BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780898|ref|YP_003065311.1| hypothetical protein
CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62]
         (207 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040575|gb|ACT57371.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score =  223 bits (567), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG
Sbjct: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL
Sbjct: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM
Sbjct: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180

Query: 181 DITFEKITQLYPNNVSKGDTEQPMNAT 207
           DITFEKITQLYPNNVSKGDTEQPMNAT
Sbjct: 181 DITFEKITQLYPNNVSKGDTEQPMNAT 207


>gi|222085806|ref|YP_002544336.1| hypothetical protein Arad_2152 [Agrobacterium radiobacter K84]
 gi|221723254|gb|ACM26410.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 198

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 79/192 (41%), Positives = 115/192 (59%), Gaps = 6/192 (3%)

Query: 1   MIKIKKPR-KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN 59
           M K   P  + L      +LL +     ++ G Y   +  +T NFH V+  E+YRS+QP+
Sbjct: 1   MPKTPSPLFRRLRRIGRGVLLALSPFALIATGFYAHML--WTTNFHPVIAGEVYRSSQPS 58

Query: 60  GTFIEYLKKEYGIKSILNLRGKL-PESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118
            + I  L+K+YGIK+I+NLRG     +W+  E   A +L I  I+F +S+  EL   Q  
Sbjct: 59  ASTIAELQKQYGIKTIINLRGNNTGHAWYDSEVAQAKELNIDHIDFRMSSAHELTQAQAA 118

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH--FPVLK 176
           QL+ I++ APKPLLIHC++G+DRTGLASA+YL  +A   +  A  Q+S++YGH  F   +
Sbjct: 119 QLVEIMRDAPKPLLIHCQAGSDRTGLASALYLAAIAKTGEATAESQMSIIYGHLPFSFTR 178

Query: 177 TITMDITFEKIT 188
              MD TFEK+ 
Sbjct: 179 AYAMDRTFEKLE 190


>gi|260576858|ref|ZP_05844841.1| protein tyrosine/serine phosphatase [Rhodobacter sp. SW2]
 gi|259020895|gb|EEW24208.1| protein tyrosine/serine phosphatase [Rhodobacter sp. SW2]
          Length = 191

 Score =  164 bits (414), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 76/181 (41%), Positives = 113/181 (62%), Gaps = 6/181 (3%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           K ++ F +++  G+L+L  ++L  Y L + +   NFH V+  E+YRSAQ     I   + 
Sbjct: 2   KQVVRFGLRL-FGLLMLGVLALIAYLLVLYS-YNNFHTVIEGELYRSAQVTPEQIAQYQA 59

Query: 69  EYGIKSILNLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           ++GI SILNLRG  P + W+  E  A+  LGI  ++F +SA + L  +Q K LI++++  
Sbjct: 60  DHGIASILNLRGAAPGKPWYDAEMAASEKLGITHVDFRMSARKALTADQAKALIALMRDM 119

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLK---TITMDITF 184
           PKP+LIHC  GADRTGLASA+YL  +A   ++EA  Q+S+ YGHF V K      MD T+
Sbjct: 120 PKPILIHCLQGADRTGLASALYLASIAGRSEDEAAGQISIRYGHFSVPKLSEAYPMDETW 179

Query: 185 E 185
           +
Sbjct: 180 Q 180


>gi|254293374|ref|YP_003059397.1| protein tyrosine/serine phosphatase [Hirschia baltica ATCC 49814]
 gi|254041905|gb|ACT58700.1| protein tyrosine/serine phosphatase [Hirschia baltica ATCC 49814]
          Length = 231

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 50/162 (30%), Positives = 80/162 (49%), Gaps = 1/162 (0%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
            +      +    +N H +   E+YR  QP+   +    KE GIK+I+NLRG+ P+ ++ 
Sbjct: 24  LMWGDHGFLRLRFRNLHQI-SDEMYRGNQPSPKQVAAYAKELGIKTIINLRGESPKGYYV 82

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            E++A  +  I LI+F + +      ++I     +      P  +HCKSGADR G+ S +
Sbjct: 83  LEKEACEENRIDLIDFQMFSRDTPTPKKIHDAKYLFDNIAYPAFMHCKSGADRAGIMSVL 142

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           Y++     P  EA  QLS  Y H    KT  +D  F++   L
Sbjct: 143 YMHFRQGLPIAEAVEQLSFKYLHVKQGKTGMLDFFFQQYIDL 184


>gi|315122684|ref|YP_004063173.1| hypothetical protein CKC_04680 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496086|gb|ADR52685.1| hypothetical protein CKC_04680 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 207

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 109/205 (53%), Positives = 154/205 (75%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           M   KK ++N+ + +   LLG+ V+  + LGL+   +T++TQNFH +VP+E+YRSAQP G
Sbjct: 1   MNYTKKLKQNIFLSFKISLLGLFVIFPIVLGLFCFILTSYTQNFHVIVPNELYRSAQPTG 60

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
            FIE + +++GIKSILNLRG+  E W++EEE    +LGIQLINFP+ A++ELN+ +IK+L
Sbjct: 61  QFIETIWEKHGIKSILNLRGENNEPWYREEEMTIRNLGIQLINFPIPASKELNNAEIKKL 120

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           I IL+ APKPLLIHCK+GADRTGLASA+YLY ++HYPK +A  QLS+ YGH P+    +M
Sbjct: 121 IDILRKAPKPLLIHCKAGADRTGLASALYLYSISHYPKYKASGQLSIFYGHIPLFGARSM 180

Query: 181 DITFEKITQLYPNNVSKGDTEQPMN 205
           DITFEK T+ + N++   + +  +N
Sbjct: 181 DITFEKYTKEFSNDLYIENAKHFLN 205


>gi|114797931|ref|YP_760077.1| hypothetical protein HNE_1360 [Hyphomonas neptunium ATCC 15444]
 gi|114738105|gb|ABI76230.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 237

 Score =  157 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 59/205 (28%), Positives = 92/205 (44%), Gaps = 5/205 (2%)

Query: 1   MIKIK--KPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP 58
           M+KI   K R+  +   +    G               +     N H + P E++R+ QP
Sbjct: 1   MVKITPRKMRRPHVAADLATAEGRARAKRELYWGDHGFLRLRFSNLHQISP-EMWRANQP 59

Query: 59  NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118
           +   +    +E GIK+ILNLRG   + ++  E++A    GI LI+F + +      E++ 
Sbjct: 60  SPKQVLAHARERGIKTILNLRGPTTKGFYLLEKEACEAAGIDLIDFQMYSREPPTVEKVF 119

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTI 178
               + +    P L+HCKSGADR G+ + +Y  +    P EEA  QLS  Y H    KT 
Sbjct: 120 GARDLFERIRYPALMHCKSGADRAGIMAVLYKLLREKLPYEEAIEQLSGRYLHIRHGKTG 179

Query: 179 TMDITFEKITQLYPNNVSKGDTEQP 203
            +D  FE       N     +  +P
Sbjct: 180 VLDAFFETYAAF--NAGRPANEWKP 202


>gi|15888562|ref|NP_354243.1| hypothetical protein Atu8150 [Agrobacterium tumefaciens str. C58]
 gi|15156276|gb|AAK87028.1| hypothetical protein Atu8150 [Agrobacterium tumefaciens str. C58]
          Length = 195

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 75/182 (41%), Positives = 113/182 (62%), Gaps = 6/182 (3%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            F+   L G+     ++ G Y   I     NFH VV  + YRS QP+   +    +++GI
Sbjct: 3   RFWKCSLWGM-GFIVLAAGGYLYAIQLL-GNFHEVVAGQFYRSNQPSSEELVRYTEDHGI 60

Query: 73  KSILNLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPL 131
           K+++NLRG    ESW+++E + +  LG+  I+F +SA+REL+  Q+ QL++I++ APKP+
Sbjct: 61  KTVINLRGSNEAESWYRDEVETSKKLGLNHIDFGMSASRELDMNQVNQLVAIMRDAPKPI 120

Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL---KTITMDITFEKIT 188
           LIHCKSGADRTGLA+A+YL  +A   +EEA  QLS+ YGH  +        MD T+E   
Sbjct: 121 LIHCKSGADRTGLATALYLSRIARLGEEEAESQLSIRYGHVSIPYLSAAYAMDRTWENAE 180

Query: 189 QL 190
           ++
Sbjct: 181 KM 182


>gi|126735048|ref|ZP_01750794.1| protein tyrosine/serine phosphatase [Roseobacter sp. CCS2]
 gi|126715603|gb|EBA12468.1| protein tyrosine/serine phosphatase [Roseobacter sp. CCS2]
          Length = 267

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 49/159 (30%), Positives = 75/159 (47%), Gaps = 2/159 (1%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE 89
             L    + TF  NF  +    +YRS  P+           GIK++LNLRG   +  +  
Sbjct: 70  RWLDHGILRTFWHNFAQISDG-VYRSNHPDHKRFAAYAA-MGIKTVLNLRGVHRQPHYLF 127

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
           E ++   L ++L+   +SA      E++  +++   T  +P L+HCKSGADRTGL +A+Y
Sbjct: 128 EAESCERLSLKLVTIHMSARDAPRKEKLIDVMNAFDTMERPFLMHCKSGADRTGLVAALY 187

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           L         EA +QLS  Y H     T  +D   +   
Sbjct: 188 LMTKEGQSVAEARKQLSFRYLHIRRSSTGILDHFLDVYE 226


>gi|315500495|ref|YP_004089298.1| protein tyrosine/serine phosphatase [Asticcacaulis excentricus CB
           48]
 gi|315418507|gb|ADU15147.1| protein tyrosine/serine phosphatase [Asticcacaulis excentricus CB
           48]
          Length = 239

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 49/186 (26%), Positives = 87/186 (46%), Gaps = 2/186 (1%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGT 61
           +K+ K RK   +F      G+       L      +     N H +   ++ R+ QP   
Sbjct: 10  VKLFKKRKTPKVFDTSTQWGLFKTYLAFLWNDHAYLRLGFTNAHWI-DDKMVRTNQPWPF 68

