           G K++++LR K   +   EE+   +  G+   N P +    +  EQ+ +   I+++APKP
Sbjct: 62  GFKTVIDLRTKNEGT--AEEKALVDRAGMMYFNIPTTVAG-ITREQVAEFTKIIESAPKP 118

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           +LIHC SG +R     A Y         E A  +
Sbjct: 119 VLIHCGSG-NRASAMWASYRIT-QGVEPEAAIEE 150


>gi|222616979|gb|EEE53111.1| hypothetical protein OsJ_35888 [Oryza sativa Japonica Group]
          Length = 164

 Score = 79.9 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 48/151 (31%), Gaps = 39/151 (25%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
             +     NF  +V   +YRS  P+     +L +  G++S+                   
Sbjct: 17  AMVVAPPSNFG-MVDTGVYRSGFPDPASFGFL-RGLGLRSV------------------- 55

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
                            +  + I   +  IL     P+LIHCK G  RTG     +  + 
Sbjct: 56  ------------DPNVSIPVDAIMGALRVILDVRNHPVLIHCKRGKHRTGCLVGCFRKL- 102

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
            ++       +    Y  +   K+   D+ F
Sbjct: 103 QNWCLSSVFEE----YHRYAAGKSRLSDLKF 129


>gi|328773804|gb|EGF83841.1| hypothetical protein BATDEDRAFT_21375 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 172

 Score = 79.1 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/167 (17%), Positives = 62/167 (37%), Gaps = 18/167 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    +YRS QPN     +L+K  G+K+++ L  + P           +D  I  
Sbjct: 15  TNFGLVE-ERLYRSGQPNELNFPFLEK-LGLKTVIFLAPEEPNQRFLN---FIDDQEINF 69

Query: 102 INFPLS----ATRELNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            +   +    A   +++E + + +  +L     P+++ C  G  RTG        +   +
Sbjct: 70  FHLGFNSTANAWDPISEEVVLESLEHMLDPRNYPVMVMCNLGRHRTGTVVGCLRKL-QKW 128

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
                  +       +       + I  E+  +L+  ++ +     P
Sbjct: 129 NLASIFEE-------YRRYAGPKVRILSEQFIELFDTDLVRVPLNHP 168


>gi|119188179|ref|XP_001244696.1| hypothetical protein CIMG_04137 [Coccidioides immitis RS]
          Length = 251

 Score = 79.1 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 43/111 (38%), Gaps = 10/111 (9%)

Query: 79  RGKLPESWHKEEEKAANDLGIQLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLI 133
           R  +     ++ +K   D GI     P+ A ++     +   + +++ IL      P+L+
Sbjct: 71  RTLVENEHSRQFKKFIKDNGITSYVMPIIANKDPKIFTSQNTVLEVLRILFNPDNHPVLV 130

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           HC  G  RTG   A +      +    A  +    Y  +   KT  +D  F
Sbjct: 131 HCNKGKHRTGCIIACFRRA-QGWSNTAAVAE----YIKYSAPKTRVLDRKF 176


>gi|196229878|ref|ZP_03128742.1| protein tyrosine/serine phosphatase [Chthoniobacter flavus
           Ellin428]
 gi|196226204|gb|EDY20710.1| protein tyrosine/serine phosphatase [Chthoniobacter flavus
           Ellin428]
          Length = 301

 Score = 79.1 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 59/157 (37%), Gaps = 10/157 (6%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP-NGTFIEYLKKEYG 71
            F   +L+  + + A +        T    N   +   E+Y    P +      L K  G
Sbjct: 4   RFVAFLLIAGVAVSACAADPGQPVETQALHNVFKL-DTELYSGNAPEDDAGFRELAK-LG 61

Query: 72  IKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI-LKTAPKP 130
           IK+I+ + G  P          A+  G++ ++ P           ++   ++ +  A  P
Sbjct: 62  IKTIVTVDGTKP------NVALAHRYGMRYVHLPFGYDGLPQKRGVELAKAVQVAEAEGP 115

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM 167
           + +HC  G  R   A+AV    +  + KE+A   L  
Sbjct: 116 VYLHCHHGKHRAPTAAAVVCEALDGWSKEKAIDFLHQ 152


>gi|262368392|ref|ZP_06061721.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316070|gb|EEY97108.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 174

 Score = 79.1 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 60/134 (44%), Gaps = 6/134 (4%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T  + T NF  +  H ++ S QP    ++ + KEYG+ +++NL      ++   E++   
Sbjct: 6   THLSQTLNFQFIHEH-LFTSGQPTAEQLQQI-KEYGVNTVINLALSNSNNYLANEDQICL 63

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIV 153
           +LG+  I+ P+ +    +D+Q   ++ ++      + + +HC S   R      +Y    
Sbjct: 64  ELGLNYIHVPI-SWDTPSDDQCLLVLDMIDHLVQEQTIWVHC-SENYRVSSLMYLYRQYY 121

Query: 154 AHYPKEEAHRQLSM 167
            +     AH  +  
Sbjct: 122 MNIDMPTAHEAMHQ 135


>gi|114331088|ref|YP_747310.1| hypothetical protein Neut_1090 [Nitrosomonas eutropha C91]
 gi|114308102|gb|ABI59345.1| protein of unknown function DUF442 [Nitrosomonas eutropha C91]
          Length = 176

 Score = 78.8 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 69/157 (43%), Gaps = 12/157 (7%)

Query: 13  IFYIKILLGVLVLCAVSLGLY-----FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           +F+ + ++ +LVL + SL        + T       ++ V P +I  S       I+ L 
Sbjct: 1   MFFARTIITLLVLSSTSLVFAKDQVPYATQVNDLMRYYRVTP-QIATSGALTHDSIQELV 59

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K +   ++++LR +   +    E KA    G+  IN P+     +N+ Q+     +L+ A
Sbjct: 60  K-HSFNTVIDLRIESEGT--PNERKAVEAAGMTYINIPV-TNDGVNESQLIAFKRVLEQA 115

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
             P L+HC +G +R G     Y  +      E A ++
Sbjct: 116 SPPFLVHCATG-NRAGAMWTAYR-LKEGISPEIAFKE 150


>gi|328870334|gb|EGG18709.1| putative tyrosine phosphatase family protein [Dictyostelium
           fasciculatum]
          Length = 164

 Score = 78.8 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 51/135 (37%), Gaps = 11/135 (8%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           +       NF  V    +YRS QPN     +L+K   +K I+ L    PE   ++     
Sbjct: 1   MAHHIPPLNFGMVADD-LYRSGQPNELNFPFLEK-LQLKKIIFL---APEDPSQQFVNFC 55

Query: 95  NDLGIQLINFPLSA----TRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVY 149
           +D  I+LI+  +         ++++ +   + I+      PL I C  G  RTG      
Sbjct: 56  DDQDIELIHLGIDTMTNPWNPISEDVVISALKIILNPDNYPLAIMCNLGRHRTGTVVGCL 115

Query: 150 LYIVAHYPKEEAHRQ 164
             +   +       +
Sbjct: 116 RKL-QRWNLTSILEE 129


>gi|301108307|ref|XP_002903235.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
 gi|262097607|gb|EEY55659.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
          Length = 172

 Score = 78.4 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 54/121 (44%), Gaps = 14/121 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI-- 102
           + ++  ++YRS QPN     +L++   +++I+ L  + P     + +    +  IQL+  
Sbjct: 10  YGMIEEDLYRSGQPNELNFPFLER-LSLRTIIYLALEEPN---LQFQSFVEEQEIQLVFL 65

Query: 103 --NFPLSATR----ELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
             N  + + R     L++E +   + I+   +  PL I C  G DRTG        I   
Sbjct: 66  GGNTRMESRRKAWEPLSEETVLAALDIILDRSNYPLYITCHLGRDRTGAVVGCLRKI-QG 124

Query: 156 Y 156
           +
Sbjct: 125 W 125


>gi|71018997|ref|XP_759729.1| hypothetical protein UM03582.1 [Ustilago maydis 521]
 gi|46099240|gb|EAK84473.1| hypothetical protein UM03582.1 [Ustilago maydis 521]
          Length = 632

 Score = 78.4 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 47/112 (41%), Gaps = 10/112 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+     NF A+V   IYRS  PN    E+L +   +K++L L     E +         
Sbjct: 394 TLIVPPLNF-AMVSRGIYRSGHPNERNFEFL-RRLSLKTVLYL---GTEDYRSNMTNWTA 448

Query: 96  DLGIQLINFPLSATRELNDEQ-----IKQLISILKTAPKPLLIHCKSGADRT 142
              I   +  L+  +E   E      +K L  ILK    P+LIHC  G  R+
Sbjct: 449 SQNITTHHLRLAINKEPTAEMDHADVVKALQLILKPENWPILIHCNKGKYRS 500


>gi|75909258|ref|YP_323554.1| hypothetical protein Ava_3049 [Anabaena variabilis ATCC 29413]
 gi|75702983|gb|ABA22659.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 141

 Score = 78.0 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V  E     QP    ++ L  E G KS++NLR         +EE+ A   G++ +N P+ 
Sbjct: 7   VSDEFSAGGQPTTETLKQLADE-GYKSVVNLRSLDEAGALADEEQQAQAAGLEYVNVPIK 65

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           +T   N     +++S L+  P P+  HC +G
Sbjct: 66  STEA-NHNSTAKVLSELEKLPTPVYFHCGAG 95


>gi|256372485|ref|YP_003110309.1| protein tyrosine/serine phosphatase [Acidimicrobium ferrooxidans
           DSM 10331]
 gi|256009069|gb|ACU54636.1| protein tyrosine/serine phosphatase [Acidimicrobium ferrooxidans
           DSM 10331]
          Length = 239

 Score = 78.0 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 63/174 (36%), Gaps = 31/174 (17%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
             F  +     N H + P  + RS QP   + T    L + Y I  IL+LR     +   
Sbjct: 17  WNFRPVEAILANGHRLRPGRLLRSEQPYRLDATQRRQLLERYAIGKILDLRTAEECA--P 74

Query: 89  EEEKAANDLGIQLINFPLSAT------------RELNDEQIKQLISILKTA--PKPLLIH 134
            E   A    + L +                  R + D+    L+  +     P P+L+H
Sbjct: 75  TESIDAPRTHLPLPDVSRDPRIADGSRNLAGAYRAMLDDHAPTLVRAIDAIGVPTPVLVH 134

Query: 135 CKSGADRTGLASAVYLYIVAHYPKE------------EAHRQLSMLYGHFPVLK 176
           C +G DRTG+  A+ L +V     +             A  + ++  G+ P  +
Sbjct: 135 CTAGKDRTGIVVALTLELVGARRDDIVRDYVESGRRLAALTERALARGYEPTWR 188


>gi|330827548|ref|XP_003291836.1| hypothetical protein DICPUDRAFT_156475 [Dictyostelium purpureum]
 gi|325077959|gb|EGC31638.1| hypothetical protein DICPUDRAFT_156475 [Dictyostelium purpureum]
          Length = 167

 Score = 78.0 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 51/127 (40%), Gaps = 11/127 (8%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           +       NF  V    +YRS QPN     +L+K   +K I+ L    P+   ++ +   
Sbjct: 1   MAHHIPPLNFGMVADD-LYRSGQPNELNFPFLEK-LQLKKIIFL---APDDPSQQFQNFV 55

Query: 95  NDLGIQLINFPLSA----TRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVY 149
            D  I+LI+  +         +++E +   + I+      PL++ C  G  RTG      
Sbjct: 56  EDQDIELIHLGMDTHQNPWNPISEEIVISALKIILNMESYPLMVMCNLGRHRTGTVIGCL 115

Query: 150 LYIVAHY 156
             +   +
Sbjct: 116 RKL-QRW 121


>gi|50553744|ref|XP_504283.1| YALI0E22880p [Yarrowia lipolytica]
 gi|74633417|sp|Q6C4X9|OCA1_YARLI RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|49650152|emb|CAG79882.1| YALI0E22880p [Yarrowia lipolytica]
          Length = 253

 Score = 77.6 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 52/149 (34%), Gaps = 13/149 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V  + +YRS QP      +L+K   +++IL L  + P          A+D  I + 
Sbjct: 93  NFGPVERN-LYRSGQPEPISFPFLEK-LRLRTILWLAVEDPSDNFLA---FADDHEIVVH 147

Query: 103 NFPL-----SATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +  L     +   +L +  I   + I +     PLL+ C  G  RTG        +   +
Sbjct: 148 HLGLVTEGTNPWDQLTESSIVAALQIIMDRDSYPLLVCCGMGRHRTGTIVGCLRRL-QGW 206

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFE 185
                  +    Y      + +       
Sbjct: 207 NLASVSEEYR-RYAGSRGGRALIELHIEA 234


>gi|258568280|ref|XP_002584884.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237906330|gb|EEP80731.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 262

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 55/157 (35%), Gaps = 33/157 (21%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P     E +KK   +K+IL L   +     ++  K   D GI
Sbjct: 54  LPPNFAEVVKG-IYRSSFPLPDHFESIKK-LNLKTILTL---VDFEHSRQFRKFIKDNGI 108

Query: 100 QLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKSGA-------DRTGLASA 147
                P+ A ++         +  ++ IL      P+L+HC  G        D       
Sbjct: 109 VSHVIPIIANKDPKIFTPQNTVLDVLKILFNPKNHPILVHCNKGKVFSSNAEDS------ 162

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
                   +    A  +    Y  +   K+  +D  F
Sbjct: 163 ------RGWSNAAAVAE----YIKYSTPKSRVLDRKF 189


>gi|302867762|ref|YP_003836399.1| tyrosine phosphatase [Micromonospora aurantiaca ATCC 27029]
 gi|302570621|gb|ADL46823.1| tyrosine phosphatase [Micromonospora aurantiaca ATCC 27029]
          Length = 226

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 50  HEIYRSA---QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
             +YRS             L+ + G++++++LR         +       LG++  +FP+
Sbjct: 32  GVLYRSGALHLLTPEGARELE-DLGLRTVIDLRSIRE---VADRPDRCAGLGVKHCHFPV 87

Query: 107 SATRELNDEQI-----------KQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
              +   D+Q+           +  ++I++        P L+HC SG DRTG+  AV
Sbjct: 88  FTEQSWPDDQVALYPYMAEQAGRATVAIIRQLITPGALPALVHCASGKDRTGVVVAV 144


>gi|281210434|gb|EFA84600.1| putative tyrosine phosphatase family protein [Polysphondylium
           pallidum PN500]
          Length = 167

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 51/135 (37%), Gaps = 11/135 (8%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           +       NF  V    +YRS QPN     +L+K   +K I+ L    P+   ++     
Sbjct: 1   MAHHIPPLNFGMVADD-LYRSGQPNELNFPFLEK-LQLKKIIFL---APDDPSQQFVNFC 55

Query: 95  NDLGIQLINFPLSA----TRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVY 149
           +D  I+LI+  +         ++++ +   + I L     PL I C  G  RTG      
Sbjct: 56  DDQDIELIHLGMDTHTNPWNPISEDIVISALKIVLDPDSYPLHIMCNLGRHRTGTVVGCL 115

Query: 150 LYIVAHYPKEEAHRQ 164
             +   +       +
Sbjct: 116 RKL-QRWNLTSILEE 129


>gi|88799531|ref|ZP_01115108.1| protein tyrosine/serine phosphatase [Reinekea sp. MED297]
 gi|88777841|gb|EAR09039.1| protein tyrosine/serine phosphatase [Reinekea sp. MED297]
          Length = 132

 Score = 77.2 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +  F  N H +  H ++RS QP+   I       G ++I+NLRG      +  E++A   
Sbjct: 44  LRAFWSNLHPLT-HSVWRSNQPSPRRIRR-LARRGFRTIVNLRGPSRWGSYALEKEACEQ 101

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA 127
            G+ LIN  + + R    ++++   ++ ++ 
Sbjct: 102 SGLTLINHKMYSRRMPTFKELQATKALFESL 132


>gi|89069500|ref|ZP_01156850.1| hypothetical protein OG2516_04199 [Oceanicola granulosus HTCC2516]
 gi|89044981|gb|EAR51068.1| hypothetical protein OG2516_04199 [Oceanicola granulosus HTCC2516]
          Length = 149

 Score = 76.8 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query: 58  PNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
           P+   +   +K+ G ++++NLR   + PE    EEE+ A + G+  ++ P +A   L+  
Sbjct: 18  PDQAALAQAQKD-GFRAVVNLRTASEKPEIAPDEEERIAREAGLAYLHHPTAADG-LDAA 75

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL 175
            + +    L + P P+L+HC SG  R G  + + L     +  +EA              
Sbjct: 76  HVDEFRRHLASLPDPVLVHCASGK-RAGALTLMALGAENGWSGDEALA----------HG 124

Query: 176 KTITMDITFEKI 187
           +   +D+  E+I
Sbjct: 125 RQAGLDLANEQI 136


>gi|149176007|ref|ZP_01854624.1| hypothetical protein PM8797T_04110 [Planctomyces maris DSM 8797]
 gi|148845161|gb|EDL59507.1| hypothetical protein PM8797T_04110 [Planctomyces maris DSM 8797]
          Length = 149

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 6/110 (5%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLRGKLPESWHK---EEEKAANDLGIQLINFPLSATRELN 113
           QP+   I  L ++ G KS++N R +  +        E++  ND  ++ ++ P+S  + + 
Sbjct: 16  QPSAEEINQLSQQ-GFKSVVNFRTEGEDEQPLSPTAEKEKVNDAEMEYLHIPVSM-KAMG 73

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
            E + +        PKP+  HCKSG  R G    ++L +      EE  +
Sbjct: 74  PELVDEFREKYPQLPKPVFAHCKSGK-RAGAMVMMHLAVEEGMGGEETLQ 122


>gi|83646875|ref|YP_435310.1| hypothetical protein HCH_04178 [Hahella chejuensis KCTC 2396]
 gi|83634918|gb|ABC30885.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 153

