PSIBLAST alignment of GI: 254780898 and protein with PDB id: 2q05

>gi|150261421|pdb|2Q05|A Chain A, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM Vaccinia Virus Wr Length = 195
>gi|150261422|pdb|2Q05|B Chain B, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM Vaccinia Virus Wr Length = 195
 Score = 45.9 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 39/115 (33%), Gaps = 15/115 (13%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V + +Y     N         E   K +LNL            +    +  I +I+ PL 
Sbjct: 52  VTNNVYLGNYKNAXD--APSSEVKFKYVLNLTXD---------KYTLPNSNINIIHIPLV 100

Query: 108 ATRELND----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
                +     + +   +S      +P+L+HC +G +R+G     YL        
Sbjct: 101 DDTTTDISKYFDDVTAFLSKCDQRNEPVLVHCAAGVNRSGAXILAYLXSKNKESL 155