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
            + + KK   I++++NLRG    ++   E  A   LG+ L++F +++    + E I +  
Sbjct: 69  QLAWFKKHDRIRTVINLRG-GQGAFFALERHACQTLGLNLVDFIVTSRDVPSAEAILEAE 127

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMD 181
            +  +   P L+HCKSGADR G+ S +Y ++   +P  EA ++L +   H    KT  +D
Sbjct: 128 KLFDSIQYPALMHCKSGADRAGIMSVLYRHLHLKHPLREAVQELGLRTLHMKAGKTGVLD 187

Query: 182 ITFEKI 187
             F+  
Sbjct: 188 YIFDCY 193


>gi|209963868|ref|YP_002296783.1| hypothetical protein RC1_0533 [Rhodospirillum centenum SW]
 gi|209957334|gb|ACI97970.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 237

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 51/157 (32%), Positives = 80/157 (50%), Gaps = 3/157 (1%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK-LPESWHKEEE 91
               +    +N   + P  +YRS+QP    I    K  GI++++NLRG+      +  EE
Sbjct: 39  DHAFLRMAYKNMFRISPG-MYRSSQPTPAHIAA-AKRMGIRTVINLRGRRDDCGSYFLEE 96

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
           +A  + GI L++FP+++        +     I      P+L+HCK+G+DR G  SA+Y+ 
Sbjct: 97  RACREHGITLVDFPVNSRDAPRKHILHAARDIWAGVEYPVLMHCKAGSDRVGFMSALYML 156

Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           +    P EEA RQL+  YGH    KT  +D  FE+  
Sbjct: 157 VHEKRPLEEAVRQLNWRYGHLRAAKTGILDQFFEEYA 193


>gi|167648492|ref|YP_001686155.1| protein tyrosine/serine phosphatase [Caulobacter sp. K31]
 gi|167350922|gb|ABZ73657.1| protein tyrosine/serine phosphatase [Caulobacter sp. K31]
          Length = 221

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 86/175 (49%), Gaps = 2/175 (1%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            +      G        L      +    +N H + P E+ R+ QP    +   KK+ G+
Sbjct: 3   SYDTTTRWGRFRTYLSYLWNDHAYLRLGFKNDHWISP-ELVRTNQPWPHQLAAWKKK-GV 60

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLL 132
           K+++NLRG    S++  E+ A   LG+++++F +++      E++     + ++   P L
Sbjct: 61  KTVINLRGGFDGSFYALEKHACQQLGLKMVDFVITSREVPIKERVLGARDLFESIEYPAL 120

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
           +HCKSGADR G+ S +Y +     P EEA  QLS+ Y H    KT  +D  FE+ 
Sbjct: 121 MHCKSGADRAGIMSVLYAHYRLGLPIEEAVEQLSLKYLHIKQGKTGVLDYVFERY 175


>gi|220935425|ref|YP_002514324.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996735|gb|ACL73337.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 244

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 57/179 (31%), Positives = 87/179 (48%), Gaps = 2/179 (1%)

Query: 23  LVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL 82
            +     L +    I     N H V P  +YRSAQP+   ++ +  + G+K+I+NLRG+ 
Sbjct: 37  FLGRFELLLVDHGFIRALYSNRHQVAPG-MYRSAQPSPAHVKQM-ADLGVKTIVNLRGEG 94

Query: 83  PESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRT 142
               +  E +A    GI+L+NF +S+ R    E +     + +    P L+HCKSGADR 
Sbjct: 95  DTGAYLLEAEACRRFGIELVNFSVSSKRAPPRETLLAAARMFQELNYPALMHCKSGADRA 154

Query: 143 GLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           GL SAVYL +      +EA  QL + YGH  + +T  +D  F +  +          T 
Sbjct: 155 GLMSAVYLAMHERRDADEAAAQLRLRYGHLRIGRTGVLDEIFRQYRRDAAETPMDFSTW 213


>gi|296536753|ref|ZP_06898809.1| protein tyrosine/serine phosphatase [Roseomonas cervicalis ATCC
           49957]
 gi|296262920|gb|EFH09489.1| protein tyrosine/serine phosphatase [Roseomonas cervicalis ATCC
           49957]
          Length = 222

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/177 (32%), Positives = 86/177 (48%), Gaps = 2/177 (1%)

Query: 27  AVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ES 85
             SL +    +    +N+  V P  +YRS  P+   +    +  G++SI+NLRG      
Sbjct: 16  LNSLFVDHAVLRLGWRNWGVVAPGRLYRSNHPSPWQLRRAARTLGLRSIINLRGHRESCG 75

Query: 86  WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLA 145
                   A +LG+  ++ PL +    + +++ +L  I +  P P+LIHCKSGADRTGLA
Sbjct: 76  SDALGRAMAAELGLSHVDAPLESRGAPHKDRLLRLAGIFRDLPGPVLIHCKSGADRTGLA 135

Query: 146 SAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
           + V+L +    P EEA RQLS  +GH    KT  +D  F         N  K   + 
Sbjct: 136 AGVWLLL-QGRPVEEAMRQLSWRHGHVSASKTGILDAFFRDYAAFQKANGPKPFLDW 191


>gi|222147302|ref|YP_002548259.1| tyrosine/serine protein phosphatase [Agrobacterium vitis S4]
 gi|221734292|gb|ACM35255.1| tyrosine/serine protein phosphatase [Agrobacterium vitis S4]
          Length = 191

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 72/185 (38%), Positives = 108/185 (58%), Gaps = 5/185 (2%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
             LL    +      +   +S G Y   +   T NFH V+P E YRSAQP+   I+    
Sbjct: 2   SILLAKATRYTALACLTGLLSCGAYLGYLR-LTGNFHEVIPGEFYRSAQPSAADIKDYAG 60

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
            YGIK+I+NLRG  P  W+ +E   A +LGI  I+F +SA + L  ++ +QL+++LK+AP
Sbjct: 61  RYGIKTIVNLRGPSPSPWYAQEVATARELGIGHIDFRMSAGKGLTIDKAEQLVALLKSAP 120

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVL---KTITMDITF 184
           KP+LIHC+ GADR+GLAS +YL  +A   ++ A +QL  ++YGH  +    K   MD ++
Sbjct: 121 KPILIHCEGGADRSGLASVLYLQQIAGVQEDTAEQQLWPVIYGHVGIPYVTKAYAMDRSW 180

Query: 185 EKITQ 189
               +
Sbjct: 181 LDFEK 185


>gi|15889438|ref|NP_355119.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str.
           C58]
 gi|15157300|gb|AAK87904.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str.
           C58]
          Length = 186

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 72/182 (39%), Positives = 112/182 (61%), Gaps = 4/182 (2%)

Query: 10  NLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKE 69
           ++L F     +G++ L    L    + I   T NFH V+P E+YRSAQP+G  I    K 
Sbjct: 3   SVLKFLKITAIGLVAL--PVLAGAHMGIGQLTGNFHEVIPGELYRSAQPSGKDIAAYAKA 60

Query: 70  YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK 129
           YGIK+I+NLR +  E W++ E  AA + GI+L+++PLS++ +++ E  + L ++L+ A K
Sbjct: 61  YGIKTIINLRDEKREGWYEAESLAAKNNGIRLVDYPLSSSEKVSVEDSETLAAVLRNAEK 120

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL--KTITMDITFEKI 187
           P+LIHC+ GA+RTGLASA+Y+ +VA   +  A  QLS  YGH P+       M  +++  
Sbjct: 121 PVLIHCEHGANRTGLASAIYVAVVAGKSEAAAEFQLSPYYGHVPIPGIGRYEMYQSWDDF 180

Query: 188 TQ 189
            +
Sbjct: 181 EE 182


>gi|325293519|ref|YP_004279383.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
 gi|325061372|gb|ADY65063.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
          Length = 186

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 71/183 (38%), Positives = 112/183 (61%), Gaps = 4/183 (2%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           + +L F     +G++ L    L    + I   T NFH V+P E+YRSAQP+G  I    K
Sbjct: 2   RIVLKFLKIAAIGLVAL--PVLAGAHMGIGQLTGNFHEVIPGELYRSAQPSGKDITAYAK 59

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
            YGIK+I+NLR +  E W+  E +AA   G++L+++PLS++ +++ E+ + L+++L+ A 
Sbjct: 60  AYGIKTIINLRDEKREGWYDAESQAAKKNGVRLVDYPLSSSEKVSVEEAETLVAVLRNAE 119

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL--KTITMDITFEK 186
           KP+LIHC+ GA+RTGLASA+Y+  VA   +  A  QLS  YGH P+       M  +++ 
Sbjct: 120 KPILIHCEHGANRTGLASAIYVSAVAGKSEAAAEFQLSPYYGHVPIPGIGRYEMYQSWDD 179

Query: 187 ITQ 189
             +
Sbjct: 180 FEE 182


>gi|312113878|ref|YP_004011474.1| protein tyrosine/serine phosphatase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219007|gb|ADP70375.1| protein tyrosine/serine phosphatase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 253

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 55/155 (35%), Positives = 86/155 (55%), Gaps = 2/155 (1%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                 +   N H + P  ++RSAQP+   I +L K  GIK+++NLRG+     ++ E +
Sbjct: 56  DHHFFRSIYSNRHQIAPG-VWRSAQPSPAHIAWLAKR-GIKTVVNLRGERDCGSYRLEAE 113

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           A    GI+LINF L +      + I+Q  ++      P+L HCKSGADR G+ SA+ +Y+
Sbjct: 114 ACERHGIRLINFQLQSRMVPRVDVIRQARALFDEIEYPVLFHCKSGADRAGMMSALLMYM 173

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
               P E+A +QLS+ +GH    +T  +D  FE+ 
Sbjct: 174 KEGQPIEQAAKQLSLKFGHIRSSETGVLDYLFERY 208


>gi|325292592|ref|YP_004278456.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
 gi|325060445|gb|ADY64136.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3]
          Length = 180