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           ++    N     P E++    P       ++   G+K++++L    P           ++
Sbjct: 5   VSLLLPNLRRPQP-ELFTCGLPAPDDFPRIRAA-GVKTVVSL--CQPHETPLLNAFPVDN 60

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAH 155
            G+QL + P++  ++L +   + L  IL  A   P+L+HC S ++R G   A+  + V  
Sbjct: 61  QGLQLFSIPVAGPQDLTEANARALADILNEAENCPVLVHCMS-SNRVGALLALKAFFVDG 119

Query: 156 YPKEEAH 162
              EEA 
Sbjct: 120 ASLEEAL 126


>gi|307299829|ref|ZP_07579617.1| protein tyrosine/serine phosphatase [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306914530|gb|EFN44928.1| protein tyrosine/serine phosphatase [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 351

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 17/133 (12%)

Query: 43  NFHAVV-----PHEIYRSAQPNGTF-----IEYLKKEYGIKSILNLRGKLPESWHKEEE- 91
           NF  +      P ++YR + P+           L ++ GIK+++NL     E     E  
Sbjct: 146 NFREITLGDIAPGKLYRCSHPSIDDPRAPYASALIEQAGIKTVINLSDSDEELASNLEYS 205

Query: 92  ---KAANDLGIQLINFPLSATRELND--EQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
              K+ ++ G  LIN  +      +D  +++ + +  +     P LIHC  G DR G+AS
Sbjct: 206 EYYKSISEAG-NLINLNMGVDPLADDFAKKLGEGLRFMIAHEPPYLIHCVEGKDRAGIAS 264

Query: 147 AVYLYIVAHYPKE 159
           A+   I+     E
Sbjct: 265 ALLGAIMNAKTDE 277


>gi|21233249|ref|NP_639166.1| hypothetical protein XCC3821 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66770191|ref|YP_244953.1| hypothetical protein XC_3893 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188993402|ref|YP_001905412.1| hypothetical protein xccb100_4007 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21115083|gb|AAM43057.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575523|gb|AAY50933.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167735162|emb|CAP53374.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 166

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 54/116 (46%), Gaps = 5/116 (4%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
           P  +  + QP+   +       G+ ++++LRG      + +E  +A+ LG++ +  P+  
Sbjct: 30  PRAVLSAGQPSQAQLREAAAN-GVTTVIDLRGPDEARGY-DETASAHALGLRYVRLPIRT 87

Query: 109 TRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
              L  + ++ L  +L   A   +L+HC SG +R G   A+ L        E+A +
Sbjct: 88  AAGLTPDNVRALQRVLDQQAQGKVLLHCASG-NRAGALLAL-LAAREGASAEQALQ 141


>gi|298705736|emb|CBJ49044.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 167

 Score = 76.5 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 49/117 (41%), Gaps = 11/117 (9%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V   +YRSA PN     +L++  G+K+I+ L     +    +      D  + L++   
Sbjct: 10  LVEEGLYRSALPNEINYPFLER-LGLKTIIYL--YPDDDIDAQLVSFLEDQDVTLVSLGE 66

Query: 107 ------SATRELNDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
                  +   + +E +   +  I+ +   P+LI C +G  RTG   A    +   +
Sbjct: 67  HDDKRNKSWAPVGEEIVLAALERIVDSVHYPVLITCNTGKHRTGTVVACLRKL-QRW 122


>gi|254425829|ref|ZP_05039546.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
 gi|196188252|gb|EDX83217.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
          Length = 121

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           + QP+    E L  + G +S++NLR         E++     LG+  ++ P++ + E+  
Sbjct: 15  AGQPDPNQFESLASQ-GFRSVINLRPYAEPGATAEDQHRIESLGLPYVHLPITYS-EITP 72

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             I   +  + + PKPLLI+CKS + R  L S  Y     +  
Sbjct: 73  SVIDSAVQQVHSLPKPLLIYCKS-SLRAILLSLFYEITYQYQT 114


>gi|296137034|ref|YP_003644276.1| protein of unknown function DUF442 [Thiomonas intermedia K12]
 gi|295797156|gb|ADG31946.1| protein of unknown function DUF442 [Thiomonas intermedia K12]
          Length = 163

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 50/129 (38%), Gaps = 4/129 (3%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             ++ S Q +   +  L    G+ +++NL           E +    LG+  ++ P+   
Sbjct: 19  EGLWCSGQLSVADMARLPA-LGVATVINLALPTSSKALSGEAEQVTSLGMNYVHIPV-LW 76

Query: 110 RELNDEQIKQLISILKTA-PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSML 168
                 Q +Q   ++     +P+ +HC     R      +Y  ++    +E+A   +S +
Sbjct: 77  DAPKPVQFEQFAGVMAALGQQPVWLHCAKNM-RASAFVYLYRLLIRGETEEQASWPMSQI 135

Query: 169 YGHFPVLKT 177
           +   PV + 
Sbjct: 136 WAPNPVWQQ 144


>gi|299769695|ref|YP_003731721.1| hypothetical protein AOLE_07275 [Acinetobacter sp. DR1]
 gi|298699783|gb|ADI90348.1| hypothetical protein AOLE_07275 [Acinetobacter sp. DR1]
          Length = 174

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 5/111 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL      ++ + E++   DLG+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSAEQLK-LIKEYGCSTVINLALSNAPNYIENEDRICLDLGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 + EQ   ++ ++      + + IHC S  DR+     VY     +
Sbjct: 75  D-WETPSAEQCLLVLDLIDHLVQNEIVWIHC-SKNDRSSCLMYVYRQFYMN 123


>gi|111226554|ref|XP_001134556.1| hypothetical protein DDB_G0281953 [Dictyostelium discoideum AX4]
 gi|121962478|sp|Q1ZXG8|D1060_DICDI RecName: Full=Probable tyrosine-protein phosphatase DG1060;
           AltName: Full=Developmental gene 1060 protein
 gi|90970644|gb|EAS66873.1| hypothetical protein DDB_G0281953 [Dictyostelium discoideum AX4]
          Length = 166

 Score = 76.1 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 50/127 (39%), Gaps = 11/127 (8%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           +       NF  V    +YRS QPN     +L+K   +K I+ L    P+   ++ +   
Sbjct: 1   MAHHIPPLNFGMVADD-LYRSGQPNELNFPFLEK-LQLKKIIFL---APDDPSQQFQNFV 55

Query: 95  NDLGIQLINFPLSA----TRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVY 149
            D  I+LI+  +         +++E +   + I+      PL I C  G  RTG      
Sbjct: 56  EDQDIELIHLGMDTHQNPWNPISEEIVISALKIILNPDNYPLHIMCNLGRHRTGTVVGCL 115

Query: 150 LYIVAHY 156
             +   +
Sbjct: 116 RKL-QRW 121


>gi|315125789|ref|YP_004067792.1| hypothetical protein PSM_A0691 [Pseudoalteromonas sp. SM9913]
 gi|315014303|gb|ADT67641.1| conserved hypothetical protein [Pseudoalteromonas sp. SM9913]
          Length = 176

 Score = 75.7 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF A   + ++ +AQP     + L  +  +K ++NLR    + W  +E    N LG+  
Sbjct: 39  KNFAA-HNNLVFSAAQPTDEQFKQL-SQANVKHVINLRAADEQDW--DEGALVNSLGMSY 94

Query: 102 INFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
              P++  +++N +  K+L S+L+      +++HC S ++R G   A+  +       E 
Sbjct: 95  HAIPIAGAQDVNIDNAKRLASLLEELKGESVVVHCAS-SNRVGALMAISAHQ-QGADIES 152

Query: 161 AHR 163
           A  
Sbjct: 153 AIE 155


>gi|320104939|ref|YP_004180530.1| hypothetical protein Isop_3423 [Isosphaera pallida ATCC 43644]
 gi|319752221|gb|ADV63981.1| hypothetical protein Isop_3423 [Isosphaera pallida ATCC 43644]
          Length = 231

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 3/124 (2%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLG--IQLI 102
            + P  + R A      +  L +  GI+SI+ L    P+   +  +  A   +G  I+ I
Sbjct: 54  VIEPGGLVRGAWQKPGPLRRLLEREGIRSIVTLTAINPDDPKYVGQANALAGVGRPIRWI 113

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
                 +    ++  +    +   + +P+  HC +G  RTGLA A YL     +   +A 
Sbjct: 114 QLDWRGSTATLEQMAQAADLLADQSLRPIFFHCVAGHHRTGLAHAAYLIRHRGFTAAQAW 173

Query: 163 RQLS 166
            QLS
Sbjct: 174 DQLS 177


>gi|149178973|ref|ZP_01857548.1| hypothetical protein PM8797T_10484 [Planctomyces maris DSM 8797]
 gi|148842172|gb|EDL56560.1| hypothetical protein PM8797T_10484 [Planctomyces maris DSM 8797]
          Length = 149

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 6/110 (5%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRELN 113
           QPN   I    K  G K+I+N R    +      + EE+      ++ ++ P+S    L+
Sbjct: 16  QPNHKEIYEFGKN-GFKTIVNFRAPHEKDQPINPQAEEQIVKGADMEYLHIPVSMN-SLD 73

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           +  + Q     +  PKP+  HCKSG  R G    + L +      E+  +
Sbjct: 74  ESLVDQFREQYEALPKPIFAHCKSGK-RAGAMVMMDLAVKQGMSGEQTLQ 122


>gi|296827050|ref|XP_002851107.1| tyrosine-protein phosphatase SIW14 [Arthroderma otae CBS 113480]
 gi|238838661|gb|EEQ28323.1| tyrosine-protein phosphatase SIW14 [Arthroderma otae CBS 113480]
          Length = 252

 Score = 75.7 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 54/147 (36%), Gaps = 29/147 (19%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
              NF  VV   IYRS+ P    +  L  +  +K+I+ L   + E W  E      D  I
Sbjct: 53  MPNNFTEVVKG-IYRSSFPMPVHLSSL-AQLKLKTIVTL---VDEKWSPEYIAFVRDNAI 107

Query: 100 QLINFPLSATRELND----EQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
                P+ A ++ +       I ++++IL +    P+L+HC  G                
Sbjct: 108 TSYVIPILANKQADVYTPISTIIEVLTILLEPRNHPVLVHCNKGK--------------- 152

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +    A  +    Y      KT  +D
Sbjct: 153 GWTCVAALAE----YIQHASPKTRVLD 175


>gi|255725068|ref|XP_002547463.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240135354|gb|EER34908.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 213

 Score = 75.3 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 39/190 (20%), Positives = 65/190 (34%), Gaps = 39/190 (20%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA-------- 94
           NF  V  + IYRS  P      +L+ +  +K+I+ L     E      +           
Sbjct: 29  NFSLVE-NGIYRSGFPMPINYPFLQ-QLNLKTIIYLGDLGNEELKSSSKSKKKKDKHGTA 86

Query: 95  -----------NDLGIQLINFPLSATREL--NDEQIKQLIS--------ILKTAPKPLLI 133
                      ND  IQ  N    +++E     + I+Q           IL     P+LI
Sbjct: 87  EIMNNYLDWIKNDTDIQFHNLYFESSQEPFNKPQDIEQATKSLTIALQLILNKQNHPILI 146

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPN 193
           H   G  RTG+   +   ++  +       +    Y  F + K+   +   E I  L+  
Sbjct: 147 HSNKGKHRTGVLIGLMRKVLQGWCLSGIFEE----YEKFAMGKS---EYDLELIE-LWQP 198

Query: 194 NVSKGDTEQP 203
            +   D  +P
Sbjct: 199 ELYIDDNNKP 208


>gi|288960214|ref|YP_003450554.1| hypothetical protein AZL_a04790 [Azospirillum sp. B510]
 gi|288912522|dbj|BAI74010.1| hypothetical protein AZL_a04790 [Azospirillum sp. B510]
          Length = 147

 Score = 75.3 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 56/117 (47%), Gaps = 6/117 (5%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRG---KLPESWHKEEEKAANDLGIQLINFPL 106
            ++    QP+G  ++ LK + G++S++NLR    +   S   EE + A  LG+  ++ P+
Sbjct: 10  GKLLAGEQPSGDDLDVLKAQ-GVRSVVNLREDGERDRPSIPAEEGRQAEALGLSFVHLPV 68

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           +   EL+ E ++Q    +   P P+ +HC  G  R    + +          E+A R
Sbjct: 69  TVP-ELSPELVEQFRRTVDALPGPVYVHCGLGQ-RAVTLALIVDAQDTGASAEDAIR 123


>gi|315505835|ref|YP_004084722.1| protein tyrosine/serine phosphatase [Micromonospora sp. L5]
 gi|315412454|gb|ADU10571.1| protein tyrosine/serine phosphatase [Micromonospora sp. L5]
          Length = 226

 Score = 75.3 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 49/117 (41%), Gaps = 22/117 (18%)

Query: 50  HEIYRSA---QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
             +YRS             L+ + G++++++LR         +       L ++  +FP+
Sbjct: 32  GVLYRSGALHLLTPEGARELE-DLGLRTVIDLRSIRE---VADRPDRCAGLDVEHCHFPV 87

Query: 107 SATRELNDEQI-----------KQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
              +   D+Q+           +  ++I++        P L+HC SG DRTG+  AV
Sbjct: 88  FTDQSWPDDQVALYPYMAEQAGRATVAIIRQLITPGALPALVHCASGKDRTGVVVAV 144


>gi|241952178|ref|XP_002418811.1| tyrosine phosphatase, putative [Candida dubliniensis CD36]
 gi|223642150|emb|CAX44117.1| tyrosine phosphatase, putative [Candida dubliniensis CD36]
          Length = 216

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 69/186 (37%), Gaps = 35/186 (18%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN------- 95
           NF  V  + IYRS  P      +L K+  +K+I+ L     ++  K ++K  +       
Sbjct: 36  NFSLVE-NGIYRSGFPMPINYPFL-KQLRLKTIIYLGDLGNQTSSKSKKKDKHGTAEIMN 93

Query: 96  --------DLGIQLINFPLSATREL--NDEQIKQLIS--------ILKTAPKPLLIHCKS 137
                   D  I+  N    +++E     E I+Q           IL     P+LIH   
Sbjct: 94  NYLDWIKNDTEIRFYNLLFESSQEPFNKPEDIQQATQSLTFALQLILNKENYPILIHSNK 153

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           G  RTG+   +   ++  +       +    Y  F + K+   +   E I  L+   +  
Sbjct: 154 GKHRTGVLIGIMRKVLQGWCLSGIFEE----YEKFAMGKS---EYDLELIE-LWQPELYI 205

Query: 198 GDTEQP 203
            D  +P
Sbjct: 206 DDANKP 211


>gi|68483608|ref|XP_714257.1| hypothetical protein CaO19.4086 [Candida albicans SC5314]
 gi|68483881|ref|XP_714119.1| hypothetical protein CaO19.11567 [Candida albicans SC5314]
 gi|46435653|gb|EAK95030.1| hypothetical protein CaO19.11567 [Candida albicans SC5314]
 gi|46435810|gb|EAK95184.1| hypothetical protein CaO19.4086 [Candida albicans SC5314]
          Length = 216

 Score = 74.9 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 69/186 (37%), Gaps = 35/186 (18%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN------- 95
           NF  V  + IYRS  P      +L K+  +K+I+ L     ++  K ++K  +       
Sbjct: 36  NFSLVE-NGIYRSGFPMPINYPFL-KQLRLKTIIYLGDLGNQTSKKGKKKDKHGTAEIMN 93

Query: 96  --------DLGIQLINFPLSATREL--NDEQIKQLIS--------ILKTAPKPLLIHCKS 137
                   D  I+  N    +++E     + I+Q           IL     P+LIH   
Sbjct: 94  NYLDWIKNDTEIRFYNLLFESSQEPFNKPDDIQQATQSLTFALQLILNKENYPILIHSNK 153

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           G  RTG+   +   ++  +       +    Y  F + K+   +   E I  L+   +  
Sbjct: 154 GKHRTGVLIGIMRKVLQGWCLSGIFEE----YEKFAMGKS---EYDLELIE-LWQPELYI 205

Query: 198 GDTEQP 203
            D  +P
Sbjct: 206 DDANKP 211


>gi|238883787|gb|EEQ47425.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 216

 Score = 74.9 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 69/186 (37%), Gaps = 35/186 (18%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN------- 95
           NF  V  + IYRS  P      +L K+  +K+I+ L     ++  K ++K  +       
Sbjct: 36  NFSLVE-NGIYRSGFPMPINYPFL-KQLRLKTIIYLGDLGNQTSKKGKKKDKHGTAEIMN 93

Query: 96  --------DLGIQLINFPLSATREL--NDEQIKQLIS--------ILKTAPKPLLIHCKS 137
                   D  I+  N    +++E     + I+Q           IL     P+LIH   
Sbjct: 94  NYLDWIKNDTEIRFYNLLFESSQEPFNKPDDIQQATQSLTFALQLILNKENYPILIHSNK 153

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           G  RTG+   +   ++  +       +    Y  F + K+   +   E I  L+   +  
Sbjct: 154 GKHRTGVLIGIMRKVLQGWCLSGIFEE----YEKFAMGKS---EYDLELIE-LWQPELYI 205

Query: 198 GDTEQP 203
            D  +P
Sbjct: 206 DDANKP 211


>gi|30248796|ref|NP_840866.1| hypothetical protein NE0792 [Nitrosomonas europaea ATCC 19718]
 gi|30180391|emb|CAD84703.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 177

 Score = 74.5 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 6/110 (5%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           S       I+ L K +  +++++LR +   +    E+KA   +GI  IN P++    +N+
Sbjct: 47  SGALTKDGIQELVK-HSFQTVIDLRSESEGT--PSEKKAVEAVGITYINIPVTG-EGVNE 102

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
            Q+      L+ A  P+LIHC +G +R G     Y         E A ++
Sbjct: 103 SQLTAFKQALEQAAPPVLIHCATG-NRAGAMWTAYRLS-EGIAPEIAFKE 150


>gi|87118863|ref|ZP_01074762.1| tyrosine-specific protein phosphatase, putative [Marinomonas sp.
           MED121]
 gi|86166497|gb|EAQ67763.1| tyrosine-specific protein phosphatase, putative [Marinomonas sp.
           MED121]
          Length = 165

 Score = 74.5 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 16/119 (13%)

Query: 54  RSA-QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS----- 107
           RS    +   +  LK++ GI +IL++     ES    E + A   GI   N P+S     
Sbjct: 15  RSGPNLDTWNLAELKEQ-GIAAILSV--NFSESVDSREMEGA---GIAHANIPMSPNAPV 68

Query: 108 --ATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
               +E     + + ++ +K   A  P++IHC+SG DRTGL  A YL        +EA 
Sbjct: 69  QLGDKETCLANLPKAMAFIKAQKAAGPVMIHCRSGKDRTGLVMAAYLVQFEGMTAKEAM 127


>gi|117919871|ref|YP_869063.1| Dual specificity protein phosphatase [Shewanella sp. ANA-3]
 gi|117612203|gb|ABK47657.1| dual specificity protein phosphatase [Shewanella sp. ANA-3]
          Length = 156

 Score = 74.5 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 58/137 (42%), Gaps = 21/137 (15%)

Query: 41  TQNFHAVVPHEIY-RSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
            Q+   +V  +I  RS  P  +   +  L K  GI+++L++ G         E  +    
Sbjct: 1   MQHLFWLVEGKIAGRSG-PNKDPWDLAEL-KSLGIRAVLSVNGGEGC-----EPGSFKHH 53

Query: 98  GIQLINFPLSATRELND-------EQIKQLISILKTAPK---PLLIHCKSGADRTGLASA 147
           G++    P S      +        Q+ + ++ ++       P+LIHC+SG DRTGL  A
Sbjct: 54  GLRYECIPFSRNVPPQEGDVAICVAQLPRALAFIQQCEADNLPVLIHCRSGKDRTGLIMA 113

Query: 148 VYLYIVAHYPKEEAHRQ 164
            YL +    P   A  Q
Sbjct: 114 YYLMVNGAAPL-HAVSQ 129


>gi|325918190|ref|ZP_08180339.1| hypothetical protein XVE_4365 [Xanthomonas vesicatoria ATCC 35937]
 gi|325535597|gb|EGD07444.1| hypothetical protein XVE_4365 [Xanthomonas vesicatoria ATCC 35937]
          Length = 165

 Score = 74.1 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 5/120 (4%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           HA     +  S QP    +     + G+ ++++LRG   E    +E  A   LG++ +  
Sbjct: 25  HAGSTGNLSSSGQPTQADLRAAAAK-GVTTVIDLRGP-EEPRGYDEIAATEALGLRYVRL 82

Query: 105 PLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           P+     L  E  + L   L       +L+HC +G +R G   A+ L        E+A +
Sbjct: 83  PVRNADALTPEAARVLQRALDQQQHGAVLLHCATG-NRAGALLAL-LAAREGASTEQALQ 140


>gi|29348713|ref|NP_812216.1| hypothetical protein BT_3304 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29340619|gb|AAO78410.1| possible protein-tyrosine-phosphatase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 356

 Score = 74.1 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 63/161 (39%), Gaps = 38/161 (23%)

Query: 50  HEIYRSAQPNGTFI--EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
             +YRSAQ +          K  GI++I++LR +     + +     +D    +++ P++
Sbjct: 134 GMLYRSAQIDSIPFCSRRELKNMGIRTIIDLRSEEERHNYPQ----LHDEDFNVLHLPIA 189

Query: 108 A-----------TRELNDEQIKQLIS--------------------ILKTAPKPLLIHCK 136
                        +++  + I +L+                     +L     P++IHC 
Sbjct: 190 TGNMEHILQDIRDKKIETDTIYRLVERMNRQLVTNYRKEYKELFTLLLDRNNYPVVIHCT 249

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           SG  RTG+ SA+ L  +    +E   +   +   +F + K 
Sbjct: 250 SGKGRTGIVSALVLAAL-GVNEEAIMKDYRLSNDYFNIPKA 289


>gi|219848061|ref|YP_002462494.1| hypothetical protein Cagg_1148 [Chloroflexus aggregans DSM 9485]
 gi|219542320|gb|ACL24058.1| protein of unknown function DUF442 [Chloroflexus aggregans DSM
           9485]
          Length = 164

 Score = 74.1 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 7/123 (5%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           +AV    +  +AQP     +      G K++LN+R     +  +         G+  I+ 
Sbjct: 21  YAVTDRVLL-AAQPQPEDWQRFVAA-GYKTVLNIRSDPERAAVQAANAR--AAGLHYIHV 76

Query: 105 PLSATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           P  A  EL  E + +   I++      L+ HC+S A R GL   +Y  +   + +E+A  
Sbjct: 77  PWPAY-ELEPEHLAEFARIVEAPETGKLVFHCRS-ATRVGLIWMLYRIVHQGWTREQAEA 134

Query: 164 QLS 166
           +L 
Sbjct: 135 ELR 137


>gi|320169800|gb|EFW46699.1| hypothetical protein CAOG_04657 [Capsaspora owczarzaki ATCC 30864]
          Length = 436

 Score = 74.1 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 66/162 (40%), Gaps = 17/162 (10%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF-- 104
           +V  ++YR A P      +L +   +K++L+L  K P+S          + G+Q I    
Sbjct: 14  IVDEQVYRGAYPTHLNFAFLAR-LKLKTVLSLTPKKPDSNIDF---FCKEEGVQNIFIQV 69

Query: 105 -PLSATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
                   L  + I Q++ IL  A   P+ IHC  GA+ TGL   ++L  +  +    A 
Sbjct: 70  DKFKENVTLTHQHIVQILPILLNASCHPIYIHCLDGANVTGLVV-MFLRRIQQWTVASAV 128

Query: 163 RQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPM 204
            +           +   M  T +++  +    +     E+P+
Sbjct: 129 IE------FARYTRDGLM--TPDELELVETFRMDTVRLEKPL 162


>gi|261331380|emb|CBH14374.1| tyrosine phosphatase, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 481

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
           A+V   +YR A P      +L +  G+++I++L    PE    +  + A   GI + +  
Sbjct: 88  AIVEEGVYRGAYPTLRNFPFL-RSLGLRTIVSL---TPEEPTYDLSRFAAAEGITIRHIQ 143

Query: 106 LSATR---ELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +   +   +L    + +++ +L  A   PL IHC  G   TGL   + L  + H+  
Sbjct: 144 VEQNKGEAQLMPTDMSEVLQMLADAEQHPLYIHCLDGRHTTGLVV-MGLRKLQHWSV 199


>gi|253568944|ref|ZP_04846354.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251840963|gb|EES69044.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 356

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 63/161 (39%), Gaps = 38/161 (23%)

Query: 50  HEIYRSAQPNGTFI--EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
             +YRSAQ +          K  GI++I++LR +     + +     +D    +++ P++
Sbjct: 134 GMLYRSAQIDSIPFCSRRELKNMGIRTIIDLRSEEERHNYPQ----FHDEDFNVLHLPIA 189

Query: 108 A-----------TRELNDEQIKQLIS--------------------ILKTAPKPLLIHCK 136
                        +++  + I +L+                     +L     P++IHC 
Sbjct: 190 TGNMEHILQDIRDKKIETDTIYRLVERMNRQLVTNYRKEYKELFTLLLDRNNYPVVIHCT 249

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           SG  RTG+ SA+ L  +    +E   +   +   +F + K 
Sbjct: 250 SGKGRTGIVSALVLAAL-GVNEEAIMKDYRLSNDYFNIPKA 289


>gi|71745060|ref|XP_827160.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70831325|gb|EAN76830.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 481

 Score = 73.8 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
           A+V   +YR A P      +L +  G+++I++L    PE    +  + A   GI + +  
Sbjct: 88  AIVEEGVYRGAYPTLRNFPFL-RSLGLRTIVSL---TPEEPTYDLSRFAAAEGITIRHIQ 143

Query: 106 LSATR---ELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +   +   +L    + +++ +L  A   PL IHC  G   TGL   + L  + H+  
Sbjct: 144 VEQNKGEAQLMPTDMSEVLQMLADAEQHPLYIHCLDGRHTTGLVV-MGLRKLQHWSV 199


>gi|24374642|ref|NP_718685.1| tyrosine-specific protein phosphatase, putative [Shewanella
           oneidensis MR-1]
 gi|24349272|gb|AAN56129.1|AE015749_6 tyrosine-specific protein phosphatase, putative [Shewanella
           oneidensis MR-1]
          Length = 156

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 54/137 (39%), Gaps = 21/137 (15%)

Query: 41  TQNFHAVVPHEIY-RSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
            Q+   +V  +I  RS  P  +   +  LK   GI+++L++ G         E  +    
Sbjct: 1   MQHLFWLVEGKIAGRSG-PNKDPWDLAELKAA-GIRAVLSVNGGEGC-----EPGSFQHH 53

Query: 98  GIQLINFPLSATRELNDEQI----------KQLISILKTAPKPLLIHCKSGADRTGLASA 147
           G++    P S      D  I             I   +    P+L+HC+SG DRTGL  A
Sbjct: 54  GLRYECIPFSRNVPPQDGDIAVCVAQLPKALAFIQQCEADNLPVLVHCRSGKDRTGLIMA 113

Query: 148 VYLYIVAHYPKEEAHRQ 164
            YL +    P   A  Q
Sbjct: 114 YYLMVNGAAPL-HAVSQ 129


>gi|163845827|ref|YP_001633871.1| hypothetical protein Caur_0229 [Chloroflexus aurantiacus J-10-fl]
 gi|163667116|gb|ABY33482.1| protein of unknown function DUF442 [Chloroflexus aurantiacus
           J-10-fl]
          Length = 169

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 6/121 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           VV   +  +AQP     +    E G +++LN+R     +  +         G++ I+ P 
Sbjct: 27  VVTENVLLAAQPQPEDWQRFV-EAGYQTVLNIRSDPERAAQQAANAR--AAGLRYIHAPW 83

Query: 107 SATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            A  EL  E + +   I++  A   L+ HC+S A R GL   +Y  +   + +E+A  +L
Sbjct: 84  PAY-ELEPEHLAEFARIVEDPATGKLVFHCRS-ATRVGLIWMLYRMVHQGWSREQAEAEL 141

Query: 166 S 166
            
Sbjct: 142 R 142


>gi|294341211|emb|CAZ89612.1| putative (Phosphotyrosine protein) phosphatase II [Thiomonas sp.
           3As]
          Length = 163

 Score = 73.4 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 44/117 (37%), Gaps = 4/117 (3%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             ++ S Q +   I  L    G+ +++NL           E +    LG+  ++ P+   
Sbjct: 19  EGLWCSGQLSVADIARLPA-LGVATVINLALPTSSKALSGEAEQVTSLGMNYVHIPV-LW 76

Query: 110 RELNDEQIKQLISILKTA-PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
                 Q +Q   ++     +P+ +HC     R      +Y  ++    +E+A   +
Sbjct: 77  DAPKPVQFEQFAGVMAALGQQPVWLHCAKNM-RASAFVYLYRLLIRGETEEQASWPM 132


>gi|302813786|ref|XP_002988578.1| hypothetical protein SELMODRAFT_447369 [Selaginella moellendorffii]
 gi|300143685|gb|EFJ10374.1| hypothetical protein SELMODRAFT_447369 [Selaginella moellendorffii]
          Length = 774

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE-EKAANDLGIQLIN 103
           +A+V   +YR A P      +L K   +K+I++L    PE+   ++      D GI L +
Sbjct: 596 YAIVEESLYRGAYPTMKNFRFL-KRLHLKTIVSL---TPEAQPNKDLRSFCQDQGIHLQH 651

Query: 104 FPLSATREL---NDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYL 150
           F +   +++   +  Q+ +++  I+     P  +HC  GA  TGL      
Sbjct: 652 FHVDKFQDVVTLSHNQVVEILHRIISVENLPAYLHCLDGAHVTGLVVMCLR 702


>gi|330721568|gb|EGG99599.1| hypothetical protein imdm_917 [gamma proteobacterium IMCC2047]
          Length = 185

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE--EEKAANDLGIQLINFPLSAT 109
           IY   QP+   +  L K  G+K ++NLR    +S  ++  E +    LG+Q  + P++  
Sbjct: 51  IYTGGQPSQEALTALSKA-GVKHVINLRPLQEQSKTQDWSEAEFVESLGMQYHSIPVAGA 109

Query: 110 RELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ-LSM 167
            ++N E   +L  ++K+       +HC S ++R G   A++   V     ++A  +    
Sbjct: 110 ADVNLENATKLADLIKSIDGEATFLHCAS-SNRVGALKALHEGAVNGANSDQAIAEGKRW 168

Query: 168 LYG 170
             G
Sbjct: 169 GLG 171


>gi|222523538|ref|YP_002568008.1| hypothetical protein Chy400_0244 [Chloroflexus sp. Y-400-fl]
 gi|222447417|gb|ACM51683.1| protein of unknown function DUF442 [Chloroflexus sp. Y-400-fl]
          Length = 165

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 6/121 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           VV   +  +AQP     +    E G +++LN+R     +  +         G++ I+ P 
Sbjct: 23  VVTENVLLAAQPQPEDWQRFV-EAGYQTVLNIRSDPERAAQQAANAR--AAGLRYIHAPW 79

Query: 107 SATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            A  EL  E + +   I++  A   L+ HC+S A R GL   +Y  +   + +E+A  +L
Sbjct: 80  PAY-ELEPEHLAEFARIVEDPATGKLVFHCRS-ATRVGLIWMLYRMVHQGWSREQAEAEL 137

Query: 166 S 166
            
Sbjct: 138 R 138


>gi|311893837|dbj|BAJ26245.1| putative tyrosine phosphatase [Kitasatospora setae KM-6054]
          Length = 251

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 47/117 (40%), Gaps = 22/117 (18%)

Query: 50  HEIYRSA---QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
             +YRS    +        L +  G++++L+LR         +   A    GI+ ++ P+
Sbjct: 44  GVLYRSGALDRLTPDGARTL-RGLGVRTVLDLRSAPE---VADRPDALGGSGIRYLHVPV 99

Query: 107 SATRELNDEQ---------------IKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            A R    EQ                  +  +L    + +L+HC SG DRTG+  A+
Sbjct: 100 FAERRWPAEQAELYPLMGELAGRPVTAAVRQLLLPEHRAVLVHCASGKDRTGVVVAL 156


>gi|262279369|ref|ZP_06057154.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259720|gb|EEY78453.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 173

 Score = 73.0 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 52/111 (46%), Gaps = 5/111 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           V+   ++ SAQP+   ++ L KEYG  +++NL      +  + E++   DLG+  I+ P+
Sbjct: 16  VIHEHLFSSAQPSIEQLK-LIKEYGCSTVINLALSNAPNHIENEDRICLDLGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 + EQ   ++ ++      + + IHC    DR+     VY     +
Sbjct: 75  D-WETPSAEQCLLVLDLIDHLVQNEIVWIHCTK-NDRSSCLMYVYRQFYMN 123


>gi|220908249|ref|YP_002483560.1| hypothetical protein Cyan7425_2856 [Cyanothece sp. PCC 7425]
 gi|219864860|gb|ACL45199.1| protein of unknown function DUF442 [Cyanothece sp. PCC 7425]
          Length = 140

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +        QP    I+ L ++ G K+++NLR +       +E++ A  +G++ +N  L+
Sbjct: 7   ISDAFSAGGQPTPEQIKQLAEQ-GYKAVVNLRSQDEVGVLADEQQQAEAVGLEYVNVQLN 65

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
                + +   ++++ L+  P P+  HC +G
Sbjct: 66  P-GVADADLTAKVLTELEELPTPIYFHCGAG 95


>gi|163784481|ref|ZP_02179352.1| protein phosphatase, putative [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880249|gb|EDP73882.1| protein phosphatase, putative [Hydrogenivirga sp. 128-5-R1-1]
          Length = 150

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 50/121 (41%), Gaps = 9/121 (7%)

Query: 58  PNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
           P    +E LK+E GI +I+NL   L   +     +   + G ++I  P +    +  E  
Sbjct: 17  PEPQELETLKEE-GINTIINL---LEGDYGNFIAQKQKEAGFEVIRIPFNMYDPIPKEDF 72

Query: 118 KQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
             +   +K      K +L+HCK G  R+G   A YL         EA  ++ +  G  P 
Sbjct: 73  LAVYDYIKEISGKEKKVLVHCKYGKARSGTFLAGYLI-NEGKEYTEALNEV-IRKGFLPQ 130

Query: 175 L 175
            
Sbjct: 131 T 131


>gi|149177621|ref|ZP_01856223.1| hypothetical protein PM8797T_00402 [Planctomyces maris DSM 8797]
 gi|148843601|gb|EDL57962.1| hypothetical protein PM8797T_00402 [Planctomyces maris DSM 8797]
          Length = 304

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 10/108 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTF-IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            N   +   + Y  + P+G    + LKK  GIK+I+++ G  P+  H      A   G++
Sbjct: 49  DNVFQI-DRQFYSGSGPHGEQSFQELKK-LGIKTIVSVDGTTPDLVH------ARKAGMK 100

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            I+ P+     ++++       + +    P+ IHC  G  R   A+AV
Sbjct: 101 YIHIPI-GYDGVSEDAGLAFARVARDLNGPVYIHCHHGKHRGPTAAAV 147


>gi|85373734|ref|YP_457796.1| hypothetical protein ELI_04535 [Erythrobacter litoralis HTCC2594]
 gi|84786817|gb|ABC62999.1| hypothetical protein ELI_04535 [Erythrobacter litoralis HTCC2594]
          Length = 150

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 55/118 (46%), Gaps = 7/118 (5%)

Query: 58  PNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRELND 114
           P+   +  L ++ G K+++NLR +           E +    LG++  + P++    ++D
Sbjct: 18  PSEGDLRALAED-GYKAVVNLRCQDEADQPLAPDREGEVVASLGLEYCHLPVAG-GTISD 75