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 72/167 (43%), Positives = 111/167 (66%), Gaps = 5/167 (2%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESW 86
           ++ G Y L I     NFH VV  ++YRS QP+   +    +++GIK+++NLRG+   E W
Sbjct: 2   LAAGGYLLAIQLL-GNFHEVVAGQLYRSNQPSSEQLVRYTRDHGIKTVINLRGENESEDW 60

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           +K+E K + +LG+  I+F +SA  EL+  ++ QL++I++ APKP+LIHCKSGADRTGLA+
Sbjct: 61  YKDEIKTSRELGLTHIDFGMSARHELDMTKVNQLVAIMRDAPKPILIHCKSGADRTGLAT 120

Query: 147 AVYLYIVAHYPKEEAHRQLSMLYGHFPVL---KTITMDITFEKITQL 190
           A+YL  VA+  ++ A  QLS+ YGH  +    +T  MD T+E +  +
Sbjct: 121 ALYLGRVAYLGEKAAESQLSVRYGHIGIPYLSETYAMDQTWENVEHM 167


>gi|83859487|ref|ZP_00953008.1| hypothetical protein OA2633_13820 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852934|gb|EAP90787.1| hypothetical protein OA2633_13820 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 220

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/162 (30%), Positives = 80/162 (49%), Gaps = 3/162 (1%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWH 87
            +      +     N H V   E++R  QP+   +    K+ G K+ILNLRG  P   ++
Sbjct: 18  LMWGDHGVLRQRFHNMHRVG-GEMWRGNQPSPKRLRE-LKDMGFKTILNLRGTQPGRHYY 75

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
             E    +++G+ +++ P  +      E+I+ LI++      P  +HCKSGADR G+ + 
Sbjct: 76  DLEHFTCDEIGLDIVDLPWGSREAPYVERIEHLITVFDEIAYPAFMHCKSGADRAGIVAV 135

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           +Y  +    P EEA +QLS  YGH    KT  +D  F+   Q
Sbjct: 136 MYKLLHEKAPFEEAVQQLSFKYGHIKQGKTGMLDHFFDLYRQ 177


>gi|119898606|ref|YP_933819.1| putative tyrosine/serine phosphatase [Azoarcus sp. BH72]
 gi|119671019|emb|CAL94932.1| conserved hypothetical tyrosine/serine phosphatase [Azoarcus sp.
           BH72]
          Length = 234

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 58/172 (33%), Positives = 84/172 (48%), Gaps = 5/172 (2%)

Query: 16  IKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSI 75
            + L   L +  V  G     I     NFHA+    +YR +QP+   I      +GI+SI
Sbjct: 23  TRRLRAWLDMHLVDHGA----IRAVYNNFHALG-GGMYRCSQPSPAQIRRYHARHGIRSI 77

Query: 76  LNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           +NLRG      +  EE+A   LGI L +  L +    + E+I ++  +      P L+HC
Sbjct: 78  INLRGVHDYGSYFFEEEACARLGIALHSVKLYSRVPPSVEEIHRMRDLFAGLQYPALLHC 137

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
           KSGADR GL +A+Y  +   +P  EA R+LS  YGH    +T  +D  F   
Sbjct: 138 KSGADRAGLGAALYRILQLGHPVREAMRELSWKYGHSKRARTGILDFFFASY 189


>gi|294084698|ref|YP_003551456.1| hypothetical protein SAR116_1129 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664271|gb|ADE39372.1| conserved hypothetical tyrosine/serine phosphatase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 219

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 51/159 (32%), Positives = 79/159 (49%), Gaps = 2/159 (1%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
            +      +  F  N H + P  ++R+ QP    +  +    GIK+I+NLRG   +   +
Sbjct: 19  LILKDHGFLRLFWHNRHEIAPG-MWRANQPGPVEVSRIAAS-GIKTIINLRGPRDDGVWQ 76

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            E +A    GI L++F   +    +   +    +I K   KP L+HCKSGADR GL SA+
Sbjct: 77  LEAEACAKAGITLLDFTARSRAAPDKAMLHDAKAIFKAIEKPALMHCKSGADRAGLMSAL 136

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
           Y+ +    P  EA +QL+  YGH    KT  +D+ F+  
Sbjct: 137 YMLVAEERPAREAAKQLAWKYGHVKQAKTGLLDVFFKAY 175


>gi|197103982|ref|YP_002129359.1| hypothetical protein PHZ_c0516 [Phenylobacterium zucineum HLK1]
 gi|196477402|gb|ACG76930.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 227

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/161 (29%), Positives = 80/161 (49%), Gaps = 2/161 (1%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
            L      +     N H +   E+ R+ QP    +   K   GIK+I+NLRG    S+H 
Sbjct: 25  YLWNDHAYLRLGFSNAHWISE-ELVRANQPWPHQLAAWKAR-GIKTIINLRGGFDASFHA 82

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            E+ A   LG+ +++F +++    + +++     + +T   P ++HCKSGADR G+ S +
Sbjct: 83  LEKDACQRLGLTMVDFTITSREVPSVQRVLGAKRLFETIEYPAMMHCKSGADRAGIMSVL 142

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           Y++        EA  QL + Y H    KT  +D TFE+  +
Sbjct: 143 YMHFRKGKTIREAMDQLHLRYLHVKQGKTGVLDYTFERYLE 183


>gi|258541139|ref|YP_003186572.1| hypothetical protein APA01_00350 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632217|dbj|BAH98192.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635274|dbj|BAI01243.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638329|dbj|BAI04291.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641383|dbj|BAI07338.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644438|dbj|BAI10386.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647493|dbj|BAI13434.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256650546|dbj|BAI16480.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653537|dbj|BAI19464.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 220

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/159 (28%), Positives = 78/159 (49%), Gaps = 1/159 (0%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           SL +          NFHAV+P ++YR   P    ++   +  G+++++NLRG        
Sbjct: 19  SLFVDHAIFRLMWTNFHAVIPGKVYRCNHPTPARLKRAMERLGLRTLVNLRGHRKCGSDA 78

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
               AA  LG+  ++    +    + ++I +   + +    P+L+HCKSGADR GLAS +
Sbjct: 79  LSRNAARGLGLHHVDMAFESRGAPHKDRILRFADMYQKLDFPMLMHCKSGADRAGLASGL 138

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            + +      ++A ++LS  YGHF   +T  +D  F   
Sbjct: 139 -VVLFEGGSAQQALKELSWKYGHFRSSRTGILDAFFLHY 176


>gi|329114750|ref|ZP_08243507.1| Protein Tyrosine/Serine Phosphatase [Acetobacter pomorum DM001]
 gi|326695881|gb|EGE47565.1| Protein Tyrosine/Serine Phosphatase [Acetobacter pomorum DM001]
          Length = 226

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 77/159 (48%), Gaps = 1/159 (0%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           SL +          NFHAV+P ++YR   P    ++      G+++++NLRG        
Sbjct: 25  SLFVDHAIFRLMWTNFHAVIPGKVYRCNHPTPARLKRAMGRLGLRTLVNLRGHRKCGSDA 84

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
               AA  LG+  I+    +    + ++I +   + +    P+L+HCKSGADR GLAS +
Sbjct: 85  LSRNAARGLGLHHIDMAFESRGAPHKDRILRFADMYQKLDFPILMHCKSGADRAGLASGL 144

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            + +      ++A ++LS  YGHF   +T  +D  F   
Sbjct: 145 -VVLFEGGSAQQALKELSWKYGHFRSSRTGILDAFFLHY 182


>gi|149915807|ref|ZP_01904332.1| protein tyrosine/serine phosphatase [Roseobacter sp. AzwK-3b]
 gi|149810389|gb|EDM70234.1| protein tyrosine/serine phosphatase [Roseobacter sp. AzwK-3b]
          Length = 233

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 84/165 (50%), Gaps = 2/165 (1%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH 87
            +L      +     NF+ V P  +YRS QP         K+ GIK+ILNLRG    + +
Sbjct: 40  YNLWFDHAVLRKVWTNFYQVAPD-VYRSNQPTHERFVK-LKKKGIKTILNLRGAGGTAHY 97

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
             EE++   LG+ L+N  L A +     +IK LI   +   KP ++HCKSGADR G A+A
Sbjct: 98  LVEEESCRTLGLTLVNVNLMARQAAPGTEIKALIRAFREIEKPFVMHCKSGADRAGFAAA 157

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
           +YL ++   P  EA R L + Y H    KT  +D   ++  Q + 
Sbjct: 158 IYLLVIEGRPVSEARRMLGVKYIHLKWSKTGVLDHILDRYEQSHK 202


>gi|170740880|ref|YP_001769535.1| protein tyrosine/serine phosphatase [Methylobacterium sp. 4-46]
 gi|168195154|gb|ACA17101.1| protein tyrosine/serine phosphatase [Methylobacterium sp. 4-46]
          Length = 241

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 83/180 (46%), Gaps = 12/180 (6%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           R++ L  ++ +LL           +    +     N H V    ++RSAQP         
Sbjct: 29  RRSRLRAWVNMLL-----------VDHGVLRLAYLNRHRVGRGLVWRSAQPAPHDF-SWF 76

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K +G+++I++LRG       + + +A    G+ L  F + +    N E +        + 
Sbjct: 77  KRHGVRTIVSLRGGREHGSWQLQREACEREGLVLREFVVRSREAPNREMLLGARDFFASV 136

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
             P L+HCKSGADR G A+A+YL +    P  EA RQLS  +GHF   KT  +D  FE  
Sbjct: 137 EYPALLHCKSGADRAGFAAALYLILHEGRPVAEAARQLSPRFGHFRFAKTGILDAFFESY 196


>gi|16124561|ref|NP_419125.1| hypothetical protein CC_0306 [Caulobacter crescentus CB15]
 gi|221233247|ref|YP_002515683.1| hypothetical protein CCNA_00308 [Caulobacter crescentus NA1000]
 gi|13421449|gb|AAK22293.1| hypothetical protein CC_0306 [Caulobacter crescentus CB15]
 gi|220962419|gb|ACL93775.1| hypothetical protein CCNA_00308 [Caulobacter crescentus NA1000]
          Length = 221