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF 172
           E + +  + ++  PKP+L+HC SG  R G  + ++L         +A  Q +   G  
Sbjct: 76  ELVDEFRASVEALPKPVLVHCASGK-RAGAFTIMHLASQQGMS-GDATLQKAADMGFV 131


>gi|114046941|ref|YP_737491.1| dual specificity protein phosphatase [Shewanella sp. MR-7]
 gi|113888383|gb|ABI42434.1| dual specificity protein phosphatase [Shewanella sp. MR-7]
          Length = 156

 Score = 72.6 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 57/137 (41%), Gaps = 21/137 (15%)

Query: 41  TQNFHAVVPHEIY-RSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
            Q+   +V  +I  RS  P  +   +  L K  GI+++L++ G         E  +    
Sbjct: 1   MQHLFWLVEGKIAGRSG-PNKDPWDLAEL-KSLGIRAVLSVNGGEGC-----EPGSFKHH 53

Query: 98  GIQLINFPLSATRELND-------EQIKQLISILKTAPK---PLLIHCKSGADRTGLASA 147
           G++    P S      +        Q+ + ++ ++       P+LIHC+SG DRTGL  A
Sbjct: 54  GLRYECIPFSRNVPPQEGDVAICVAQLPRALAFIQECEADNLPVLIHCRSGKDRTGLIMA 113

Query: 148 VYLYIVAHYPKEEAHRQ 164
            YL      P   A  Q
Sbjct: 114 YYLMANGAAPL-HAVSQ 129


>gi|325181330|emb|CCA15745.1| tyrosine phosphatase putative [Albugo laibachii Nc14]
          Length = 173

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 48/116 (41%), Gaps = 7/116 (6%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-----KEEEKAANDLGI 99
           + ++  ++YRS QPN     +L++   ++ I+ L  + P         ++E +     G 
Sbjct: 10  YGMIEEDLYRSGQPNELNFPFLER-LNLRKIIYLAAEEPNLQFQSFVEEQEIELICLGGN 68

Query: 100 QLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
             +     A   L++E +   + I+   +  PL I C  G DRTG        +  
Sbjct: 69  AHLETRRKAWEPLSEETVLAALQIILDRSNYPLYITCHLGRDRTGAVVGCLRKMQQ 124


>gi|119501138|ref|XP_001267326.1| tyrosine phosphatase family protein [Neosartorya fischeri NRRL 181]
 gi|119415491|gb|EAW25429.1| tyrosine phosphatase family protein [Neosartorya fischeri NRRL 181]
          Length = 166

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 54/129 (41%), Gaps = 13/129 (10%)

Query: 83  PESWHKEEEKAANDLGIQLINFPLSATREL----NDEQIKQLISIL-KTAPKPLLIHCKS 137
              + ++ +    + GI+     + A ++      D  + +++ I+   A  PLL+HC  
Sbjct: 7   EGDYTQDHQVFLEENGIEHRRILILANKDPTIRTPDHVVNRVLEIMLNKANHPLLLHCNK 66

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI---TQLYPNN 194
           G  RTG     +   V  +      ++    Y +F   K+  +D  F ++   T+L P  
Sbjct: 67  GKHRTGCIVGCFR-KVQGWDMPAIRKE----YINFSWPKSRPLDERFIELFDDTRLRPLA 121

Query: 195 VSKGDTEQP 203
           VS G +  P
Sbjct: 122 VSSGASSWP 130


>gi|254578750|ref|XP_002495361.1| ZYRO0B09482p [Zygosaccharomyces rouxii]
 gi|238938251|emb|CAR26428.1| ZYRO0B09482p [Zygosaccharomyces rouxii]
          Length = 218

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 46/131 (35%), Gaps = 15/131 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+     +L  +  +K+I+ L  + P+          +   IQL 
Sbjct: 49  NFCPVE-RYLYRSGQPSPVNFPFLL-DLNLKTIIWLANEEPQDSLL---VFCDRHDIQLQ 103

Query: 103 NFPLSA--------TRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++            L +  I   +  +      PLL+ C  G  RTG        I+
Sbjct: 104 FAAINPDGGEDDNPWDGLTEHSIINALQTIVDQDNYPLLVCCGMGRHRTGTVIGCLRRIM 163

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 164 -GWNLASVSEE 173


>gi|32471313|ref|NP_864306.1| secreted glycosyl hydrolase [Rhodopirellula baltica SH 1]
 gi|32443154|emb|CAD71985.1| probable secreted glycosyl hydrolase [Rhodopirellula baltica SH 1]
          Length = 504

 Score = 72.2 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 8/118 (6%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             I+ + QP    +   KK  G+K ++ LR +    +  ++E    + G++         
Sbjct: 368 GPIWLAGQPTAEGLAAAKKA-GVKRVITLRSERELDF--DDEALVKNAGLEFHAIRFGGH 424

Query: 110 RELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++L DE+I  +  +L+ A  P    L+HC S A+R G     Y  +      E A ++
Sbjct: 425 QQLTDEKIHAVCQLLQAAD-PDNQALLHCAS-ANRVGAIWIAYRVLDGRQTLENAIQE 480


>gi|87311119|ref|ZP_01093243.1| hypothetical protein DSM3645_18906 [Blastopirellula marina DSM
           3645]
 gi|87286210|gb|EAQ78120.1| hypothetical protein DSM3645_18906 [Blastopirellula marina DSM
           3645]
          Length = 295

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 52/123 (42%), Gaps = 12/123 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            N   V P  ++  +QP+G    E L K  G++ I+++ G  P      E  AA   G++
Sbjct: 34  HNLFQVTP-RVWSGSQPHGVAGFESLAK-LGVQVIVSVDGAKP------EIAAAKKQGLK 85

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADR--TGLASAVYLYIVAHYPK 158
            I+ P        D Q  QL  ++K  P  +  HC  G  R   G+A A       +  +
Sbjct: 86  YIHIPFGYDGVPGDAQ-AQLAEVMKQYPGQIYFHCHHGKHRGPAGVAIACLAEGSLNTAQ 144

Query: 159 EEA 161
            EA
Sbjct: 145 AEA 147


>gi|327538147|gb|EGF24832.1| protein containing DUF1080 [Rhodopirellula baltica WH47]
          Length = 385

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 8/118 (6%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             I+ + QP    +   KK  G+K ++ LR +    +  ++E    + G++         
Sbjct: 249 GPIWLAGQPTAEGLAAAKKA-GVKRVITLRSERELDF--DDEALVKNAGLEFHAIRFGGH 305

Query: 110 RELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++L DE+I  +  +L+ A  P    L+HC S A+R G     Y  +      E A ++
Sbjct: 306 QQLTDEKIHAVCQLLQAAD-PDNQALLHCAS-ANRVGAIWIAYRVLDGRQTLENAIQE 361


>gi|320580846|gb|EFW95068.1| Putative protein tyrosine phosphatase [Pichia angusta DL-1]
          Length = 208

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 52/129 (40%), Gaps = 13/129 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V  H +YRS QP+     +L+ +  +KS++ L  + P+       +   +  I L 
Sbjct: 47  NFCPVEKH-LYRSGQPSAINHSFLQ-QLHLKSVIWLATEEPQDTFL---RFMEENDINLF 101

Query: 103 ------NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 +   ++   L++  IKQ + I+      PLL+ C  G  RTG        +   
Sbjct: 102 CNLGYDSIDSNSWDGLSESSIKQALEIISDKRHYPLLVCCGMGRHRTGTVIGCLRKL-QG 160

Query: 156 YPKEEAHRQ 164
           +       +
Sbjct: 161 WNLASVSEE 169


>gi|91793880|ref|YP_563531.1| Dual specificity protein phosphatase [Shewanella denitrificans
           OS217]
 gi|91715882|gb|ABE55808.1| dual specificity protein phosphatase [Shewanella denitrificans
           OS217]
          Length = 156

 Score = 71.8 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 48/123 (39%), Gaps = 20/123 (16%)

Query: 54  RSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           RS  P      ++ L    GIK I++L           +E A  ++GI    F L  +  
Sbjct: 15  RSG-PNKTPWDLQELAAN-GIKVIVSLNDANQC-----DESAMAEVGILHRVFTLPDSIP 67

Query: 112 LNDEQ----------IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
              +           I   I+  +    P+LIHC+SG DRTGL  A YL      P   A
Sbjct: 68  PTLDDLAICTEILPKILAFIAQCEADNLPVLIHCRSGKDRTGLMMAYYLMKNGAAPL-HA 126

Query: 162 HRQ 164
             Q
Sbjct: 127 VSQ 129


>gi|58263244|ref|XP_569032.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57223682|gb|AAW41725.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 157

 Score = 71.8 bits (175), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 59/166 (35%), Gaps = 19/166 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V     YRSAQP+     +L+K   +KSI+ +  + P              GI+L 
Sbjct: 2   NFGLVEDG-FYRSAQPSELCFSFLEK-LNLKSIIWVGAEEPSDIFLS---FIESQGIKLY 56

Query: 103 NFPLSATRELNDEQ------IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           N                   I+ L  +L+ +  P L+ C  G  RTG     Y  +   +
Sbjct: 57  NLAPQTNHLPPLPPPPEPLIIQALTLLLRPSTFPTLLCCNMGRHRTGTVVGCYRKL-QRW 115

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
                  +       +     + + +  E+  +L+  ++     EQ
Sbjct: 116 ALSSILEE-------YRRYAGMKVRVLNEQFIELFDTDLVSITAEQ 154


>gi|225447151|ref|XP_002275463.1| PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
          Length = 145

 Score = 71.4 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 9/106 (8%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
            LV     L      + T   NF A+V + I+RS  P+     +L+   G++SI+ L   
Sbjct: 21  ALVAAGDELDRDGEELFTPPLNF-AMVDNGIFRSGFPDTANFAFLQT-LGLRSIIYL--- 75

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATREL----NDEQIKQLISI 123
            PE++ +   +     GI+L  F +   +E      ++ I++ + +
Sbjct: 76  CPETYPEANNEFLKSNGIKLFQFGIEGYKEPFVNIPEDTIREALKV 121


>gi|254569462|ref|XP_002491841.1| Putative protein tyrosine phosphatase [Pichia pastoris GS115]
 gi|238031638|emb|CAY69561.1| Putative protein tyrosine phosphatase [Pichia pastoris GS115]
 gi|328351660|emb|CCA38059.1| Putative tyrosine-protein phosphatase OCA1 [Pichia pastoris CBS
           7435]
          Length = 203

 Score = 71.4 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 11/128 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-----WHKEEEKAANDL 97
           NF  V  H +YRS QP+     +L KE  +KSI+ L  + P+            K   +L
Sbjct: 39  NFCPVERH-LYRSGQPSTINHSFL-KELNLKSIIWLAIEDPQDNFLKFIDDNNIKFFYNL 96

Query: 98  GIQLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           G   I+   ++   L++  IKQ + ++  T   PLL+ C  G  RTG        +   +
Sbjct: 97  GFNSIDN--NSWDGLSENSIKQSLEVIVDTRNYPLLVCCGMGRHRTGTIIGCLRKL-QGW 153

Query: 157 PKEEAHRQ 164
                  +
Sbjct: 154 NLSSVSEE 161


>gi|290991013|ref|XP_002678130.1| predicted protein [Naegleria gruberi]
 gi|284091741|gb|EFC45386.1| predicted protein [Naegleria gruberi]
          Length = 180

 Score = 71.4 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 62/187 (33%), Gaps = 30/187 (16%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
           +TI     NF  V  + ++RS QP      +L     +K+I+ L    P+   +E    A
Sbjct: 1   MTILVPPINFGYVQEN-VFRSGQPTSVNFPHL-ATLNLKTIIYL---APDQPTQEFVNFA 55

Query: 95  NDLGIQLINF-----------------PLSATRELNDEQIKQLISIL-KTAPKPLLIHCK 136
            D  I LI+                   ++    +++E + + + I+      PL I C 
Sbjct: 56  KDQNINLIHLTNQSTKMKKSGTSSSHTGMAQLGLISEEIVVEALEIILNRENLPLAIMCN 115

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVS 196
            G  RTG        I   +       +      +     +       + I     + VS
Sbjct: 116 LGRHRTGTVVGCLRKI-QRWNLTSILDE------YRRYAGSKVRLQNEQFIELFDTDLVS 168

Query: 197 KGDTEQP 203
                +P
Sbjct: 169 FRTDNKP 175


>gi|163793454|ref|ZP_02187429.1| hypothetical protein BAL199_03064 [alpha proteobacterium BAL199]
 gi|159181256|gb|EDP65771.1| hypothetical protein BAL199_03064 [alpha proteobacterium BAL199]
          Length = 153

 Score = 71.4 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 50/99 (50%), Gaps = 4/99 (4%)

Query: 67  KKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
             + G  SI+NLR   +  E     E + A + G+  ++ P+S   +L+++ +++    +
Sbjct: 26  AAQNGFGSIVNLRTTAEKQELAPDAEGRIAKNQGLAYLHHPVSG-DDLSEDAVERFRQKI 84

Query: 125 KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
            + P P+L+HC +G  R+G    ++L I      E+A  
Sbjct: 85  NSLPGPILVHCATG-RRSGALVMMHLAIEQGLSGEQAVE 122


>gi|320165669|gb|EFW42568.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 186

 Score = 71.1 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 54/120 (45%), Gaps = 13/120 (10%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           + +V   +YRS   + +   +L K  G++++L L    P+   +       D  + +I+ 
Sbjct: 10  YGIVEPNVYRSNFWHPSNFPFL-KSLGLRTLLVL---SPDKPLRPIADFCEDNSVNVIHL 65

Query: 105 PLSATR-------ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            LSA +        ++DE +K+ + I L     P+++ C SG  +TG        +  ++
Sbjct: 66  GLSAWKLDASSWKPVSDELVKEALEITLDVTTHPVMLMCSSGIHQTGTIVGCLRRL-QNW 124


>gi|168055820|ref|XP_001779921.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162668635|gb|EDQ55238.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 181

 Score = 71.1 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 52/125 (41%), Gaps = 10/125 (8%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE-EKAANDLGIQLIN 103
           HA+V    +R A P      +L +   +K++++L    PE+    +  +     GI + N
Sbjct: 13  HAIVEDSFFRGAYPTIKNFRFL-RRLHLKTLVSL---TPEAHPNRDMREFCEHEGITVHN 68

Query: 104 F---PLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           F          L + ++ Q++ I+ +    P+ +HC  G   TGL    +  +   +   
Sbjct: 69  FFVEKFQDGVTLTNAKVIQVLQIIIRPENLPVYVHCLDGTHVTGLVVMCFRKL-QSWNLS 127

Query: 160 EAHRQ 164
            +  +
Sbjct: 128 TSTAE 132


>gi|113969712|ref|YP_733505.1| dual specificity protein phosphatase [Shewanella sp. MR-4]
 gi|113884396|gb|ABI38448.1| dual specificity protein phosphatase [Shewanella sp. MR-4]
          Length = 156

 Score = 71.1 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 57/137 (41%), Gaps = 21/137 (15%)

Query: 41  TQNFHAVVPHEIY-RSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
            Q+   +V  +I  RS  P  +   +  LK   GI+++L++ G         E  +    
Sbjct: 1   MQHLFWLVEGKIAGRSG-PNKDPWDLAELKTS-GIRAVLSVNGGEGC-----EPGSFKHH 53

Query: 98  GIQLINFPLSATRELND-------EQIKQLISILKTAPK---PLLIHCKSGADRTGLASA 147
           G++    P S      +        Q+ + ++ ++       P+LIHC+SG DRTGL  A
Sbjct: 54  GLRYECIPFSRNVPPQEGDVAICVAQLPRALAFIQECEADNLPVLIHCRSGKDRTGLIMA 113

Query: 148 VYLYIVAHYPKEEAHRQ 164
            YL      P   A  Q
Sbjct: 114 YYLMANGAAPL-HAVSQ 129


>gi|255671726|gb|ACU26484.1| hypothetical protein [uncultured bacterium HF186_25m_13D19]
          Length = 340

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 5/119 (4%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
             V+   +    QP    +E L  + G+K ++NLR      +  +EEK   +L +     
Sbjct: 47  GTVISPTLVIGGQPTKAALEELATQ-GLKHVINLRTPSELDF--DEEKVVKELKMSYQMI 103

Query: 105 PLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           P+   + L +  I  L + L     P L+HC SG +R G   A+          +EA  
Sbjct: 104 PVPGAKGLTESAIDDLHAALNP-EVPTLVHCASG-NRVGALFALRAQRHLDANFDEALA 160


>gi|120435701|ref|YP_861387.1| hypothetical protein GFO_1346 [Gramella forsetii KT0803]
 gi|117577851|emb|CAL66320.1| conserved hypothetical protein [Gramella forsetii KT0803]
          Length = 148

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/109 (24%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

Query: 58  PNGTFIEYLKKEYGIKSILNLRGKLPES--WHKEEEKAANDLGIQLINFPLSATRELNDE 115
           PN    +    + G KS++NL+    E     ++E++ A  L ++  +  + +   L++ 
Sbjct: 19  PNENSFKTFADK-GFKSVINLQTDEEEQNVSQEKEKELAKKLNLEYKHIGI-SKDNLSEA 76

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
            +      L++ PKP+L+HCKSG  R+G    +++        EE  +Q
Sbjct: 77  IVNNFRQELESLPKPILVHCKSGK-RSGAFVMMHIGCQKDMSGEEVIKQ 124


>gi|298706396|emb|CBJ29405.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 182

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 56/143 (39%), Gaps = 11/143 (7%)

Query: 21  GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG 80
           G+ +    SL L    +     NF  +V   ++RS  P      +L +  G++SIL L  
Sbjct: 19  GLGLPGLASLALPSDGMVVPPLNFS-MVSEGVFRSGYPIACNFPFL-RRLGLQSILCL-- 74

Query: 81  KLPESWHKEEEKAANDLGIQLINFPLSATREL----NDEQIKQLISILKT-APKPLLIHC 135
             PES      + A + G+ +    L              +++ +  L     +P+L+HC
Sbjct: 75  -CPESVLPGSLEWAKESGVSMEMCDLGENSPPFVSMPLAAMRKAVDYLSDCRNRPVLVHC 133

Query: 136 KSGADRTGLASAVYLYIVAHYPK 158
            +G  +TG A         ++  
Sbjct: 134 LTGKTQTGCAIGCLR-RRQNWAL 155


>gi|120598332|ref|YP_962906.1| dual specificity protein phosphatase [Shewanella sp. W3-18-1]
 gi|146293590|ref|YP_001184014.1| dual specificity protein phosphatase [Shewanella putrefaciens
           CN-32]
 gi|120558425|gb|ABM24352.1| dual specificity protein phosphatase [Shewanella sp. W3-18-1]
 gi|145565280|gb|ABP76215.1| dual specificity protein phosphatase [Shewanella putrefaciens
           CN-32]
 gi|319426889|gb|ADV54963.1| Dual specificity protein phosphatase [Shewanella putrefaciens 200]
          Length = 156

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query: 54  RSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           RS  P  +   +  LK   GI ++L++ G      H         LG++    P S    
Sbjct: 15  RSG-PNKDPWDLTELKAA-GIGAVLSVNGGEGCDPHSF-----KGLGLRYECIPFSRNVP 67

Query: 112 LNDEQI----------KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             D  I             I   +    P++IHC+SG DRTGL  A YL +    P   A
Sbjct: 68  PQDGDIAICVAQLPKALAFIQQCEADNLPVVIHCRSGKDRTGLIMAYYLMVNGAAPL-HA 126

Query: 162 HRQ 164
             Q
Sbjct: 127 VSQ 129


>gi|294654978|ref|XP_457063.2| DEHA2B02200p [Debaryomyces hansenii CBS767]
 gi|199429597|emb|CAG85049.2| DEHA2B02200p [Debaryomyces hansenii]
          Length = 276

 Score = 70.7 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 61/202 (30%), Gaps = 52/202 (25%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG---------------------- 80
           NF  V    IYRS  P      +L+ + GIK+I+ L                        
Sbjct: 78  NFSLVEDG-IYRSGFPMPINYPFLE-QLGIKTIIYLGDLGEKKKDEKSKKKNKKNKEEGD 135

Query: 81  -----------KLPESWHKEEEKAANDLGIQLINFPLSATREL--NDEQIKQLISILKTA 127
                                +K      I+  +  + +  E    +E   Q +  +KTA
Sbjct: 136 KTPKEKEKKDKHGTAEIMDNYKKWIETTDIKFHDLFIKSASEPFTLEEDRTQALETIKTA 195

Query: 128 --------PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTIT 179
                     P+LIH   G  R G+   +   ++  +       +    Y  F + K+  
Sbjct: 196 LQLIVNKQNFPILIHSNKGKHRIGVLVGLMRKLLQGWCLSGIFEE----YEKFAMGKS-- 249

Query: 180 MDITFEKITQLYPNNVSKGDTE 201
            +   E I    P    + + +
Sbjct: 250 -EFDLECIELWQPELYVENEWK 270


>gi|126136825|ref|XP_001384936.1| protein tyrosine/serine phosphatase [Scheffersomyces stipitis CBS
           6054]
 gi|189029254|sp|A3LW52|OCA1_PICST RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|126092158|gb|ABN66907.1| protein tyrosine/serine phosphatase [Scheffersomyces stipitis CBS
           6054]
          Length = 212

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 55/141 (39%), Gaps = 25/141 (17%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V   ++YRS QP+     +L+ +  +K+IL L  + P+    +  + +ND  I + 
Sbjct: 40  NFCPVE-RQLYRSGQPSAINQSFLE-QLNLKTILWLASEEPQD---DFLEFSNDHNINIE 94

Query: 103 NFPL------------------SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTG 143
              +                  +    LN++ IK+ + ++      PLL+ C  G  RTG
Sbjct: 95  FVGIINEFSNYQNYNTNQTLTVNPWDALNEQTIKRALELIVNRENYPLLVCCGMGRHRTG 154

Query: 144 LASAVYLYIVAHYPKEEAHRQ 164
                   +   +       +
Sbjct: 155 TVIGCLRRL-QGWNLASVSEE 174


>gi|323352559|gb|EGA85058.1| Oca1p [Saccharomyces cerevisiae VL3]
          Length = 238

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 46/131 (35%), Gaps = 15/131 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+     +L     +K+I+ L  + P+       +  +   I L 
Sbjct: 72  NFCPVE-RYLYRSGQPSPVNFPFLL-NLKLKTIIWLSNEEPQDTLL---EFCDTHRINLQ 126

Query: 103 NFPLSA--------TRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++            L +  I  ++  +      PLL+ C  G  RTG        I+
Sbjct: 127 FAAINPDAGEDDNPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLRRIM 186

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 187 -GWNLASVSEE 196


>gi|71064100|gb|AAZ22508.1| Oca1p [Saccharomyces cerevisiae]
          Length = 238

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 46/131 (35%), Gaps = 15/131 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+     +L     +K+I+ L  + P+       +  +   I L 
Sbjct: 72  NFCPVE-RYLYRSGQPSPVNFPFLL-NLKLKTIIWLSNEEPQDTLL---EFCDTHRINLQ 126

Query: 103 NFPLSA--------TRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++            L +  I  ++  +      PLL+ C  G  RTG        I+
Sbjct: 127 FAAINPDAGEDDNPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLRRIM 186

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 187 -GWNLASVSEE 196


>gi|295086066|emb|CBK67589.1| Protein tyrosine/serine phosphatase [Bacteroides xylanisolvens
           XB1A]
          Length = 355

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 61/161 (37%), Gaps = 38/161 (23%)

Query: 50  HEIYRSAQPN--GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
             IYRSAQ +          K  GI++I++LR +     + +     +D   ++++ P+ 
Sbjct: 134 GMIYRSAQIDSIPPCSRQELKNMGIRTIIDLRPESERHNYPQ----LHDDKFKIVHIPIL 189

Query: 108 AT-----------RELNDEQIKQLIS--------------------ILKTAPKPLLIHCK 136
                         ++  + I +L+                     +L  +  P++IHC 
Sbjct: 190 TGNMEKILQGIREEKIKTDTIYRLVERMNRELVTNYQKEFKELFTVLLDRSNYPVVIHCT 249

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           SG  RTG+ SA+ L       ++       +   +F + K 
Sbjct: 250 SGKGRTGVVSAL-LLAALGVNEDVIMEDYRLSNDYFNIPKA 289


>gi|6324230|ref|NP_014300.1| Oca1p [Saccharomyces cerevisiae S288c]
 gi|1730756|sp|P50946|OCA1_YEAST RecName: Full=Putative tyrosine-protein phosphatase OCA1; AltName:
           Full=Oxidant-induced cell-cycle arrest protein 1
 gi|189029255|sp|A6ZRY1|OCA1_YEAS7 RecName: Full=Putative tyrosine-protein phosphatase OCA1; AltName:
           Full=Oxidant-induced cell-cycle arrest protein 1
 gi|929854|emb|CAA90527.1| ORF N2194 [Saccharomyces cerevisiae]
 gi|1302010|emb|CAA95975.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|151944435|gb|EDN62713.1| oxidant-induced cell-cycle arrest [Saccharomyces cerevisiae YJM789]
 gi|190409088|gb|EDV12353.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gi|207341726|gb|EDZ69703.1| YNL099Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256271649|gb|EEU06690.1| Oca1p [Saccharomyces cerevisiae JAY291]
 gi|259149261|emb|CAY82503.1| Oca1p [Saccharomyces cerevisiae EC1118]
 gi|285814552|tpg|DAA10446.1| TPA: Oca1p [Saccharomyces cerevisiae S288c]
 gi|323303234|gb|EGA57032.1| Oca1p [Saccharomyces cerevisiae FostersB]
 gi|323307428|gb|EGA60702.1| Oca1p [Saccharomyces cerevisiae FostersO]
 gi|323331952|gb|EGA73364.1| Oca1p [Saccharomyces cerevisiae AWRI796]
 gi|323335801|gb|EGA77080.1| Oca1p [Saccharomyces cerevisiae Vin13]
          Length = 238

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 46/131 (35%), Gaps = 15/131 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+     +L     +K+I+ L  + P+       +  +   I L 
Sbjct: 72  NFCPVE-RYLYRSGQPSPVNFPFLL-NLKLKTIIWLSNEEPQDTLL---EFCDTHRINLQ 126

Query: 103 NFPLSA--------TRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++            L +  I  ++  +      PLL+ C  G  RTG        I+
Sbjct: 127 FAAINPDAGEDDNPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLRRIM 186

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 187 -GWNLASVSEE 196


>gi|262376560|ref|ZP_06069789.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262308699|gb|EEY89833.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 174

 Score = 70.3 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 55/137 (40%), Gaps = 12/137 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T  +  +NF  +  H ++ S QP  T +  L KEYG+ +++N+     E +   E+K   
Sbjct: 6   TALSQIENFQFIHEH-LFSSGQPTTTQL-QLMKEYGVSTVINVALTDSEQYLPHEDKICL 63

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHC---KSGADRTGLASAVYL 150
           +LG+  I  P+ +    +D Q   ++ ++      + + +HC      +        +Y 
Sbjct: 64  ELGLNYIQVPI-SWETPSDNQCLLVLDLIDHLVKEQMVWVHCSQNYHVS----CLMYLYR 118

Query: 151 YIVAHYPKEEAHRQLSM 167
                     A   L  
Sbjct: 119 QYYMDMDLPTAQEHLHQ 135


>gi|293609261|ref|ZP_06691563.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827713|gb|EFF86076.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 174

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KE+G  +++NL      +  + E++   DLG+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSAEQLK-LIKEFGCSTVINLALTNASNHLENEDRICLDLGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 + EQ   ++ ++      + + IHC     R      VY     +
Sbjct: 75  D-WEMPSAEQCLLVLDLIDHLVQNEIIWIHCAKNK-RVSCLMYVYRQFYMN 123


>gi|255671639|gb|ACU26400.1| hypothetical protein [uncultured bacterium HF186_25m_30B18]
 gi|255671677|gb|ACU26437.1| hypothetical protein [uncultured bacterium HF186_75m_14K15]
          Length = 340

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 5/119 (4%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
             V+   +    QP    +E L  + G+K ++NLR      +  +EEK   +L +     
Sbjct: 47  GTVISPTLVIGGQPTKAALEELATQ-GLKHVINLRTPSELDF--DEEKVVKELKMSYQMI 103

Query: 105 PLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           P+   + L +  I  L + L     P L+HC SG +R G   A+           EA  
Sbjct: 104 PVPGAKGLTESAIDDLHAALNP-EVPTLVHCASG-NRVGALFALRAQRHLDADFGEALA 160


>gi|146417654|ref|XP_001484795.1| hypothetical protein PGUG_02524 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146390268|gb|EDK38426.1| hypothetical protein PGUG_02524 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 276

 Score = 69.9 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 62/193 (32%), Gaps = 42/193 (21%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL----------------------RG 80
           NF  V    IYRS  P      +L++   +K+I+ L                        
Sbjct: 89  NFSLVEDG-IYRSGFPMPINYPFLER-LELKTIIYLGDLGQEKKEKKQKKDKEKEKEKDK 146

Query: 81  KLPESWHKEEEKAANDLGIQLINFPLSATREL--NDEQIKQLIS--------ILKTAPKP 130
                     ++  +   I   +  + +++E   N ++IKQ           +L     P
Sbjct: 147 NTTLEVLANYKQWIDSTDITFHHLMMESSQEPFLNQDRIKQAQESLTTALQLMLDRNNFP 206

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           +LIH   G  R G+   +   I+  +       +    Y  F + K+       E    L
Sbjct: 207 MLIHSNKGKHRIGVLVGLMRKILQGWCMSGIFEE----YEKFAMGKSEIDLEFIE----L 258

Query: 191 YPNNVSKGDTEQP 203
           +   +   D  +P
Sbjct: 259 WQPELWVDDKWRP 271


>gi|321248739|ref|XP_003191224.1| hypothetical protein CGB_A1470C [Cryptococcus gattii WM276]
 gi|317457691|gb|ADV19437.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 159

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 62/168 (36%), Gaps = 21/168 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V     YRSAQP+     +L+K   +KSI+ +  + P              GI+L 
Sbjct: 2   NFGLVEDG-FYRSAQPSELCFSFLEK-LNLKSIIWVGAEEPSDIFLS---FIESQGIKLY 56

Query: 103 NFPLSATRE-------LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           N       +         +  I Q +++L + +  P L+ C  G  RTG     Y  +  
Sbjct: 57  NLAPQTKTDHLPPLPPPPEPLIIQALTLLLRPSTFPTLLCCNMGRHRTGTVVGCYRKL-Q 115

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
            +       +       +     + + +  E+  +L+  ++     EQ
Sbjct: 116 RWALSSILEE-------YRRYAGMKVRVLNEQFIELFDTDLVSITAEQ 156


>gi|156741170|ref|YP_001431299.1| hypothetical protein Rcas_1184 [Roseiflexus castenholzii DSM 13941]
 gi|156232498|gb|ABU57281.1| protein of unknown function DUF442 [Roseiflexus castenholzii DSM
           13941]
          Length = 165

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 48/112 (42%), Gaps = 5/112 (4%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           + QP       L  E G   ++N+R     +    ++++A   G++ I+ PL    EL  
Sbjct: 30  AGQPQPEDWAALAAE-GFAVVINMRSDPERA--TTQQRSAEAAGLRYIHLPLPVY-ELEP 85

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
           E ++Q    L      + +HC+S A R  L   +   +   + +E+A   L 
Sbjct: 86  EHLEQYHQTLAAEQGRVFLHCRS-ATRVALMWLLDRIVYDGWSREQAEATLR 136


>gi|281202086|gb|EFA76291.1| hypothetical protein PPL_10054 [Polysphondylium pallidum PN500]
          Length = 483

 Score = 69.5 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 53/125 (42%), Gaps = 9/125 (7%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
           A++   +YR + P    + +L K   +K+I++L    P+   K              +FP
Sbjct: 15  AIIEEGLYRGSYPTEKNLRFL-KRLKLKTIVSL---TPKPPLKPFLNFCERYNTTSKHFP 70

Query: 106 LSATRE---LNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           +S  ++   ++  Q+ QL+ ++   A  PL  HC  GA+ TG         V ++     
Sbjct: 71  VSKFKDDVTIDASQVVQLLELMIDPANLPLYCHCLDGANVTGTIFMCLR-KVQNWNLSAI 129

Query: 162 HRQLS 166
             + +
Sbjct: 130 ISEFT 134


>gi|28199758|ref|NP_780072.1| hypothetical protein PD1890 [Xylella fastidiosa Temecula1]
 gi|182682508|ref|YP_001830668.1| hypothetical protein XfasM23_1995 [Xylella fastidiosa M23]
 gi|81585639|sp|Q87AD6|BLH_XYLFT RecName: Full=Beta-lactamase hydrolase-like protein
 gi|28057879|gb|AAO29721.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182632618|gb|ACB93394.1| protein of unknown function DUF442 [Xylella fastidiosa M23]
 gi|307578785|gb|ADN62754.1| hypothetical protein XFLM_03920 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 431

 Score = 69.5 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 47/122 (38%), Gaps = 11/122 (9%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRE 111
           S QPN        +  G +SI+NLR    E        E+ AA   G+     P+  T  
Sbjct: 13  SGQPNTDEFINFARR-GYRSIINLRPDGEEPNQPGNDAEQAAARRAGLAYNFVPVIGT-S 70

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY--IVAHYPKEEAHRQLSMLY 169
           + +  I+     + T    +L+HCKSG      A  +Y    ++    K +    L   +
Sbjct: 71  ITEADIQAFQRAIATTEGSVLVHCKSGTR----ALMLYALSEVIDGRMKRDEVEALGHAH 126

Query: 170 GH 171
           G 
Sbjct: 127 GF 128


>gi|60679731|ref|YP_209875.1| hypothetical protein BF0135 [Bacteroides fragilis NCTC 9343]
 gi|253564477|ref|ZP_04841934.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|265764860|ref|ZP_06093135.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|60491165|emb|CAH05913.1| conserved hypothetical protein [Bacteroides fragilis NCTC 9343]
 gi|251948253|gb|EES88535.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263254244|gb|EEZ25678.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|301161193|emb|CBW20731.1| conserved hypothetical protein [Bacteroides fragilis 638R]
          Length = 351

 Score = 69.1 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 38/134 (28%)

Query: 50  HEIYRSAQPNGTFIEYLKK--EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
            ++YRSAQ +      L+K    GIK+IL+LR +         +K     G  +++ P++
Sbjct: 133 GKLYRSAQIDSLNCFALRKLQNLGIKTILDLRSESELHNTPPLQK-----GFNVVHIPIN 187

Query: 108 A-----------TRELNDEQIKQLIS--------------------ILKTAPKPLLIHCK 136
                         ++  + I  ++                     +L     P++IHC 
Sbjct: 188 TGDMEHILHGIQQEKIKTDTIYHMVEAMNRELVAKYQKEYKEIFDILLDKNSYPVVIHCS 247

Query: 137 SGADRTGLASAVYL 150
           SG  RTG+ SA+ L
Sbjct: 248 SGKGRTGIVSALIL 261


>gi|53711461|ref|YP_097453.1| hypothetical protein BF0170 [Bacteroides fragilis YCH46]
 gi|52214326|dbj|BAD46919.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
          Length = 351

 Score = 69.1 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 38/134 (28%)

Query: 50  HEIYRSAQPNGTFIEYLKK--EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
            ++YRSAQ +      L+K    GIK+IL+LR +         +K     G  +++ P++
Sbjct: 133 GKLYRSAQIDSLNCFALRKLQNLGIKTILDLRSESELHNTPPLQK-----GFNVVHIPIN 187