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 51/177 (28%), Positives = 81/177 (45%), Gaps = 2/177 (1%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            F +    G        L      +     N H + P E+ R+ QP    + + KK  GI
Sbjct: 3   KFDLTTPWGRFKTYLHYLWNDHAYLRLGFSNAHWISP-ELVRANQPWPFQLAWWKKR-GI 60

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLL 132
           K+I+NLRG    S++  E+ A   LG+  ++F +++      E+++    + +    P L
Sbjct: 61  KTIVNLRGGFDGSFYALEKDACERLGLNFVDFVITSREVPIRERVRGAKELFERIEYPAL 120

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           +HCKSGADR G+ S  Y +     P  EA +QL   Y H     T  +D  FE+  +
Sbjct: 121 MHCKSGADRAGIMSVFYAHYRLGQPIREAMQQLGPRYLHIKHGNTGVLDYVFEQYLE 177


>gi|89057701|ref|YP_512155.1| protein tyrosine/serine phosphatase [Jannaschia sp. CCS1]
 gi|88866255|gb|ABD57131.1| protein tyrosine/serine phosphatase [Jannaschia sp. CCS1]
          Length = 244

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 52/163 (31%), Positives = 75/163 (46%), Gaps = 2/163 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            +    +     NF  + P  ++RS  P     +   +  GIK+IL LRG      H  E
Sbjct: 44  WIDHEILRYPWTNFDEIAPG-VFRSNHPTRARFKAYAER-GIKTILTLRGGEDRPHHLLE 101

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            +A  D G+     P+SA       Q+  +  +L    +P LIHCKSGADRTGL SA+YL
Sbjct: 102 VEACRDFGLTFECVPMSARHAPTVAQLSAVFEVLDRIERPFLIHCKSGADRTGLVSAIYL 161

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPN 193
               + P ++A  QLS  Y H    +T  +D+  E     +  
Sbjct: 162 MHYENIPFDQARVQLSFRYIHIRRSQTGILDVFLEAFAARHAE 204


>gi|295691195|ref|YP_003594888.1| protein tyrosine/serine phosphatase [Caulobacter segnis ATCC 21756]
 gi|295433098|gb|ADG12270.1| protein tyrosine/serine phosphatase [Caulobacter segnis ATCC 21756]
          Length = 221

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 51/177 (28%), Positives = 82/177 (46%), Gaps = 2/177 (1%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            F +    G        L      +     N H + P  + R+ QP    + + KK+ GI
Sbjct: 3   KFDLTTPWGRFRTYLHYLWNDHAYLRLGFSNAHWISPEMV-RANQPWPFQLAWWKKQ-GI 60

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLL 132
           K+I+NLRG    S++  E+ A   LG+  ++F +++      E+++    + +T   P L
Sbjct: 61  KTIVNLRGGFDGSFYALEKDACQRLGLNFVDFTITSREVPIRERVRGAKELFETIEYPAL 120

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           +HCKSGADR G+ S  Y +     P  EA +QL   Y H     T  +D  FE+  +
Sbjct: 121 MHCKSGADRAGIMSVFYAHYRLGQPIREAMKQLGPRYLHIKHGNTGVLDYVFEQYLE 177


>gi|288961764|ref|YP_003452074.1| protein tyrosine/serine phosphatase [Azospirillum sp. B510]
 gi|288914044|dbj|BAI75530.1| protein tyrosine/serine phosphatase [Azospirillum sp. B510]
          Length = 215

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 53/161 (32%), Positives = 78/161 (48%), Gaps = 2/161 (1%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                     N H V  + + R++QP+ + I       G+K+ILNLRG    + +  E +
Sbjct: 18  DHACFRLVYSNTHRVSANMV-RASQPSPSHIAA-AARSGVKTILNLRGSRDCASYILEAE 75

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           A    G+QLI+FP+++      E + +   + K    P L+HCKSGADR G  + +YL+ 
Sbjct: 76  ACRAHGLQLIDFPVNSRDMPRKETLLKARELFKGMNYPALMHCKSGADRAGFMATLYLFA 135

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPN 193
               P E A +QLS  YGHF   KT  +D  FE        
Sbjct: 136 HEGQPLERAMKQLSWKYGHFKQAKTGILDYFFELYAAYNQK 176


>gi|206890973|ref|YP_002248592.1| hypothetical protein THEYE_A0750 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206742911|gb|ACI21968.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 190

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 75/151 (49%), Positives = 105/151 (69%), Gaps = 1/151 (0%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLG 98
              NFH + P E YRSAQ +   +EY  K+Y IKSILNLRGK P  +W+ EE + +++L 
Sbjct: 28  EQGNFHIITPGEAYRSAQLDRDELEYYIKKYNIKSILNLRGKNPNAAWYIEELQVSSELN 87

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           ++  +  LSATREL DE++++LI I K+AP+P+LIHCKSGADR+GL +A++  +V   PK
Sbjct: 88  VKHYDIALSATRELTDEEVRKLIEIFKSAPRPVLIHCKSGADRSGLVAAMWKVVVDGEPK 147

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
            EA +QLS+LYGH    KT  MD  F++  +
Sbjct: 148 SEARKQLSLLYGHLSTGKTKAMDQFFDEFFE 178


>gi|220922853|ref|YP_002498155.1| protein tyrosine/serine phosphatase [Methylobacterium nodulans ORS
           2060]
 gi|219947460|gb|ACL57852.1| protein tyrosine/serine phosphatase [Methylobacterium nodulans ORS
           2060]
          Length = 241

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 82/180 (45%), Gaps = 12/180 (6%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           R+N L  ++ +LL           +    +     N H +    ++RSAQP    +    
Sbjct: 29  RRNRLRAWVNMLL-----------VDHGVLRLAYLNRHRIGRGLLWRSAQPAPHDLA-WF 76

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K  G+++I++LRG       + + +A    G+ L  F + +    +   +          
Sbjct: 77  KRQGLRTIISLRGGREHGSWQLQREACEREGLLLREFVVRSREAPDRAMLLSARDFFAGV 136

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
             P LIHCKSGADR G A+A+YL +    P  EA RQLS  YGHF   KT  +D  F++ 
Sbjct: 137 EYPALIHCKSGADRAGFAAALYLILHEGRPVAEAARQLSPRYGHFRFAKTGILDAFFDRY 196


>gi|153007388|ref|YP_001368603.1| protein tyrosine/serine phosphatase [Ochrobactrum anthropi ATCC
           49188]
 gi|151559276|gb|ABS12774.1| protein tyrosine/serine phosphatase [Ochrobactrum anthropi ATCC
           49188]
          Length = 197

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 79/172 (45%), Positives = 111/172 (64%), Gaps = 5/172 (2%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           LG+LV  +V +G Y  T+  +  N H ++  + YRS QP+   I  L+K YGIK+I+NLR
Sbjct: 20  LGLLVGSSV-MGGYLYTLQ-YKGNVHTIIDGQAYRSNQPDPARIASLQKLYGIKTIINLR 77

Query: 80  GKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
           G  P   W+ EE   A  LGI+  +F +S+ REL+  Q +QLI++++ A KP+LIHCKSG
Sbjct: 78  GPEPGSKWYDEEIATAKTLGIKHADFEMSSRRELSPAQTRQLIALMQNAEKPVLIHCKSG 137

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL--KTITMDITFEKIT 188
           ADRTGLA+A+Y+  VA   + +A RQ+S+ YGHF      T  M+ TFE I 
Sbjct: 138 ADRTGLAAALYVAAVAKGSEGKAERQMSIAYGHFGFPLSPTYAMEKTFEAIE 189


>gi|254420876|ref|ZP_05034600.1| hypothetical protein BBAL3_3186 [Brevundimonas sp. BAL3]
 gi|196187053|gb|EDX82029.1| hypothetical protein BBAL3_3186 [Brevundimonas sp. BAL3]
          Length = 221

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/185 (29%), Positives = 89/185 (48%), Gaps = 3/185 (1%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            F +   +G               +     N H + P  + R+ QP+   + Y KK+ G+
Sbjct: 3   RFDLSTAMGRFRAHWHYFWADHAFLRLAFSNAHWLGPDLV-RTNQPSPRQLAYWKKK-GV 60

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLL 132
           K+++NLRG+  E ++  E++A   LG+ LI+ PL +      ++I +   +  T   P+L
Sbjct: 61  KTVINLRGQRDEGYYWLEKEACERLGLTLIDAPLDSRDPPETDRIHRARRLFTTIEYPVL 120

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLY 191
           IHCKSGADR G+ +  Y +     P   A  +LS  Y H     T  +D T EK  +++ 
Sbjct: 121 IHCKSGADRAGMMAVFYRHFHLGEPISVAMAELSKKYLHSREGLTGVLDYTLEKYVSEIE 180

Query: 192 PNNVS 196
           P  +S
Sbjct: 181 PRGIS 185


>gi|302382966|ref|YP_003818789.1| protein tyrosine/serine phosphatase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193594|gb|ADL01166.1| protein tyrosine/serine phosphatase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 221

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 76/157 (48%), Gaps = 2/157 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
                 +     N H + P  + R+ QP+   +E   +  GI++++NLRG+  E ++  E
Sbjct: 21  WNDHAFLRLAFSNAHWIGPDLV-RTNQPSPRQLEGWARR-GIRTVINLRGERDEGYYWLE 78

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           + A   LG+ LI+ PL +    + +++++   +  +   P LIHCKSGADR GL +  Y 
Sbjct: 79  KAACERLGLTLIDAPLDSRDPPSKDRVRRARDLFASIEYPALIHCKSGADRAGLMAVFYR 138

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
           +     P   A ++LS  Y H     T  +D   E  
Sbjct: 139 HFHLGEPISVARQELSKRYLHSREGLTGVLDHFVETY 175


>gi|254440390|ref|ZP_05053884.1| hypothetical protein OA307_5260 [Octadecabacter antarcticus 307]
 gi|198255836|gb|EDY80150.1| hypothetical protein OA307_5260 [Octadecabacter antarcticus 307]
          Length = 235