Query: 108 A-----------TRELNDEQIKQLIS--------------------ILKTAPKPLLIHCK 136
                         ++  + I  ++                     +L     P++IHC 
Sbjct: 188 TGDMEHILHGIQQEKIKTDTIYHMVEAMNRELVAKYQKEYKEIFDILLDKNSYPVVIHCS 247

Query: 137 SGADRTGLASAVYL 150
           SG  RTG+ SA+ L
Sbjct: 248 SGKGRTGIVSALIL 261


>gi|223590114|sp|A5DE24|OCA1_PICGU RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|190345526|gb|EDK37427.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 185

 Score = 69.1 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 54/131 (41%), Gaps = 13/131 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V   ++YRS QP+     +L+ +  +K+I+ L  + P+    +   + N + I+ +
Sbjct: 18  NFCPVE-KQLYRSGQPSIINQSFLQ-DLNLKTIIWLASEEPQEEFLDYC-SMNSINIEFV 74

Query: 103 NF--------PLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
                      ++    LN+  IK+ + ++      P+L+ C  G  RTG        + 
Sbjct: 75  GMINDDYSYQNVNPWDSLNETTIKKALELICDRNNYPMLVCCGMGRHRTGTVIGCLRRL- 133

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 134 QGWNLASVSEE 144


>gi|126642026|ref|YP_001085010.1| hypothetical protein A1S_1981 [Acinetobacter baumannii ATCC 17978]
 gi|126387910|gb|ABO12408.1| hypothetical protein A1S_1981 [Acinetobacter baumannii ATCC 17978]
          Length = 174

 Score = 69.1 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSTEQLK-LIKEYGCSTVINLALSNSPDSIKNEDQVCLEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 + +Q   ++ ++      + + IHC     R      VY     +
Sbjct: 75  D-WETPSSDQCLLVLDLIDHLVQNEIVWIHCAKNK-RVSCLMYVYRQFYMN 123


>gi|154417107|ref|XP_001581574.1| Tyrosine phosphatase family protein [Trichomonas vaginalis G3]
 gi|121915803|gb|EAY20588.1| Tyrosine phosphatase family protein [Trichomonas vaginalis G3]
          Length = 202

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 49/121 (40%), Gaps = 11/121 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRSA P+     +L+    +K+++ L    P        +   +  I+L 
Sbjct: 8   NFGYVEPD-LYRSAVPSDMNFPFLQT-LHLKTVIYLSLDAPSVLFL---EFLKEHNIELK 62

Query: 103 NFPLSAT----RELNDEQIKQLI-SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
               + T    + ++++ +   + S+L     P+++ C  G  RTG        +   + 
Sbjct: 63  QISGAETTGFAQRVSEQLVLDALHSLLNPNAYPIIVMCNLGRHRTGTVIGCLRRL-QKWS 121

Query: 158 K 158
            
Sbjct: 122 L 122


>gi|15837370|ref|NP_298058.1| hypothetical protein XF0768 [Xylella fastidiosa 9a5c]
 gi|81623802|sp|Q9PFB0|BLH_XYLFA RecName: Full=Beta-lactamase hydrolase-like protein
 gi|9105660|gb|AAF83578.1|AE003917_12 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 431

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 47/122 (38%), Gaps = 11/122 (9%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRE 111
           S QPN        +  G +SI+NLR    E        E+ AA   G+     P+  T  
Sbjct: 13  SGQPNTDEFINFARR-GYRSIINLRPDGEEPNQPGNDAEQAAARRAGLAYNFVPVIGT-S 70

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY--IVAHYPKEEAHRQLSMLY 169
           + +  I+     + T    +L+HCKSG      A  +Y    ++    K +    L   +
Sbjct: 71  ITEADIQAFQRAIATTEGSVLVHCKSGTR----ALMLYALSEVIDGRMKRDEVEALGHAH 126

Query: 170 GH 171
           G 
Sbjct: 127 GF 128


>gi|71898224|ref|ZP_00680398.1| Protein of unknown function DUF442 [Xylella fastidiosa Ann-1]
 gi|71731963|gb|EAO34020.1| Protein of unknown function DUF442 [Xylella fastidiosa Ann-1]
          Length = 482

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 47/122 (38%), Gaps = 11/122 (9%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRE 111
           S QPN        +  G +SI+NLR    E        E+ AA   G+     P+  T  
Sbjct: 64  SGQPNTDEFINFARR-GYRSIINLRPDGEEPNQPGNDAEQAAARRAGLAYNFVPVIGT-S 121

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY--IVAHYPKEEAHRQLSMLY 169
           + +  I+     + T    +L+HCKSG      A  +Y    ++    K +    L   +
Sbjct: 122 ITEADIQAFQRAIATTEGSVLVHCKSGTR----ALMLYALSEVIDGRMKRDEVEALGHAH 177

Query: 170 GH 171
           G 
Sbjct: 178 GF 179


>gi|114564728|ref|YP_752242.1| hypothetical protein Sfri_3576 [Shewanella frigidimarina NCIMB 400]
 gi|114336021|gb|ABI73403.1| hypothetical protein Sfri_3576 [Shewanella frigidimarina NCIMB 400]
          Length = 193

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 63/187 (33%), Gaps = 22/187 (11%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLT---------ITTFTQNFHAVVPHEIYRSAQPNGTFI 63
           +    IL+      A       +          I     N   V+   +     P     
Sbjct: 9   LLSTSILMCCFFFSAGVFSAESMANIDTSKLGDIKAIKFNNQQVITAGL-----PTEPQF 63

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
             L  + GIK+++NL      +    E++    LG+   N  +   ++   E ++Q  S+
Sbjct: 64  AQL-AQAGIKTVINLIPNDNPNALINEQQIVTQLGMNYHNVSVD-WQQPTQENLQQFFSL 121

Query: 124 LKTA-PKPLLIHCKSGADRTGLASAVYLYIVAHYP-KEEAHR---QLSMLYGHFPVLKTI 178
           ++     P+L+HC +   R      +Y     + P   EA      L   +  +P  + +
Sbjct: 122 MEQNGDAPVLVHCAA-NYRASAFYYLYQARHNNAPSMAEALTPWGDLQQSFAEYPQWQQL 180

Query: 179 TMDITFE 185
             D   +
Sbjct: 181 IEDAKQQ 187


>gi|156375475|ref|XP_001630106.1| predicted protein [Nematostella vectensis]
 gi|156217120|gb|EDO38043.1| predicted protein [Nematostella vectensis]
          Length = 374

 Score = 69.1 bits (168), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 70/203 (34%), Gaps = 14/203 (6%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIY------RSAQPNGTFIEYLK 67
           F   I  G        L  Y      F  N+  +VP +I       R  +   +    L+
Sbjct: 156 FEKAISRGFFSFEDFDLNRYEEDEKAFDSNW--IVPGKILAMSDPQRRNEVKASRFAKLR 213

Query: 68  K---EYGIKSILNLRGKLPESWHKE--EEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           K   + G+K+++ L        +    + +     G    +             +K+   
Sbjct: 214 KHFRQNGVKTVVRLNRDDNMIKYGLVYDARCFTANGFAHSDQYFEDGGIPTKAIVKRFTR 273

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
           IL      + IHC++G  RTG   A YL     +   EA   L +   G    L+   ++
Sbjct: 274 ILDHCEGAVAIHCRAGLGRTGTLIACYLIKQYKFSAAEAVGWLRICRPGSVSSLQHCFLE 333

Query: 182 ITFEKITQLYPNNVSKGDTEQPM 204
              E I + Y  +++  D  + M
Sbjct: 334 HKQEAIQRGYTEDLTLEDLSETM 356


>gi|255010250|ref|ZP_05282376.1| hypothetical protein Bfra3_14012 [Bacteroides fragilis 3_1_12]
 gi|313148045|ref|ZP_07810238.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313136812|gb|EFR54172.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 351

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 53/135 (39%), Gaps = 40/135 (29%)

Query: 50  HEIYRSAQPNGTF---IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
            ++YRSAQ +         L+   GIK+IL+LR +         +K     G  +++ P+
Sbjct: 133 GKLYRSAQIDSLNCFAFRKLQ-NLGIKTILDLRSESELHNTPPLQK-----GFNVVHIPI 186

Query: 107 SA-----------TRELNDEQIKQLIS--------------------ILKTAPKPLLIHC 135
           S              ++  + I  ++                     +L     P++IHC
Sbjct: 187 STGDMEHILHGIQQEKIKTDTIYHMVEGMNRELVVKYQKEYKEIFDILLDKNSYPVVIHC 246

Query: 136 KSGADRTGLASAVYL 150
            SG  RTG+ SA+ L
Sbjct: 247 SSGKGRTGIVSALIL 261


>gi|163841421|ref|YP_001625826.1| protein tyrosine phosphatase [Renibacterium salmoninarum ATCC
           33209]
 gi|162954897|gb|ABY24412.1| protein tyrosine phosphatase [Renibacterium salmoninarum ATCC
           33209]
          Length = 244

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 59/153 (38%), Gaps = 32/153 (20%)

Query: 46  AVVPHEIYRSA---QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE-EKAANDLGIQL 101
            V P  ++RSA     +    + +    G+++I++LR        + +      D  I++
Sbjct: 30  RVQPGRVFRSARREYLSQAGWQQMYDS-GVRTIIDLRNVDEHGRRESDPTDVVEDARIRV 88

Query: 102 INFPLSATRELN---------------------DEQIKQLISILKTA---PKPLLIHCKS 137
           I+ P+                             E++  +   +  A   P  +LIHC +
Sbjct: 89  ISVPIEDQSVPEFQEIYPTHNSPECFWPTMRLWPEKLVAVYRAIAQAATEPGGVLIHCAA 148

Query: 138 GADRTGLASAVYLYIVAHYPKEE--AHRQLSML 168
           G DRTG    + L  +A  P E+  A  +L++ 
Sbjct: 149 GRDRTG-MIVMGLLQLAGVPAEQIVADYELAVR 180


>gi|50424373|ref|XP_460773.1| DEHA2F09482p [Debaryomyces hansenii CBS767]
 gi|74601445|sp|Q6BLZ8|OCA1_DEBHA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|49656442|emb|CAG89114.1| DEHA2F09482p [Debaryomyces hansenii]
          Length = 196

 Score = 68.7 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 54/129 (41%), Gaps = 10/129 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE----EEKAANDLG 98
           NF  V   ++YRS QP+     +L+ +  +K+IL L  + P+    +       A   +G
Sbjct: 33  NFCPVE-KQLYRSGQPSIINQSFLQ-DLNLKTILWLASEEPQEDFLDYCSMNNIAVEFVG 90

Query: 99  I--QLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           +  +     ++    L+++ IK+ + ++      PLL+ C  G  RTG        +   
Sbjct: 91  LMNEYSYQNVNPWDALSEDTIKKALELICNKENYPLLVCCGMGRHRTGTVIGCLRRL-QG 149

Query: 156 YPKEEAHRQ 164
           +       +
Sbjct: 150 WNLASVSEE 158


>gi|325122529|gb|ADY82052.1| hypothetical protein BDGL_001466 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 174

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 49/111 (44%), Gaps = 5/111 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KE+G  +++NL      +  + E++   D G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSAEQLK-LIKEFGCSTVINLALTNASNHLENEDRICLDFGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 + EQ   ++ ++      + + IHC     R      VY     +
Sbjct: 75  D-WEMPSAEQCLLVLDLIDHLVQNEIIWIHCAKNK-RVSCLMYVYRQFYMN 123


>gi|50288433|ref|XP_446646.1| hypothetical protein [Candida glabrata CBS 138]
 gi|74610046|sp|Q6FSZ8|OCA1_CANGA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|49525954|emb|CAG59573.1| unnamed protein product [Candida glabrata]
          Length = 217

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 46/131 (35%), Gaps = 15/131 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+     +L     +K+I+ L  + P+       +  +   I L 
Sbjct: 51  NFCPVE-RYLYRSGQPSPVNFPFLL-NLNLKTIVWLANEEPQDSLL---EFCDTHKINLQ 105

Query: 103 NFPLSA--------TRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++            L +  I  ++  +      PLL+ C  G  RTG        I+
Sbjct: 106 FAAINPDAGEDDNPWDGLTEHSIINVLQTIVTKENYPLLVCCGMGRHRTGTVIGCLRRIM 165

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 166 -GWNLASVSEE 175


>gi|320583554|gb|EFW97767.1| tyrosine phosphatase, putative [Pichia angusta DL-1]
          Length = 240

 Score = 68.7 bits (167), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 46/127 (36%), Gaps = 15/127 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P     E+L     +K+I+ +        +   +  A   G + I
Sbjct: 75  NFATVESD-LYRSGHPQPINFEFL-DTLNLKTIIYI--GDKTDNYDYYKWIAGHAGEKTI 130

Query: 103 NFPLSATREL----------NDEQIKQLISILKTA-PKPLLIHCKSGADRTGLASAVYLY 151
           +F     +            ++  +  +++++      P+LIH   G  R G+   +   
Sbjct: 131 SFRFFKMKPPSTFGTSHMFNDEVALNTVLNLVANRENYPILIHSNKGKHRVGVLVGLIRK 190

Query: 152 IVAHYPK 158
            +  +  
Sbjct: 191 FLQGWSL 197


>gi|315505847|ref|YP_004084734.1| protein tyrosine/serine phosphatase [Micromonospora sp. L5]
 gi|315412466|gb|ADU10583.1| protein tyrosine/serine phosphatase [Micromonospora sp. L5]
          Length = 262

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 51/130 (39%), Gaps = 31/130 (23%)

Query: 41  TQNFHAVVPHEIYRS---AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
           T +   V    +YRS   A+  G  +E      G++++++LR         +  +A   L
Sbjct: 21  TGDGRTVARGRLYRSDSLAKLAGEDLERFAA-LGVRTVIDLRYPWE---IADRGRAPESL 76

Query: 98  GIQLINFPLSAT----RELNDE--------------------QIKQLISILKTAPKPLLI 133
           G+   N  +        +++ +                    +++Q I ++     PL+ 
Sbjct: 77  GVTWHNLSIEHRPYVQADIDPDVDPWRYLADRYAEVAEDGVAELRQAIEVIADGEHPLVF 136

Query: 134 HCKSGADRTG 143
           HC SG DRTG
Sbjct: 137 HCASGKDRTG 146


>gi|119775338|ref|YP_928078.1| tyrosine-specific protein phosphatase [Shewanella amazonensis SB2B]
 gi|119767838|gb|ABM00409.1| dual specificity protein phosphatase [Shewanella amazonensis SB2B]
          Length = 158

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 43/115 (37%), Gaps = 18/115 (15%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
              +  LK   GI ++++L      S    +  A    GI  ++ P+        E + +
Sbjct: 22  PWDLGELKA-VGIGAVVSL------SDDAGDPDALARAGIAHLHRPIKRNVPPLAEDVSR 74

Query: 120 LISI----------LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                         ++ A  P+L+HC  G DRTGL  A YL      P   A  Q
Sbjct: 75  AGEAISEALAWVLEMEAAQTPVLVHCALGNDRTGLLMAAYLMARGAAPV-HAVSQ 128


>gi|321259720|ref|XP_003194580.1| cytoplasm protein [Cryptococcus gattii WM276]
 gi|317461052|gb|ADV22793.1| Cytoplasm protein, putative [Cryptococcus gattii WM276]
          Length = 190

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 52/133 (39%), Gaps = 20/133 (15%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           ++     NF  V P  IYRS  PN     +L K   +K I+ + G  P  + ++      
Sbjct: 17  SVVVPPINFSLVAPG-IYRSGHPNRKNFPFL-KRLNLKGIIYVEGSDP--YRQDSLDFVQ 72

Query: 96  DLGIQLINFPLSATRELN----DEQIKQLIS-ILKTAPKPLLIHCKSGADRTG-----LA 145
              ++L  F  S   +L      E+++ L+  +L     PLL+H     D TG     L 
Sbjct: 73  SQNLKLYRFDFSNESDLYTSEGQERLEALLKVLLDRRNYPLLVH-----DDTGKGSCTLV 127

Query: 146 SAVYLYIVAHYPK 158
            A+       +  
Sbjct: 128 CALIR-RFQSWSL 139


>gi|268610437|ref|ZP_06144164.1| protein tyrosine/serine phosphatase [Ruminococcus flavefaciens
           FD-1]
          Length = 229

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 50/120 (41%), Gaps = 21/120 (17%)

Query: 50  HEIYRS---AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
             I+RS   + P+    E L +E  I +I+++R +       +    A+  G    +FP+
Sbjct: 30  GVIWRSDVPSVPSAEDAEKL-RELNITTIIDMRTEAECKRTPDG--FADMEGFDYHHFPI 86

Query: 107 SATRELND---------------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
           +    + +               E I  +   +  A   +L HC +G DRTG+ SA+ L 
Sbjct: 87  TEGSGVPESLEAVPYSYMSIAMAESIPDVWRTIAEAESGVLFHCTAGKDRTGVVSAIILM 146


>gi|330793689|ref|XP_003284915.1| hypothetical protein DICPUDRAFT_86492 [Dictyostelium purpureum]
 gi|325085131|gb|EGC38544.1| hypothetical protein DICPUDRAFT_86492 [Dictyostelium purpureum]
          Length = 226

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +   +Y  A P    IE L  +Y I S++NL        +    +     GI  +  P+ 
Sbjct: 84  IDDNVYLGAMPMSYNIEMLVSKYQINSVVNL-----CDEYNGPIQQYTRYGITQLYIPVV 138

Query: 108 ATRELNDEQIKQLISILKT---APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
              E   ++IK  I  ++    +   + IHCK+G  R+G  +  +L        E+A + 
Sbjct: 139 DHYEPTVQEIKSSIDFIQRQVESGNRVFIHCKAGRGRSGAIAICWLAHSKRISIEQAQKM 198

Query: 165 L 165
           L
Sbjct: 199 L 199


>gi|160882943|ref|ZP_02063946.1| hypothetical protein BACOVA_00905 [Bacteroides ovatus ATCC 8483]
 gi|299146923|ref|ZP_07039990.1| conserved hypothetical protein [Bacteroides sp. 3_1_23]
 gi|156111626|gb|EDO13371.1| hypothetical protein BACOVA_00905 [Bacteroides ovatus ATCC 8483]
 gi|298514808|gb|EFI38690.1| conserved hypothetical protein [Bacteroides sp. 3_1_23]
          Length = 329