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/169 (29%), Positives = 78/169 (46%), Gaps = 2/169 (1%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE 89
                  +  F  N   + P  ++RS  P       L    GI +I++LRG     W   
Sbjct: 50  RWFDHGFLRKFWTNMFEIAPG-VWRSNHPTAKRFPALTAR-GIHTIISLRGSTTTPWALL 107

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
           E++A    GI+L    L +    N   ++ LI + ++  KP+L HCKSGADRTGLAS +Y
Sbjct: 108 EKEACTRHGIRLETVALKSQSAPNRRDLQALIGLFRSVEKPVLFHCKSGADRTGLASVMY 167

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
           L ++ + P E+A + LS  Y H    K   +D+  +       ++    
Sbjct: 168 LLVIENQPLEQARKMLSWRYAHLSWTKAGVLDMLLDDFATSARHDFEDW 216


>gi|209544250|ref|YP_002276479.1| protein tyrosine/serine phosphatase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531927|gb|ACI51864.1| protein tyrosine/serine phosphatase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 220

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 78/157 (49%), Gaps = 1/157 (0%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                     NF AV+P ++YR   P    +    + YG+++++NLRG           +
Sbjct: 23  DHAVFRLPWTNFAAVIPGKVYRCNHPTPRRLAAATRRYGLRTLVNLRGHRRCGSDALSRE 82

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           AA+ +G+  ++    +    + ++I +  ++  T   P+L+HCKSGADR GLAS + + +
Sbjct: 83  AASRIGLTHLDMAFESRGAPHRDRILRFAAMYATLDFPMLMHCKSGADRAGLASGL-VIL 141

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
                 E+A RQLS  +GHF   +T  +D  F +   
Sbjct: 142 FEGGTAEQALRQLSWRFGHFNRSRTGILDAFFLRYRH 178


>gi|162147197|ref|YP_001601658.1| hypothetical protein GDI_1402 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785774|emb|CAP55345.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 239

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 78/157 (49%), Gaps = 1/157 (0%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                     NF AV+P ++YR   P    +    + YG+++++NLRG           +
Sbjct: 42  DHAVFRLPWTNFAAVIPGKVYRCNHPTPRRLAAATRRYGLRTLVNLRGHRRCGSDALSRE 101

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           AA+ +G+  ++    +    + ++I +  ++  T   P+L+HCKSGADR GLAS + + +
Sbjct: 102 AASRIGLTHLDMAFESRGAPHRDRILRFAAMYATLDFPMLMHCKSGADRAGLASGL-VIL 160

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
                 E+A RQLS  +GHF   +T  +D  F +   
Sbjct: 161 FEGGTAEQALRQLSWRFGHFNRSRTGILDAFFLRYRH 197


>gi|296114433|ref|ZP_06833087.1| protein tyrosine/serine phosphatase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295979194|gb|EFG85918.1| protein tyrosine/serine phosphatase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 220

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 80/159 (50%), Gaps = 1/159 (0%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           SL +    +     NF  V+P  +YR   P    +    +   +K+++NLRG        
Sbjct: 19  SLFVDHAVLRMTWTNFRTVIPGRVYRCNHPTPWRLAMATRRLHLKTLVNLRGHRQCGSDA 78

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
              +AA+ LG++ I+    +    + ++I++   I +T   P+L+HCKSGADRTGLA+ +
Sbjct: 79  LSREAAHRLGLKHIDMAFESRNAPHRDRIERFEKIYRTLTFPMLMHCKSGADRTGLAAGL 138

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            L +      ++A RQLS   GHF   +T  +D  F + 
Sbjct: 139 VL-LFEGGTADDALRQLSWKNGHFNRSRTGVLDAFFLRY 176


>gi|254561265|ref|YP_003068360.1| hypothetical protein METDI2844 [Methylobacterium extorquens DM4]
 gi|254268543|emb|CAX24500.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 241

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 48/160 (30%), Positives = 73/160 (45%), Gaps = 1/160 (0%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE 89
           L +          N H +    ++RSAQP    +    K  G+++I++LRG         
Sbjct: 40  LLVDHGIFRLAYLNRHRIGTGLVWRSAQPTPHQLA-WFKRQGVRTIVSLRGGREHGSWPL 98

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
           + +A    G+ L+ F L +    + E +            P ++HCKSGADR GLA+ ++
Sbjct: 99  QREACERQGLNLVEFVLRSREAPSRETLLAARDFFDGLEYPAVMHCKSGADRAGLAATLF 158

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           L +    P  EA RQLS  YGHF   KT  +D  F    +
Sbjct: 159 LILHEGRPVREALRQLSPRYGHFRFAKTGILDAFFATYLR 198


>gi|260424450|ref|YP_003212651.1| hypothetical protein Ctu_1p00750 [Cronobacter turicensis z3032]
 gi|260219258|emb|CBA34612.1| hypothetical protein Ctu_1p00750 [Cronobacter turicensis z3032]
          Length = 483

 Score =  144 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 73/194 (37%), Positives = 115/194 (59%), Gaps = 4/194 (2%)

Query: 3   KIKKPRKNLLIFYIKI--LLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           +  K RK  +  + +    LG+LV   ++L          T NFH V+  E+YRSAQP+ 
Sbjct: 289 RTPKRRKGWVGAFRRTGKRLGLLVAAVLALTGLHAGYEQLTGNFHEVIEGELYRSAQPDA 348

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
           T I    + Y I++ILNLR +    W+++E+ +A+  GIQL+++PLS+++E++  + ++L
Sbjct: 349 TDIAEYSERYHIRTILNLRDEPRGDWYEQEKASADVHGIQLVDYPLSSSKEISVREAEKL 408

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL--KTI 178
             ++KT P+PLLIHC  GA+RTGL SA+YL  VA      A  QLS  YGHFP+      
Sbjct: 409 AELMKTLPRPLLIHCDHGANRTGLVSAIYLDAVAQTSDLIAQLQLSPWYGHFPIPVMGRY 468

Query: 179 TMDITFEKITQLYP 192
            M  ++++   + P
Sbjct: 469 AMYSSYKRFQIMSP 482


>gi|114569186|ref|YP_755866.1| hypothetical protein Mmar10_0635 [Maricaulis maris MCS10]
 gi|114339648|gb|ABI64928.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 241

 Score =  144 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 49/163 (30%), Positives = 80/163 (49%), Gaps = 3/163 (1%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWH 87
            L      +     N H V    ++R+ QP+   +E L  + G K+ILN+RG  P   ++
Sbjct: 39  YLWKDHGILRQKFHNMHEVG-GGMWRANQPSPERLEQLAAD-GFKTILNIRGTQPGVCYY 96

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
             E++A    G+ +I+ P  +      +++++ + I ++   P LIHCKSGADR G+ S 
Sbjct: 97  DLEKEACEKHGLTMIDMPFGSREAPYVDRMQRAVKIFESIEYPALIHCKSGADRAGIISV 156

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           +Y       P +EA + LS+ Y H    KT  +D  FE     
Sbjct: 157 LYALTKLKLPYDEAIKHLSLKYLHVKAGKTGVLDYFFECYRAY 199


>gi|330991160|ref|ZP_08315113.1| hypothetical protein SXCC_01067 [Gluconacetobacter sp. SXCC-1]
 gi|329761746|gb|EGG78237.1| hypothetical protein SXCC_01067 [Gluconacetobacter sp. SXCC-1]
          Length = 220

 Score =  144 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 49/159 (30%), Positives = 79/159 (49%), Gaps = 1/159 (0%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           SL +    +     NF  V+P  +YR   P    +    + YG+K+++NLRG        
Sbjct: 19  SLFVDHAILRQTWTNFRVVIPGRVYRCNHPTPWRLRLATRRYGLKTLVNLRGHRRCGSDA 78

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
              +AA  LG+  I+    +    + ++I++   I +T   P+L+HCKSGADRTGLA+ +
Sbjct: 79  LSREAAQALGLTHIDMAFESRNAPHRDRIERFERIYRTIRFPMLMHCKSGADRTGLAAGL 138

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            + +       +A RQLS   GHF   +T  +D  F + 
Sbjct: 139 -VILFEGGTARQALRQLSWKNGHFNSSRTGVLDAFFLRY 176


>gi|84515251|ref|ZP_01002613.1| hypothetical protein SKA53_01296 [Loktanella vestfoldensis SKA53]
 gi|84510534|gb|EAQ06989.1| hypothetical protein SKA53_01296 [Loktanella vestfoldensis SKA53]
          Length = 235

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/158 (34%), Positives = 80/158 (50%), Gaps = 2/158 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            L    +     NF  V P  +YRS  PN +       + GIK++LNLRG   +  H  E
Sbjct: 39  WLDHGILRRRWHNFDLVAPG-VYRSNHPNHSRFAAY-AQMGIKTVLNLRGAALQPHHLFE 96

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            ++   LG+ L+N  ++A R  + +++  L+    T  +P L+HCKSGADRTGLA+A+YL
Sbjct: 97  VESCATLGLTLVNVQMAARRAPDRDELLALLDAFATMERPFLMHCKSGADRTGLAAAIYL 156

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
                 P  +A RQLS  Y H     T  +D   +   
Sbjct: 157 LHYQDAPIAQAKRQLSFRYVHIRRTSTGILDHFLDVYA 194


>gi|84500026|ref|ZP_00998292.1| hypothetical protein OB2597_08799 [Oceanicola batsensis HTCC2597]
 gi|84391960|gb|EAQ04228.1| hypothetical protein OB2597_08799 [Oceanicola batsensis HTCC2597]
          Length = 226

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/162 (32%), Positives = 78/162 (48%), Gaps = 2/162 (1%)

Query: 27  AVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW 86
             +L      + T   NF  + P  +YRS  P    +  +K   GI ++LNLRG    + 
Sbjct: 33  TYNLYFDHAVLRTVWGNFFQISPD-VYRSNHPTHARLARMKAR-GITTVLNLRGTESGAP 90

Query: 87  HKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           +  E  +  +LG+ +++  L A      E I  LI   +   KP ++HCKSGADR G AS
Sbjct: 91  YLTERVSCGELGLTMVDCNLIARAAAPKEDILNLIDCFRRIEKPFVMHCKSGADRAGFAS 150

Query: 147 AVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           A+YL ++   P E A R LS  Y HF   +T  +D   +   
Sbjct: 151 AIYLMVIEGEPVERARRMLSPRYIHFRWTRTGILDHILDHYA 192


>gi|223648028|gb|ACN10772.1| Dual specificity protein phosphatase CDC14A [Salmo salar]
          Length = 542

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 64/193 (33%), Gaps = 20/193 (10%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG- 60
           +        L   Y  +  G L      +  Y         +F+ ++P +    + P+  
Sbjct: 156 MYNLNILDCLCAIYKALQFGWLDFSHFDVEEYEHYERAENGDFNWIIPGKFLAFSGPHPK 215

Query: 61  ------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
                              +++ I +I+ L  K+       + K   D+G +  +     
Sbjct: 216 SKMENGYPLHAPEAYFPYFRKHNITTIVRLNKKM------YDAKRFTDMGFEHHDLFFVD 269

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM- 167
               ND  +++ ++I + A   + +HCK+G  RTG     Y+         EA   + + 
Sbjct: 270 GSTPNDSIVRKFLNICENANGAIAVHCKAGLGRTGTLIGCYMMKHYRLTAAEAIAWMRIC 329

Query: 168 LYGHFPVLKTITM 180
             G     +   +
Sbjct: 330 RPGSVIGPQQNFV 342


>gi|83950364|ref|ZP_00959097.1| hypothetical protein ISM_04680 [Roseovarius nubinhibens ISM]
 gi|83838263|gb|EAP77559.1| hypothetical protein ISM_04680 [Roseovarius nubinhibens ISM]
          Length = 227

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 54/161 (33%), Positives = 76/161 (47%), Gaps = 2/161 (1%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH 87
            +L      + T   NF  V P  ++RS  P     E   K  G +S+LNLRG    + +
Sbjct: 34  YNLWFDHAILRTVWTNFFEVAPG-VWRSNHPTHRRFEK-LKAMGFRSVLNLRGSGGAAHY 91

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
             E ++   LG+ L+N  L A      E I  L+   +   KP ++HCKSGADR G ASA
Sbjct: 92  LTEVESCEKLGLTLVNVTLHARYAAPREDILTLLEAFRQIEKPFVMHCKSGADRAGFASA 151

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           ++L ++   P  EA R LS  Y H    KT  +D   +   
Sbjct: 152 IWLLVMEGRPVSEARRMLSFKYVHIRRSKTGVLDHILDVYE 192


>gi|170750050|ref|YP_001756310.1| protein tyrosine/serine phosphatase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656572|gb|ACB25627.1| protein tyrosine/serine phosphatase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 241

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 78/166 (46%), Gaps = 1/166 (0%)

Query: 23  LVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL 82
           L+  A  L +          N H V    ++RSAQP    +   + E G+++I++LRG  
Sbjct: 33  LMAWANMLLMDHGVFRLAYLNRHRVGSGALWRSAQPGPHQLARFRAE-GVRTIISLRGGR 91

Query: 83  PESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRT 142
                  + +A    G++L+ F L +    +   I    +       P ++HCKSGADR 
Sbjct: 92  EHGSWPLQREACERHGLKLVEFVLRSREAPDRATILGAKAFFAGIEYPAVMHCKSGADRA 151

Query: 143 GLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           GLASA+YL +    P  EA RQLS  YGH    KT  +D  F +  
Sbjct: 152 GLASALYLILHEGRPVAEAARQLSARYGHLRFAKTGILDAFFARYR 197


>gi|188581291|ref|YP_001924736.1| protein tyrosine/serine phosphatase [Methylobacterium populi BJ001]
 gi|179344789|gb|ACB80201.1| protein tyrosine/serine phosphatase [Methylobacterium populi BJ001]
          Length = 241

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/160 (30%), Positives = 73/160 (45%), Gaps = 1/160 (0%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE 89
           L +          N H +    ++RSAQP    +    K  G+++I++LRG         
Sbjct: 40  LLVDHGIFRLAYLNRHRIGTGLVWRSAQPTPHQLA-WFKRQGVRTIVSLRGGREHGSWPL 98

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
           + +A    G+ L+ F L +    + E +            P ++HCKSGADR GLA+ ++
Sbjct: 99  QREACERQGLTLVEFVLRSREAPSRETLLAARDFFAGLEYPAVMHCKSGADRAGLAATLF 158

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           L +    P  EA RQLS  YGHF   KT  +D  F    +
Sbjct: 159 LILHEGRPVREALRQLSPRYGHFRFAKTGILDAFFATYLR 198


>gi|149176972|ref|ZP_01855581.1| hypothetical protein PM8797T_07122 [Planctomyces maris DSM 8797]
 gi|148844227|gb|EDL58581.1| hypothetical protein PM8797T_07122 [Planctomyces maris DSM 8797]
          Length = 225

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 52/190 (27%), Positives = 84/190 (44%), Gaps = 6/190 (3%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIE 64
           K PR++ L F I +++  L+   V +    L      + F  V   +IYRS Q +   IE
Sbjct: 16  KSPRRHKL-FKISLIVCALIGTGVLIWEEVLEDRIVAKRFGVVEQGKIYRSGQISSYLIE 74

Query: 65  YLKKEYGIKSILNLRGKL-PESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL--- 120
            +  E  I+ ++ L G    + + K E + A  L I      L      + +   +    
Sbjct: 75  PVLSENKIEKVIALNGSDLQKPYLKAEVQTAKKLHIDHQVLHLIGDGTGDVDDYAEAVAE 134

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           I   + A KP+L+HC +GA RTG   A Y  +V     EEA+++L + Y   P      +
Sbjct: 135 IMRCEKAGKPVLVHCAAGAQRTGGVIAAYRMLVQKKTPEEAYQEL-LQYDWKPHKDQALI 193

Query: 181 DITFEKITQL 190
           D   + + QL
Sbjct: 194 DYLNQNLAQL 203


>gi|148260026|ref|YP_001234153.1| protein tyrosine/serine phosphatase [Acidiphilium cryptum JF-5]
 gi|326403018|ref|YP_004283099.1| putative phosphatase [Acidiphilium multivorum AIU301]
 gi|146401707|gb|ABQ30234.1| protein tyrosine/serine phosphatase [Acidiphilium cryptum JF-5]
 gi|325049879|dbj|BAJ80217.1| putative phosphatase [Acidiphilium multivorum AIU301]
          Length = 229

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/161 (29%), Positives = 81/161 (50%), Gaps = 1/161 (0%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           +L +    +     NF  V P  +YRS  P    +   ++  GI +++NLRG+       
Sbjct: 22  ALFVDHAVLRLGWTNFAPVKPGALYRSNHPVPFQLAKFRRLVGINTLINLRGECRNGSDA 81

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
              +AA  LG+   +  L +    + ++I +L  I++T  +P L+HCKSGADR G+ASA+
Sbjct: 82  LSREAARRLGLDFYDMALESRGAPHRDRILRLAEIIRTMRRPALVHCKSGADRAGIASAL 141

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           +  ++      EA RQLS+ +GH     T  +D   +   +
Sbjct: 142 F-VLIEGGSVAEARRQLSLRFGHIRQSNTGILDAFLDMYEE 181


>gi|78485859|ref|YP_391784.1| protein tyrosine/serine phosphatase [Thiomicrospira crunogena
           XCL-2]
 gi|78364145|gb|ABB42110.1| protein tyrosine/serine phosphatase [Thiomicrospira crunogena
           XCL-2]
          Length = 220

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 62/170 (36%), Positives = 96/170 (56%), Gaps = 1/170 (0%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
               +  F +NFHA+  +  YRS  P+  FI+ L ++ GIK+I++LR       ++ E++
Sbjct: 21  DHEILRLFYRNFHAL-SNNAYRSNHPSAAFIQKLHEKKGIKTIISLRRADQTGQYQLEKE 79

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           A + LGI+LIN P+S+    + ++I Q   IL+ A  P+LIHCKSGADR G+ S  Y + 
Sbjct: 80  ACDRLGIKLINHPMSSRSFPDVDKILQAKKILEDAEYPILIHCKSGADRAGMMSVFYKHF 139

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
           + + P +EA  +L+M YGHF    T  +DI FE        + +    E 
Sbjct: 140 ILNQPIKEALSELNMKYGHFRWADTGKLDIFFESFLTFEKAHPNVSFVEW 189


>gi|224057310|ref|XP_002187902.1| PREDICTED: similar to CDC14A [Taeniopygia guttata]
          Length = 623

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 29/186 (15%), Positives = 62/186 (33%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ ++P +    + P+         
Sbjct: 163 DCLQGVNKALQHGFFDFKTFDVDEYEHYERVENGDFNWIIPGKFLAFSGPHPKSKLENGY 222

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + SI+ L  K+       E K   + G +  +         +D 
Sbjct: 223 PLHAPEAYFPYFKKHNVTSIIRLNKKI------YEAKRFTEAGFEHYDLFFIDGSTPSDS 276

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I + A   + +HCK+G  RTG   A Y+     +   EA   + +   G    
Sbjct: 277 IVQRFLNICENADGAIAVHCKAGLGRTGTLIACYIMKHYKFTHAEAIAWIRICRPGSIIG 336

Query: 175 LKTITM 180
            +   +
Sbjct: 337 PQQHFL 342


>gi|163851502|ref|YP_001639545.1| hypothetical protein Mext_2078 [Methylobacterium extorquens PA1]
 gi|218530309|ref|YP_002421125.1| protein tyrosine/serine phosphatase [Methylobacterium
           chloromethanicum CM4]
 gi|240138669|ref|YP_002963141.1| hypothetical protein MexAM1_META1p2063 [Methylobacterium extorquens
           AM1]
 gi|163663107|gb|ABY30474.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
 gi|218522612|gb|ACK83197.1| protein tyrosine/serine phosphatase [Methylobacterium
           chloromethanicum CM4]
 gi|240008638|gb|ACS39864.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 241