 Score = 68.4 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 59/161 (36%), Gaps = 38/161 (23%)

Query: 50  HEIYRSAQPN--GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
             IYRSAQ +          K  GI++I++LR +     + +     +D    +I+ P+ 
Sbjct: 108 GMIYRSAQIDSIPPCSRQELKNMGIRTIIDLRSENERHNYPQ----LHDDEFNIIHIPIL 163

Query: 108 AT-----------RELNDEQIKQLIS--------------------ILKTAPKPLLIHCK 136
                         ++  + I +L+                     +L     P++IHC 
Sbjct: 164 TGNMEEILQGIQEEKIKSDTIYRLVEQMNRELVINYQKEFKKLFTVLLDRTHYPVVIHCT 223

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           SG  RTG+ SA+ L       ++       +   +F + K 
Sbjct: 224 SGKGRTGVVSAL-LLAALGVNEDVIMEDYRLSNDYFNIPKA 263


>gi|50305669|ref|XP_452795.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74606830|sp|Q6CTE4|OCA1_KLULA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|49641928|emb|CAH01646.1| KLLA0C13343p [Kluyveromyces lactis]
          Length = 210

 Score = 68.4 bits (166), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 49/131 (37%), Gaps = 15/131 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+     +L     +K+I+ L  + P+       +  +D  IQL 
Sbjct: 44  NFCPVE-RYLYRSGQPSNVNFPFLL-NLKLKTIIWLANEEPQDALL---EFCDDHNIQLQ 98

Query: 103 NFPLSA--------TRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIV 153
              ++            L +  I+  +  +  +   PLL+ C  G  RTG        ++
Sbjct: 99  FAAINPDGGEDDNPWDGLTEHSIRNALHTIVNSESYPLLVCCGMGRHRTGTVIGCLRRLM 158

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 159 -GWNLASVSEE 168


>gi|302867750|ref|YP_003836387.1| conventional protein tyrosine phosphatase [Micromonospora
           aurantiaca ATCC 27029]
 gi|302570609|gb|ADL46811.1| conventional protein tyrosine phosphatase [Micromonospora
           aurantiaca ATCC 27029]
          Length = 262

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 51/130 (39%), Gaps = 31/130 (23%)

Query: 41  TQNFHAVVPHEIYRS---AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
           T +   V    +YRS   A+  G  +E      G++++++LR         +  +A   L
Sbjct: 21  TGDGRTVARGRLYRSDSLAKLAGEDLERFAA-LGVRTVIDLRYPWE---IADRGRAPESL 76

Query: 98  GIQLINFPLSAT----RELNDE--------------------QIKQLISILKTAPKPLLI 133
           G+   N  +        +++ +                    +++Q I ++     PL+ 
Sbjct: 77  GVTWHNLSIEHRPYVQADIDPDVDPWRYLADRYAEVAEDGVAELRQAIEVIADGEHPLVF 136

Query: 134 HCKSGADRTG 143
           HC SG DRTG
Sbjct: 137 HCASGKDRTG 146


>gi|260941936|ref|XP_002615134.1| hypothetical protein CLUG_05150 [Clavispora lusitaniae ATCC 42720]
 gi|238851557|gb|EEQ41021.1| hypothetical protein CLUG_05150 [Clavispora lusitaniae ATCC 42720]
          Length = 202

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 50/132 (37%), Gaps = 16/132 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V   ++YRS QP+     +L+ +  +K+IL L  + P    ++     +   I + 
Sbjct: 32  NFCPVE-KQLYRSGQPSIINQSFLQ-QLHLKTILWLASEEP---MEDFLDYCSAQNINIE 86

Query: 103 NFPL---------SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYI 152
              +         +    L++  I+  + ++      PLL+ C  G  RTG        +
Sbjct: 87  FVGMINDYNYTNINPWDSLDERTIQNALELICNKENYPLLVCCGMGRHRTGAVIGCLRRL 146

Query: 153 VAHYPKEEAHRQ 164
              +       +
Sbjct: 147 -QGWNLASVSEE 157


>gi|239501615|ref|ZP_04660925.1| hypothetical protein AbauAB_04826 [Acinetobacter baumannii AB900]
          Length = 174

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSIEQLK-LIKEYGCSTVINLALSNSPDSIKNEDQVCLEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 + +Q   ++ ++      + + IHC     R      VY     +
Sbjct: 75  D-WETPSSDQCLLVLDLIDHLVQNEIVWIHCAKNK-RVSCLMYVYRQFYMN 123


>gi|169795675|ref|YP_001713468.1| hypothetical protein ABAYE1570 [Acinetobacter baumannii AYE]
 gi|184158424|ref|YP_001846763.1| hypothetical protein ACICU_02104 [Acinetobacter baumannii ACICU]
 gi|213158381|ref|YP_002319678.1| hypothetical protein AB57_2328 [Acinetobacter baumannii AB0057]
 gi|215483161|ref|YP_002325368.1| hypothetical protein ABBFA_001465 [Acinetobacter baumannii
           AB307-0294]
 gi|301346289|ref|ZP_07227030.1| hypothetical protein AbauAB0_08590 [Acinetobacter baumannii AB056]
 gi|301512084|ref|ZP_07237321.1| hypothetical protein AbauAB05_10902 [Acinetobacter baumannii AB058]
 gi|301595684|ref|ZP_07240692.1| hypothetical protein AbauAB059_07727 [Acinetobacter baumannii
           AB059]
 gi|332852493|ref|ZP_08434232.1| hypothetical protein HMPREF0021_01807 [Acinetobacter baumannii
           6013150]
 gi|332871304|ref|ZP_08439853.1| hypothetical protein HMPREF0020_03508 [Acinetobacter baumannii
           6013113]
 gi|332873916|ref|ZP_08441856.1| hypothetical protein HMPREF0022_01468 [Acinetobacter baumannii
           6014059]
 gi|169148602|emb|CAM86468.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|183210018|gb|ACC57416.1| hypothetical protein ACICU_02104 [Acinetobacter baumannii ACICU]
 gi|213057541|gb|ACJ42443.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213988963|gb|ACJ59262.1| hypothetical protein ABBFA_001465 [Acinetobacter baumannii
           AB307-0294]
 gi|322508750|gb|ADX04204.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323518353|gb|ADX92734.1| hypothetical protein ABTW07_2310 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332729195|gb|EGJ60538.1| hypothetical protein HMPREF0021_01807 [Acinetobacter baumannii
           6013150]
 gi|332731588|gb|EGJ62874.1| hypothetical protein HMPREF0020_03508 [Acinetobacter baumannii
           6013113]
 gi|332737902|gb|EGJ68789.1| hypothetical protein HMPREF0022_01468 [Acinetobacter baumannii
           6014059]
          Length = 174

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSIEQLK-LIKEYGCSTVINLALSNSPDSIKNEDQVCLEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 + +Q   ++ ++      + + IHC     R      VY     +
Sbjct: 75  D-WETPSSDQCLLVLDLIDHLVQNEIVWIHCAKNK-RVSCLMYVYRQFYMN 123


>gi|87306696|ref|ZP_01088843.1| hypothetical protein DSM3645_10192 [Blastopirellula marina DSM
           3645]
 gi|87290875|gb|EAQ82762.1| hypothetical protein DSM3645_10192 [Blastopirellula marina DSM
           3645]
          Length = 151

 Score = 68.0 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 6/111 (5%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLR--GKLPESW-HKEEEKAANDLGIQLINFPLSATRELN 113
           QPN   I  LK E G ++I+N R  G+  +      E+       ++ ++ P+S    ++
Sbjct: 16  QPNEAEIGQLKLE-GFRTIVNFREDGEDDQPITPSHEKDWVVAAEMEYLHLPVSM-MTMS 73

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
            + + +     +  PKP+  HC SG  R G    ++L        EE  +Q
Sbjct: 74  PQIVDEFRDKYQYLPKPIFAHCASGK-RAGAMVMMHLACEQGMSGEETLKQ 123


>gi|323331976|gb|EGA73388.1| Oca2p [Saccharomyces cerevisiae AWRI796]
          Length = 172

 Score = 68.0 bits (165), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 55/144 (38%), Gaps = 12/144 (8%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL-SATRELNDEQIK 118
                ++K +  +K+I+ +     +   +E +       I+  +  + S+  E   E++ 
Sbjct: 2   PLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN 59

Query: 119 QLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL-K 176
           Q++ + L     P+L+H   G  R G+   +   ++  +     +++    YG F    K
Sbjct: 60  QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGIYQE----YGLFSGGMK 115

Query: 177 TITMDIT---FEKITQLYPNNVSK 197
                     FE   ++  N +  
Sbjct: 116 DGVDLEFITMFETNLKIPRNVIPG 139


>gi|167045003|gb|ABZ09667.1| putative dual specificity phosphatase, catalytic domain protein
           [uncultured marine crenarchaeote HF4000_APKG8G15]
          Length = 164

 Score = 68.0 bits (165), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 54/132 (40%), Gaps = 13/132 (9%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK-LPESWHKEEEKAA 94
           T+T     F  ++ +++  S  P          E GIKSI+ +R + L + W K+     
Sbjct: 14  TVTGRPDKFSWLIDNKLAGSGIPTSIDEVQWAIEQGIKSIVTVREEPLDDDWVKD----- 68

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGLASAVYLY 151
               I+ ++   +         +   +  +    T  +P+++HC +G  RTG   A YL 
Sbjct: 69  ----IKYLHIMSNDMGVPEFVDLVSAVDFIHSRITNNEPVMVHCLAGLGRTGTLLACYLI 124

Query: 152 IVAHYPKEEAHR 163
                  ++A +
Sbjct: 125 KHQKMSADDAMQ 136


>gi|169633322|ref|YP_001707058.1| hypothetical protein ABSDF1673 [Acinetobacter baumannii SDF]
 gi|169152114|emb|CAP01013.1| conserved hypothetical protein [Acinetobacter baumannii]
          Length = 174

 Score = 68.0 bits (165), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 47/111 (42%), Gaps = 5/111 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   +  L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSIEQLR-LIKEYGCSTVINLALSNSPDSIKNEDQVCIEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAH 155
                 + +Q   ++ ++      + + IHC     R      VY     +
Sbjct: 75  D-WETPSSDQCLLVLDLIDHLVQNEIVWIHCAKNK-RVSCLMYVYRQFYMN 123


>gi|320167291|gb|EFW44190.1| tyrosine phosphatase [Capsaspora owczarzaki ATCC 30864]
          Length = 166

 Score = 67.6 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 33/167 (19%), Positives = 70/167 (41%), Gaps = 19/167 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V  ++YRS QPN     +L+K   +K+I+ L  + P    +     A+D  I+++
Sbjct: 10  NFG-MVEEDLYRSGQPNELNFPFLEK-LHLKTIVFLAAEDPSQALRN---FADDHDIEVL 64

Query: 103 NFP-----LSATRELNDEQIKQLIS-ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +             L +E + + ++ +L     PL + C  G+ RTG        +   +
Sbjct: 65  HLGKAQASALTWAPLAEETVIEALNVVLNPEHYPLHVMCNLGSHRTGTLIGCLRKL-QRW 123

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
                  +    Y    + K   + +  E+  + +  ++ +  T++P
Sbjct: 124 NLTSIFEE----YRRHAMGK---VRLLNEQFIEFFDTDLVRIPTQRP 163


>gi|189464962|ref|ZP_03013747.1| hypothetical protein BACINT_01306 [Bacteroides intestinalis DSM
           17393]
 gi|189437236|gb|EDV06221.1| hypothetical protein BACINT_01306 [Bacteroides intestinalis DSM
           17393]
          Length = 356

 Score = 67.6 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 55/134 (41%), Gaps = 38/134 (28%)

Query: 50  HEIYRSAQPNGTF--IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
             +YRSAQ +          K  GIK+I++LR +     H   ++     G  +++ P+ 
Sbjct: 134 GMLYRSAQIDSLECYSRRELKNIGIKTIVDLRSESELKGHTPLQE-----GFNVVHIPIK 188

Query: 108 ATR-----------ELNDEQIKQLIS--------------------ILKTAPKPLLIHCK 136
                         ++  + + +++                     +L +A  P++IHC 
Sbjct: 189 TGDMEDILRGIQEQKIKSDTVYRMVERMNRELVMNYHHEYRQIFDILLDSANYPVVIHCS 248

Query: 137 SGADRTGLASAVYL 150
           SG  RTG+ASA+ L
Sbjct: 249 SGKGRTGIASALIL 262


>gi|255725660|ref|XP_002547759.1| hypothetical protein CTRG_02066 [Candida tropicalis MYA-3404]
 gi|240135650|gb|EER35204.1| hypothetical protein CTRG_02066 [Candida tropicalis MYA-3404]
          Length = 227

 Score = 67.6 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/144 (19%), Positives = 53/144 (36%), Gaps = 28/144 (19%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V   ++YRS QP+     +L  +  +K+I+ L  + P       ++  +D  I + 
Sbjct: 52  NFCPVE-KQLYRSGQPSMINESFL-NQLNLKTIIWLANEEPSDEF---QEYCSDSNINIE 106

Query: 103 NFPL---------------------SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGAD 140
              +                     +    LND  IK+ + ++   +  P+LI C  G  
Sbjct: 107 YIGMINDFQSQFESNYNNVNRSTMANPWDALNDTTIKKSLEVIVDKSNYPILICCGMGRH 166

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQ 164
           RTG        +  ++       +
Sbjct: 167 RTGTVIGCLRRL-QNWNLNSVSEE 189


>gi|323307448|gb|EGA60722.1| Oca2p [Saccharomyces cerevisiae FostersO]
          Length = 172

 Score = 67.6 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 55/144 (38%), Gaps = 12/144 (8%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL-SATRELNDEQIK 118
                ++K +  +K+I+ +     +   +E +       I+  +  + S+  E   E++ 
Sbjct: 2   PLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN 59

Query: 119 QLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL-K 176
           Q++ + L     P+L+H   G  R G+   +   ++  +     +++    YG F    K
Sbjct: 60  QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGIYQE----YGLFSGGMK 115

Query: 177 TITMDIT---FEKITQLYPNNVSK 197
                     FE   ++  N +  
Sbjct: 116 DGVDLEFITXFETNLKIPRNVIPG 139


>gi|170726100|ref|YP_001760126.1| dual specificity protein phosphatase [Shewanella woodyi ATCC 51908]
 gi|169811447|gb|ACA86031.1| dual specificity protein phosphatase [Shewanella woodyi ATCC 51908]
          Length = 156

 Score = 67.6 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 52/132 (39%), Gaps = 18/132 (13%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLK-KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           F  V      RS  PN    +  + K  GI +IL++ G         +  A     +   
Sbjct: 5   FWLVEDKVAGRSG-PNKDMWDLNEIKSAGIGAILSVNGGEDC-----DLAAIKQAELAYA 58

Query: 103 NFPLSATRELND-------EQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYLYI 152
             P S+     +       EQ+ + ++ ++       P+LIHC+SG DRTGL  A YL  
Sbjct: 59  CIPFSSNIPPTEDDLGICVEQLPKALAFIRDCEAKDLPVLIHCRSGKDRTGLLMAYYLME 118

Query: 153 VAHYPKEEAHRQ 164
               P   A  Q
Sbjct: 119 NGAAPL-HAVSQ 129


>gi|323346914|gb|EGA81193.1| Oca2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 172

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 55/144 (38%), Gaps = 12/144 (8%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL-SATRELNDEQIK 118
                ++K +  +K+I+ +     +   +E +       I+  +  + S+  E   E++ 
Sbjct: 2   PLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN 59

Query: 119 QLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL-K 176
           Q++ + L     P+L+H   G  R G+   +   ++  +     +++    YG F    K
Sbjct: 60  QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGIYQE----YGLFSGGMK 115

Query: 177 TITMDIT---FEKITQLYPNNVSK 197
                     FE   ++  N +  
Sbjct: 116 DGVDLEFITMFETNLKIPRNVIPG 139


>gi|323352586|gb|EGA85085.1| Oca2p [Saccharomyces cerevisiae VL3]
          Length = 172

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 55/144 (38%), Gaps = 12/144 (8%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL-SATRELNDEQIK 118
                ++K +  +K+I+ +     +   +E +       I+  +  + S+  E   E++ 
Sbjct: 2   PLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN 59

Query: 119 QLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL-K 176
           Q++ + L     P+L+H   G  R G+   +   ++  +     +++    YG F    K
Sbjct: 60  QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGIYQE----YGLFSGGMK 115

Query: 177 TITMDIT---FEKITQLYPNNVSK 197
                     FE   ++  N +  
Sbjct: 116 DGVDLEFITMFETNLKIPRNVIPG 139


>gi|156841424|ref|XP_001644085.1| hypothetical protein Kpol_505p3 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114720|gb|EDO16227.1| hypothetical protein Kpol_505p3 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 284

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 45/131 (34%), Gaps = 15/131 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+     +L     +K+I+ L  + P+       +      I+L 
Sbjct: 118 NFCPVE-RYLYRSGQPSPVNFPFL-SNLNLKTIIWLANEEPQDTLL---EFCETNDIELQ 172

Query: 103 NFPLSA--------TRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++            L +  I   +  +      PLLI C  G  RTG        ++
Sbjct: 173 FSAINPDAGEDDNPWDGLTENSIINALQTIVSNKSYPLLICCGMGRHRTGTVVGCLRRLM 232

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 233 -GWNLASVSEE 242


>gi|225851439|ref|YP_002731673.1| dual specificity protein phosphatase [Persephonella marina EX-H1]
 gi|225646038|gb|ACO04224.1| dual specificity protein phosphatase [Persephonella marina EX-H1]
          Length = 149

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/139 (23%), Positives = 60/139 (43%), Gaps = 10/139 (7%)

Query: 58  PNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
           P    ++    E G+ +++NL G    S+  E++    + G ++I  P S    + +E+ 
Sbjct: 15  PEPEELDIWVNE-GVNTVINLLGGDYGSFIAEKQ---REKGFEVIRIPFSMADPIPEEEF 70

Query: 118 KQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
             +   +  L+   K +++HCK G  R+G   A YL   + Y  EEA   +    G  P 
Sbjct: 71  TAVYEYVDQLREDRKKVVVHCKYGQARSGTFLAGYLI-HSGYSYEEALNTVFSK-GFTPH 128

Query: 175 LKTITMDITFEKITQLYPN 193
            +   +    E   +L  +
Sbjct: 129 TE-YQIRFLKELYEKLRSD 146


>gi|221487729|gb|EEE25961.1| protein-tyrosine phosphatase, putative [Toxoplasma gondii GT1]
          Length = 502

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 36/93 (38%), Gaps = 6/93 (6%)

Query: 59  NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118
                  +    GIK+++ L  K        + +   D  I+ ++         + E I+
Sbjct: 215 TPEDYANIFNSLGIKTVVRLNKKQ------YDARKFTDRNIEHVDLFFVDGTCPSREIIQ 268

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
             + +++    P+ +HCK+G  RTG     Y  
Sbjct: 269 AFLQVVENRDHPIAVHCKAGLGRTGTLIGCYAI 301


>gi|296283666|ref|ZP_06861664.1| hypothetical protein CbatJ_08594 [Citromicrobium bathyomarinum
           JL354]
          Length = 261

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 57/152 (37%), Gaps = 34/152 (22%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLK--KEYGIKSILNLRG---------KLPESWHKEEEKA 93
             VV   +YRS Q        L+   + GI+++++LRG         + P+ W  E    
Sbjct: 30  GRVVSGLLYRSGQHVEASDADLRTFADLGIRTVIDLRGNGERERHPCRRPDLWDGEVVFY 89

Query: 94  ANDLGIQLINFPLSATRELNDEQIK---------------------QLISILKTAPKPLL 132
             +      + P    REL  E  +                     Q +  L       L
Sbjct: 90  DGETSSSPPHVP-QERRELTPETAQERMLTLYTRMPENPAMQVIFGQYLRTLADRDGASL 148

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           +HC +G DRTG+A+A+ L+ +    + +   +
Sbjct: 149 VHCFAGKDRTGIAAAL-LHHILGVSRADMVTE 179


>gi|58268464|ref|XP_571388.1| cytoplasm protein [Cryptococcus neoformans var. neoformans JEC21]
 gi|134112698|ref|XP_774892.1| hypothetical protein CNBF0570 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257540|gb|EAL20245.1| hypothetical protein CNBF0570 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227623|gb|AAW44081.1| cytoplasm protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 190

 Score = 67.6 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 52/133 (39%), Gaps = 20/133 (15%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           ++     NF  V P  IYRS  PN     +L K   +K I+ + G  P  + ++      
Sbjct: 17  SVVVPPINFSLVAPG-IYRSGHPNRKNFPFL-KRLNLKGIIYVEGSDP--YRQDSLDFVQ 72

Query: 96  DLGIQLINFPLSATRELN----DEQIKQLIS-ILKTAPKPLLIHCKSGADRTG-----LA 145
              ++L  F  S   +L      E+++ L+  +L     PLL+H     D TG     L 
Sbjct: 73  SQNLELYRFDFSNESDLYTPEGQERMEALLKVLLDKRNYPLLVH-----DDTGKGSCTLV 127

Query: 146 SAVYLYIVAHYPK 158
            A+       +  
Sbjct: 128 CALIR-RFQSWSL 139


>gi|148654972|ref|YP_001275177.1| hypothetical protein RoseRS_0813 [Roseiflexus sp. RS-1]
 gi|148567082|gb|ABQ89227.1| protein of unknown function DUF442 [Roseiflexus sp. RS-1]
          Length = 165

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 52/112 (46%), Gaps = 5/112 (4%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           + QP       L  E G + ++N+R     +    +++ A  +G+Q I+ PL    EL  
Sbjct: 30  AGQPQPDDWAALAAE-GFQVVVNMRSDPERA--AVQQRNAEAVGLQYIHLPLPVY-ELEP 85

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
           + ++Q   ++++    + +HC+S A R  L   +   +   + +EEA   L 
Sbjct: 86  DHLEQYHQVMQSVQGRVFLHCRS-ATRVALMWMLDRIVYDGWRREEAESALR 136


>gi|254514440|ref|ZP_05126501.1| conserved hypothetical protein [gamma proteobacterium NOR5-3]
 gi|219676683|gb|EED33048.1| conserved hypothetical protein [gamma proteobacterium NOR5-3]
          Length = 216

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 68/177 (38%), Gaps = 14/177 (7%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTI---TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKE 69
           +F +K    VL + A+ L   +          +NFH V    +  + Q     +  L+ E
Sbjct: 33  LFTVKFYRLVLAIAALWLSPAYSKDPHTLEDARNFHRV-SDVLLTAGQIYPEQVAALQSE 91

Query: 70  YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP- 128
             ++ I+NL    P S + EE  A    GI  +N P+          ++   +++     
Sbjct: 92  -SVELIINLAVADP-SRNAEEPFAVQQAGINYVNIPV-LWDAPTPRDLELFFAMMDARQG 148

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-----SMLYGHFPVLKTITM 180
           +  L+HC +   R    + +Y  I    P+ +A + L        +   PV +T   
Sbjct: 149 RKTLVHCFA-NFRASAFTYLYRVIREGVPEVDARKDLYAVWDEAKFDENPVWRTFIN 204


>gi|163749733|ref|ZP_02156979.1| tyrosine-specific protein phosphatase, putative [Shewanella
           benthica KT99]
 gi|161330546|gb|EDQ01504.1| tyrosine-specific protein phosphatase, putative [Shewanella
           benthica KT99]
          Length = 156

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 51/133 (38%), Gaps = 20/133 (15%)

Query: 44  FHAVVPHEIYRSAQPNGT--FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           F  V      RS  PN     ++ +K+  GI ++L++ G         + +A  D  +  
Sbjct: 5   FWLVEDKIAGRSG-PNKEAWDLKEIKRS-GIGAVLSVNGGEDC-----DPQAFIDADLSY 57

Query: 102 INFPLSATRELNDEQI----------KQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
              P S+     +E +             I   +    P+LIHC+SG DRT L  A YL 
Sbjct: 58  ACIPFSSNIPPKEEDLALCVEQLPKALAFIRECEANNLPVLIHCRSGKDRTALIMAYYLM 117

Query: 152 IVAHYPKEEAHRQ 164
                P   A  Q
Sbjct: 118 ENGAAPL-HAVSQ 129


>gi|148653189|ref|YP_001280282.1| hypothetical protein PsycPRwf_1387 [Psychrobacter sp. PRwf-1]
 gi|148572273|gb|ABQ94332.1| hypothetical protein PsycPRwf_1387 [Psychrobacter sp. PRwf-1]
          Length = 176

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 5/111 (4%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
           S + +   +     E GI+ I+NL+ +   S+  +E  A    GI   + P++   +L  
Sbjct: 49  SGKLSAEQVVK-AAEAGIEHIINLQPESELSF--DERAAVEAQGINYTHLPIAGAEDLKQ 105

Query: 115 EQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
             + +    L+T   K  LIHC SG +R G   A+    +     + A +Q
Sbjct: 106 VNLLEFDKALRTHHGKKTLIHCGSG-NRVGACMALRAGWLRGRKMDTAMQQ 155


>gi|3264600|gb|AAC24571.1| hypoxically induced transcript 2 [Zea mays]
          Length = 102

 Score = 67.2 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 33/83 (39%), Gaps = 6/83 (7%)

Query: 111 ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY 169
            + +E I++ + + L    +P+LIHCK G  RTG        +   +       +    Y
Sbjct: 24  HIPEETIREALKVVLDVRNQPVLIHCKRGEHRTGCVVGCLRKL-QKWCLSSVFDE----Y 78

Query: 170 GHFPVLKTITMDITFEKITQLYP 192
            HF   K  T D  F ++     
Sbjct: 79  LHFAAAKARTTDQRFMELFDAQS 101


>gi|237830691|ref|XP_002364643.1| dual specificity protein phosphatase CDC14A, putative [Toxoplasma
           gondii ME49]
 gi|211962307|gb|EEA97502.1| dual specificity protein phosphatase CDC14A, putative [Toxoplasma
           gondii ME49]
 gi|221507522|gb|EEE33126.1| protein-tyrosine phosphatase, putative [Toxoplasma gondii VEG]
          Length = 479

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 36/93 (38%), Gaps = 6/93 (6%)

Query: 59  NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118
                  +    GIK+++ L  K        + +   D  I+ ++         + E I+
Sbjct: 215 TPEDYANIFNSLGIKTVVRLNKKQ------YDARKFTDRNIEHVDLFFVDGTCPSREIIQ 268

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
             + +++    P+ +HCK+G  RTG     Y  
Sbjct: 269 AFLQVVENRDHPIAVHCKAGLGRTGTLIGCYAI 301


>gi|146419788|ref|XP_001485854.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 185

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 53/131 (40%), Gaps = 13/131 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V   ++YRS QP      +L+ +  +K+I+ L  + P+    +   + N + I+ +
Sbjct: 18  NFCPVE-KQLYRSGQPLIINQSFLQ-DLNLKTIIWLASEEPQEEFLDYC-SMNSINIEFV 74

Query: 103 NF--------PLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIV 153
                      ++    LN+  IK+ + ++      P+L+ C  G  RTG        + 
Sbjct: 75  GMINDDYSYQNVNPWDSLNETTIKKALELICDRNNYPMLVCCGMGRHRTGTVIGCLRRL- 133

Query: 154 AHYPKEEAHRQ 164
             +       +
Sbjct: 134 QGWNLASVSEE 144


>gi|149178982|ref|ZP_01857557.1| probable secreted glycosyl hydrolase [Planctomyces maris DSM 8797]
 gi|148842181|gb|EDL56569.1| probable secreted glycosyl hydrolase [Planctomyces maris DSM 8797]
          Length = 185

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 47/115 (40%), Gaps = 13/115 (11%)

Query: 44  FHAVVPHEIYRS------AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
              + P  +YRS       QP       ++K+ G+K+++NLR +    W  +E      L
Sbjct: 40  LGQITP--LYRSKLVYLAGQPTKEDFRLIQKD-GVKTVVNLRTEKELDW--DEGGFVRML 94

Query: 98  GIQLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLY 151
            +  +  P      L      Q  S+L   A  PL++H  S A+R G    V+  
Sbjct: 95  ELDYVAIPFLTPDTLTPAVFDQCRSVLNDQARHPLILHSAS-ANRVGAIWLVHRV 148


>gi|3319370|gb|AAC28219.1| contains similarity to C3HC4-type zinc fingers (Pfam: zf-C3HC4.hmm,
           score: 32.94) [Arabidopsis thaliana]
 gi|7267151|emb|CAB80819.1| putative protein [Arabidopsis thaliana]
          Length = 233

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 55/156 (35%), Gaps = 35/156 (22%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF A+V + I+RS  P      +L+    +KSI+ L    PE++ +   + A   GIQ+ 
Sbjct: 34  NF-AMVDNGIFRSGFPEPVSFSFLQS-LRLKSIIYL---CPEAYPEVNREFAKSNGIQVF 88

Query: 103 NFPLSATR--------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
            F +   +         + DE I++ +                   RTG        I  
Sbjct: 89  QFGIERCKVRLVEPFVNIPDEVIREALQ-----------------HRTGCLVGCVRKI-Q 130

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
            +       +    Y  F   K    D  F ++  +
Sbjct: 131 RWCLSSIFDE----YQRFAAAKARISDQRFMELFDI 162


>gi|296121147|ref|YP_003628925.1| hypothetical protein Plim_0882 [Planctomyces limnophilus DSM 3776]
 gi|296013487|gb|ADG66726.1| hypothetical protein Plim_0882 [Planctomyces limnophilus DSM 3776]
          Length = 365

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 10/92 (10%)

Query: 59  NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118
               +  L    G+K+I+++ G  P        + A   G++ ++ P+  +  L+ +QI 
Sbjct: 102 TDAAMAELAAS-GVKTIISVDGAPPL------VELAKKHGLKYVHIPVKYS-ALSRDQIV 153

Query: 119 QLISILKTAPKPLLIHCKSGADR--TGLASAV 148
            L S+L+   +P+ +HC  G  R    L +A+
Sbjct: 154 SLASVLQRNHEPVYVHCHHGKHRGPAALVAAL 185


>gi|283768619|ref|ZP_06341531.1| conserved hypothetical protein [Bulleidia extructa W1219]
 gi|283105011|gb|EFC06383.1| conserved hypothetical protein [Bulleidia extructa W1219]
          Length = 253

 Score = 66.8 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 64/171 (37%), Gaps = 37/171 (21%)

Query: 45  HAVVPHEIYRS---AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK--------- 92
             +     YRS    Q +   +E ++K  G+K I++LR K     H + +          
Sbjct: 22  RKIKKGFFYRSSGLNQFSSQDLEKIRK-IGLKKIIDLRSKEEREKHPDPDLGVPIICFDA 80

Query: 93  -----------------AANDLGIQLINFPLSATRELN--DEQIKQLISILKTAPKPLLI 133
                            +  + G+Q     L     +   +  +K+++ +++    PLL 
Sbjct: 81  YRAKYMDDIDFSFNGMLSLGEKGLQQKALRLKYYENMPFGNPYLKKVMELIQEDELPLLF 140

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           HC SG DRTGL + V L +    P++     +   Y      +   +D  F
Sbjct: 141 HCASGKDRTGLMAMVILGLFEVEPEK-----MLEDYLQTNDYRRAIIDQVF 186


>gi|88900443|ref|NP_001034709.1| hypothetical protein LOC323834 [Danio rerio]
 gi|56208091|emb|CAI21375.1| novel protein similar to vertebrate dual specificity phosphatase 23
           (DUSP23) [Danio rerio]
 gi|111309264|gb|AAI21762.1| Si:dkeyp-95d10.1 [Danio rerio]
          Length = 161

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 10/125 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P ++   A+P          ++GIK +++L    P ++     +   +  + L 
Sbjct: 12  NFSWVEPCKLAGLARPTMVHHYRYLLDHGIKHLVSLLEIKPPNY-----EKCPE--LSLH 64

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPKE 159
              +      +  QI Q +SI++ A      + +HC  G  RTG   A YL    H   E
Sbjct: 65  QISIVDFTPPSRSQILQFLSIVEKANAKGEGVAVHCAHGHGRTGTMLACYLVKSRHLSGE 124

Query: 160 EAHRQ 164
           EA ++
Sbjct: 125 EAIKE 129


>gi|237720586|ref|ZP_04551067.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|260172627|ref|ZP_05759039.1| hypothetical protein BacD2_12241 [Bacteroides sp. D2]
 gi|293373373|ref|ZP_06619729.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|315920917|ref|ZP_07917157.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|229450337|gb|EEO56128.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|292631659|gb|EFF50281.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|313694792|gb|EFS31627.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 355

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 59/161 (36%), Gaps = 38/161 (23%)

Query: 50  HEIYRSAQPN--GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
             IYRSAQ +          K  G+++I++LR +     + +     +D    +I+ P+ 
Sbjct: 134 GMIYRSAQIDSIPPCSRRELKNMGVRTIIDLRSENERHNYPQ----LHDDEFNIIHIPIL 189

Query: 108 AT-----------RELNDEQIKQLIS--------------------ILKTAPKPLLIHCK 136
                         ++  + I +L+                     +L     P++IHC 
Sbjct: 190 TGNMEEILQGIQEEKIKSDTIYRLVEQMNRELVINYQKEFKKLFTVLLDRTHYPVVIHCT 249

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           SG  RTG+ SA+ L       ++       +   +F + K 
Sbjct: 250 SGKGRTGVVSAL-LLAALGVNEDVIMEDYRLSNDYFNIPKA 289


>gi|322488072|emb|CBZ23317.1| tyrosine phospatase-like protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 869

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 52/127 (40%), Gaps = 10/127 (7%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  V    +YR A P      Y+ +   +++I++L   +PE    + +  A    IQL +
Sbjct: 392 FARVESG-VYRGAYPVLRNFPYI-RRLRLRTIVSL---IPEPPTYDIKCFAEAEHIQLHH 446

Query: 104 FPLSATR---ELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 +   +L   ++ + + ++      PL IHC  G   TGL       ++  +  +
Sbjct: 447 IHAERAKGEVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALRKLLQ-WDAK 505

Query: 160 EAHRQLS 166
            A+ +  
Sbjct: 506 VANAEFQ 512


>gi|226361844|ref|YP_002779622.1| protein-tyrosine-phosphatase [Rhodococcus opacus B4]
 gi|226240329|dbj|BAH50677.1| putative protein-tyrosine-phosphatase [Rhodococcus opacus B4]
          Length = 236

 Score = 66.4 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 17/125 (13%)

Query: 52  IYRSAQPNGTFI-EYLKKEYGIKSILNLRGKLPESW--HKEEEKAANDLGIQL-----IN 103
           +YRSA P           E+  +++++LR     +   H  +        + L     + 
Sbjct: 31  LYRSALPAPGDARPTAVAEWPARTVIDLRSPREFATRAHPLQSDDTTVHQVSLLTDAEVT 90

Query: 104 FPLSATRELND---------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
            P   TR  +          +++  L+ I  TAP P+L+HC +G DRTG+A A+ L I  
Sbjct: 91  APSQGTRLADVYQGILVNAGDKLVALLQIAATAPGPILLHCAAGKDRTGIAVALLLRISG 150

Query: 155 HYPKE 159
             P++
Sbjct: 151 VDPRD 155


>gi|62202153|gb|AAH92774.1| Si:dkeyp-95d10.1 [Danio rerio]
          Length = 177

 Score = 66.1 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 10/125 (8%)

Query: 43  NFHAVVPHEIYRSAQ