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/160 (30%), Positives = 73/160 (45%), Gaps = 1/160 (0%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE 89
           L +          N H +    ++RSAQP    +    K  G+++I++LRG         
Sbjct: 40  LLVDHGIFRLAYLNRHRIGTGLVWRSAQPTPHQLA-WFKRQGVRTIVSLRGGREHGSWPL 98

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
           + +A    G+ L+ F L +    + E +            P ++HCKSGADR GLA+ ++
Sbjct: 99  QREACERQGLNLVEFVLRSREAPSRETLLAARDFFAGLEYPAVMHCKSGADRAGLAATLF 158

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           L +    P  EA RQLS  YGHF   KT  +D  F    +
Sbjct: 159 LILHEGRPVREALRQLSPRYGHFRFAKTGILDAFFATYLR 198


>gi|300024092|ref|YP_003756703.1| protein tyrosine/serine phosphatase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525913|gb|ADJ24382.1| protein tyrosine/serine phosphatase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 245

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 2/150 (1%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
                N H +    ++RSAQP    +       G+K+I+NLRG+        E++A    
Sbjct: 53  RIAYNNRHRISKD-VWRSAQPAPHHV-GWLARRGVKTIINLRGEQSFGTRWLEQQACARH 110

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           GI L++  L +        ++ +  +LK    P+L+HCKSGADR G+ S +  +     P
Sbjct: 111 GITLVDLALKSRAPPTTADLRAMRDVLKNVEYPILLHCKSGADRAGIMSVIVRHERDGVP 170

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            EEA +QLS+ YGH     T  +D  FE+ 
Sbjct: 171 IEEAKKQLSLRYGHIRSADTGVLDAVFERY 200


>gi|126732786|ref|ZP_01748581.1| protein tyrosine/serine phosphatase [Sagittula stellata E-37]
 gi|126706782|gb|EBA05853.1| protein tyrosine/serine phosphatase [Sagittula stellata E-37]
          Length = 240

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/157 (32%), Positives = 75/157 (47%), Gaps = 2/157 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
                 +     NF  + P  +YRS QP     E   K  GI++++NLRG    + +  E
Sbjct: 39  LFDHAFLRVLWTNFFEIAPG-VYRSNQPTHGRFERYAK-MGIRTVINLRGPDVRAQYLFE 96

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            ++   LG+ L++  L A       +I+ +I  L+ A KP++ HCKSGADR G  +A+YL
Sbjct: 97  RESCETLGLTLVDAKLWARTAAPRSKIEAVIDALRAAEKPVMFHCKSGADRAGFVAAMYL 156

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            I    P E A +QL + Y H    KT   D      
Sbjct: 157 LIFEDAPLEVAQKQLGLKYIHLDFTKTGVQDYILRVY 193


>gi|260427419|ref|ZP_05781398.1| protein tyrosine/serine phosphatase [Citreicella sp. SE45]
 gi|260421911|gb|EEX15162.1| protein tyrosine/serine phosphatase [Citreicella sp. SE45]
          Length = 231

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/158 (32%), Positives = 77/158 (48%), Gaps = 2/158 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
                 + T   NF  + P  ++RS  P     E   K  GIK+++ LRG+   S +  E
Sbjct: 39  LFDHAWLRTVWTNFWEIAPG-VWRSNHPTHRRFEKYAK-MGIKTVITLRGEEKFSHYLFE 96

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           +++   LG++L +  L A       +I  LI  ++T  +P++ HCKSGADR G ASAVYL
Sbjct: 97  KESCEALGLKLEHAKLWARMAPKRARILHLIETMRTVERPMMFHCKSGADRAGFASAVYL 156

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
            +    P EEA +QL + Y H    KT       +   
Sbjct: 157 MVFEGVPVEEARKQLGLKYIHLEFTKTGIQGYILDTYA 194


>gi|84503445|ref|ZP_01001505.1| hypothetical protein OB2597_03809 [Oceanicola batsensis HTCC2597]
 gi|84388232|gb|EAQ01184.1| hypothetical protein OB2597_03809 [Oceanicola batsensis HTCC2597]
          Length = 212

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 83/167 (49%), Gaps = 2/167 (1%)

Query: 28  VSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH 87
                          N H V P  ++RS  PN        ++ GI++ILNLRG      +
Sbjct: 22  FVRWNDHGIFRELWTNLHEVAPG-VWRSNHPNERRFTRY-RDMGIRTILNLRGAEDNVTY 79

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
           + EE+   + GI+L    L A R    E I+Q++++L+ A +PLL HCKSGADR GL SA
Sbjct: 80  RWEERLCAEHGIRLHAVRLDARRAPQVEPIQQVLAVLRQAERPLLFHCKSGADRAGLVSA 139

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
           +YL ++   P + A + LS  + HF    T  +D   E   + +  +
Sbjct: 140 LYLLVIEGQPADIARKMLSRRFLHFRSSMTGVLDHFLESYARAHSRS 186


>gi|326924990|ref|XP_003208705.1| PREDICTED: LOW QUALITY PROTEIN: dual specificity protein
           phosphatase CDC14A-like [Meleagris gallopavo]
          Length = 601

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 29/186 (15%), Positives = 62/186 (33%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ ++P +    + P+         
Sbjct: 155 DCLQGINKALQHGFFDFKTFDVDEYEHYERVENGDFNWIIPGKFLAFSGPHPKSKFENGY 214

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + SI+ L  K+       E K   D G +  +         +D 
Sbjct: 215 PLHAPEAYFPYFRKHNVTSIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDS 268

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I + A   + +HCK+G  RTG   A Y+     +   EA   + +   G    
Sbjct: 269 IVQRFLNICENANGAIAVHCKAGLGRTGTLIACYIMKHYRFTHAEAIAWIRICRPGSIIG 328

Query: 175 LKTITM 180
            +   +
Sbjct: 329 PQQHFL 334


>gi|114328740|ref|YP_745897.1| hypothetical protein GbCGDNIH1_2076 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316914|gb|ABI62974.1| hypothetical protein GbCGDNIH1_2076 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 219

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 48/161 (29%), Positives = 78/161 (48%), Gaps = 2/161 (1%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           SL +          N+  V+P  +YRS  P    +    + +GI++++NLRG        
Sbjct: 19  SLFVDHAVFRLVWDNWAEVLPG-LYRSNHPTPGRLAAAVRRHGIRTLINLRGHRQCGSDA 77

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
               AA  LG+  ++    +    + ++I +  SIL+    P L+HCKSGADR GLAS +
Sbjct: 78  LSRDAAQRLGMAHVDMAFESRGAPHRDRILRFASILQQIEYPALMHCKSGADRAGLASGL 137

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
            + +       +A RQLS  +GHF   +T  +D  F +  +
Sbjct: 138 AIVLTGG-TAAQALRQLSWRFGHFNRSRTGILDAFFVRYAR 177


>gi|163795969|ref|ZP_02189932.1| hypothetical protein BAL199_28110 [alpha proteobacterium BAL199]
 gi|159178724|gb|EDP63262.1| hypothetical protein BAL199_28110 [alpha proteobacterium BAL199]
          Length = 228

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 82/159 (51%), Gaps = 3/159 (1%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL-PESWHK 88
           L +    +     + H V    ++R+AQP    ++   KE GI++ILNLRG       ++
Sbjct: 27  LLVDHGFLRQVYVHRHKVADG-VWRAAQPGPGHLDQFAKE-GIRTILNLRGPRVECGAYR 84

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            E +A   LG+ LI+FP+ +   L+ E +   I +      PLL+HCKSGADRTG  + +
Sbjct: 85  LEREACARLGLTLIDFPIRSRAALDRETVLAAIDLWDGLELPLLMHCKSGADRTGFMATL 144

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
           YL+     P  +A  QLS  YGH    KT  +D  FE  
Sbjct: 145 YLWQRTGLPLRQAMEQLSWRYGHIRQAKTGVIDFFFESY 183


>gi|223648802|gb|ACN11159.1| Dual specificity protein phosphatase CDC14A [Salmo salar]
          Length = 539

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 30/193 (15%), Positives = 64/193 (33%), Gaps = 20/193 (10%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG- 60
           +        L   Y  +  G L      +  Y         +F+ ++P +    + P+  
Sbjct: 157 MYNLNILDCLRAIYKALQFGWLDFSQFDVEEYEHYERAENGDFNWIIPGKFLAFSGPHPK 216

Query: 61  ------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
                              +++ I +I+ L  K+       + K   D+G +  +     
Sbjct: 217 SKIENGYPLHAPEAYFPYFRKHNITAIVRLNKKM------YDAKRFTDMGFEHHDLFFVD 270

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM- 167
               ND  +++ ++I + A   + +HCK+G  RTG     Y+         EA   + + 
Sbjct: 271 GSTPNDSIVRKFLNICENADGAIAVHCKAGLGRTGTLIGCYMMKHYRLTASEAIAWMRIC 330

Query: 168 LYGHFPVLKTITM 180
             G     +   +
Sbjct: 331 RPGSVIGPQQNFV 343


>gi|254461851|ref|ZP_05075267.1| protein tyrosine/serine phosphatase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678440|gb|EDZ42927.1| protein tyrosine/serine phosphatase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 231

 Score =  141 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 79/170 (46%), Gaps = 2/170 (1%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
                +     NF+ V    ++RS QP         ++ GIKS++NLRG  P + +  EE
Sbjct: 40  FDHAFLRVPWTNFYPVSVG-VWRSNQPTHKRFMRY-RDLGIKSVINLRGTDPRAHYLFEE 97

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
           ++   LG++L N  L A    N E I  ++ ++++  +P + HCKSGADR G  +A+Y  
Sbjct: 98  ESCRILGLKLHNTKLWARTAANRENIVAVLDLMRSVERPFMFHCKSGADRAGFCAAMYQI 157

Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           +      EEA RQLS+ + H    KT       +             +T 
Sbjct: 158 VFDGVSVEEAKRQLSIKFIHLKWSKTGVQGYILDVFQARQAKGEIDFETW 207


>gi|329890440|ref|ZP_08268783.1| protein tyrosine/serine phosphatase [Brevundimonas diminuta ATCC
           11568]
 gi|328845741|gb|EGF95305.1| protein tyrosine/serine phosphatase [Brevundimonas diminuta ATCC
           11568]
          Length = 221

 Score =  141 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 50/188 (26%), Positives = 87/188 (46%), Gaps = 3/188 (1%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            + +    G               + T   N H + P  + R+ QP+   + +  K  G+
Sbjct: 3   RYDLTTPFGRFKAHWSYFWKDHAFLRTAFTNAHWLGPDLV-RTNQPSPRQLAWW-KRQGV 60

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLL 132
           ++++NLRG+  E+++  E+ A   LG+ LI+ PL +      +++++  ++ +T   P L
Sbjct: 61  RTVVNLRGQRDEAYYWLEKDACERLGLTLIDAPLDSRDPPGKDRVRRAKALFQTMEYPAL 120

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI-TQLY 191
           IHCKSGADR G+ +  Y +     P   A  +L     H     T  +D T EK   ++ 
Sbjct: 121 IHCKSGADRAGMMAVFYRHFHLGEPISAAMEELGKRTLHSREGLTGVLDYTLEKYVAEVE 180

Query: 192 PNNVSKGD 199
           P  VS  D
Sbjct: 181 PTGVSFED 188


>gi|114557969|ref|XP_001134948.1| PREDICTED: CDC14 homolog A isoform 3 [Pan troglodytes]
          Length = 508

 Score =  141 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 59  DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 118

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 119 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 172

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 173 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 232

Query: 175 LKTITM 180
            +   +
Sbjct: 233 PQQHFL 238


>gi|114763435|ref|ZP_01442842.1| hypothetical protein 1100011001336_R2601_17659 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543973|gb|EAU46984.1| hypothetical protein R2601_17659 [Roseovarius sp. HTCC2601]
          Length = 231

 Score =  140 bits (353), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 52/158 (32%), Positives = 76/158 (48%), Gaps = 2/158 (1%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
                 + T   NF  + P  ++RS  P     E   K  GIK+++ LRG+   S +  E
Sbjct: 39  LFDHAWLRTVWTNFWQIAPG-VWRSNHPTHRRFEKYAK-MGIKTVITLRGEEKFSHYLFE 96

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
           +++   LG+ L +  L A      E+I  LI  L+ A +P++ HCKSGADR G ASAVYL
Sbjct: 97  KESCEKLGLTLKHAKLWARSAPKRERILTLIDTLREAERPMMFHCKSGADRAGFASAVYL 156

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
            +    P E A +QL + Y H    +T       +   
Sbjct: 157 MVFEGVPVEVARKQLGLKYIHLEFTRTGVQGYILDVYA 194


>gi|295148226|ref|NP_001171207.1| CDC14 cell division cycle 14 homolog A [Gallus gallus]
 gi|291291831|gb|ADD91788.1| cell division cycle 14-like protein A [Gallus gallus]
          Length = 603

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 61/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 162 DCLQGINKALQHGFFDFKTFDVDEYEHYERVENGDFNWIVPGKFLALSGPHPKSKFENGY 221

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ I SI+ L  K        E K   D G +  +         +D 
Sbjct: 222 PLHAPEAYFPYFRKHNITSIIRLNKKN------YEAKRFTDAGFEHYDLFFIDGSTPSDS 275

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I + A   + +HCK+G  RTG   A Y+     +   EA   + +   G    
Sbjct: 276 IVQRFLNICENANGAIAVHCKAGLGRTGTLIACYIMKHYRFTHTEAIAWIRVCRPGSIIG 335

Query: 175 LKTITM 180
            +   +
Sbjct: 336 PQQHFL 341


>gi|255263931|ref|ZP_05343273.1| protein tyrosine/serine phosphatase [Thalassiobium sp. R2A62]
 gi|255106266|gb|EET48940.1| protein tyrosine/serine phosphatase [Thalassiobium sp. R2A62]
          Length = 230

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/160 (29%), Positives = 73/160 (45%), Gaps = 1/160 (0%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
            +      +  F  NF  +    +YRS   +           G+K+I+NLRG      + 
Sbjct: 37  DMLFDHAYLRKFWTNFRTLDTG-VYRSNHGDAARFGADIDRLGLKTIINLRGASKAGHYY 95

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            E++     GI LI+  L+A +    + +  L+  L+T  +P+LIHCKSGADR GL SA+
Sbjct: 96  AEKELCTAKGITLIDIRLNARKAPRQQALLDLVDALETTERPVLIHCKSGADRAGLGSAL 155

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           Y  IV  +P ++A  +LS    H        M    +   
Sbjct: 156 YRMIVMGHPTKDARSELSFRTLHVRKSSAGIMGHVLDVYA 195


>gi|194379364|dbj|BAG63648.1| unnamed protein product [Homo sapiens]
          Length = 565

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 87  DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 146

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 147 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 200

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 201 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 260

Query: 175 LKTITM 180
            +   +
Sbjct: 261 PQQHFL 266


>gi|62089300|dbj|BAD93094.1| CDC14 homolog A isoform 1 variant [Homo sapiens]
          Length = 530

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 81  DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 140

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 141 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 194

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 195 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 254

Query: 175 LKTITM 180
            +   +
Sbjct: 255 PQQHFL 260


>gi|148680438|gb|EDL12385.1| mCG2012 [Mus musculus]
          Length = 594

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 114 DCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 173

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 174 PLHAPEAYFPYFKKNNVTTIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 227

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 228 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 287

Query: 175 LKTITM 180
            +   +
Sbjct: 288 PQQHFL 293


>gi|297279369|ref|XP_001107228.2| PREDICTED: dual specificity protein phosphatase CDC14A-like [Macaca
           mulatta]
          Length = 566

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 87  DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 146

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 147 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 200

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 201 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 260

Query: 175 LKTITM 180
            +   +
Sbjct: 261 PQQHFL 266


>gi|67970441|dbj|BAE01563.1| unnamed protein product [Macaca fascicularis]
          Length = 624

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|41055744|ref|NP_956473.1| dual specificity protein phosphatase CDC14B [Danio rerio]
 gi|28279618|gb|AAH45476.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Danio
           rerio]
 gi|182889726|gb|AAI65560.1| Cdc14b protein [Danio rerio]
          Length = 404

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 71/213 (33%), Gaps = 23/213 (10%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG- 60
           +        L   +  +  G L     ++  Y         +F+ ++P +    + P+  
Sbjct: 79  MYNLNILDCLRAVHKALQFGWLDFTQFNVEEYEHYERAENGDFNWILPGKFLAFSSPHPK 138

Query: 61  ------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
                              +++ + +I+ L  K+       + K   D+G +  +     
Sbjct: 139 SKIENGYPLHAPEAYFPYFRKHNVTTIIRLNKKM------YDSKRFTDVGFKHHDLFFVD 192

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM- 167
               ND  + + + I + A   + +HCK+G  RTG     YL         EA   + + 
Sbjct: 193 GSTPNDSIVSRFLHICENADGVIAVHCKAGLGRTGTLIGCYLMKHFRLTAAEAIAWIRIC 252

Query: 168 LYGHFPVLKTITMDITFEKIT---QLYPNNVSK 197
             G     +   +D     +    +LY   +++
Sbjct: 253 RPGSVIGPQQNFVDEMQSSLWAEGELYRQKINE 285


>gi|311254722|ref|XP_003125936.1| PREDICTED: dual specificity protein phosphatase CDC14A-like [Sus
           scrofa]
          Length = 577

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 96  DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 155

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 156 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 209

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 210 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 269

Query: 175 LKTITM 180
            +   +
Sbjct: 270 PQQHFL 275


>gi|15451931|ref|NP_201569.1| dual specificity protein phosphatase CDC14A isoform 2 [Homo
           sapiens]
 gi|3136328|gb|AAC16659.1| Cdc14A2 phosphatase [Homo sapiens]
 gi|55665697|emb|CAH70069.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|119593364|gb|EAW72958.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae), isoform
           CRA_c [Homo sapiens]
          Length = 623

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|114557961|ref|XP_001134865.1| PREDICTED: CDC14 homolog A isoform 2 [Pan troglodytes]
          Length = 623

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|194211072|ref|XP_001489852.2| PREDICTED: CDC14 cell division cycle 14 homolog A (S. cerevisiae)
           [Equus caballus]
          Length = 624

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 59/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKNNVTAIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTMIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|198442873|ref|NP_001101188.2| CDC14 cell division cycle 14 homolog A isoform 2 [Rattus
           norvegicus]
 gi|171846866|gb|AAI61876.1| Cdc14a protein [Rattus norvegicus]
          Length = 626

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDADEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKNNVTTIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|126310869|ref|XP_001372152.1| PREDICTED: similar to Cdc14A2 phosphatase [Monodelphis domestica]
          Length = 619

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G     +  +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFESFDVEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKNNVTTIIRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|26331492|dbj|BAC29476.1| unnamed protein product [Mus musculus]
          Length = 532

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 74  DCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 133

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 134 PLHAPEAYFPYFKKNNVTTIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 187

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 188 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 247

Query: 175 LKTITM 180
            +   +
Sbjct: 248 PQQHFL 253


>gi|47940423|gb|AAH71529.1| Cdc14b protein [Danio rerio]
          Length = 445

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 71/213 (33%), Gaps = 23/213 (10%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG- 60
           +        L   +  +  G L     ++  Y         +F+ ++P +    + P+  
Sbjct: 140 MYNLNILDCLRAVHKALQFGWLDFTQFNVEEYEHYERAENGDFNWILPGKFLAFSSPHPK 199

Query: 61  ------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
                              +++ + +I+ L  K+       + K   D+G +  +     
Sbjct: 200 SKIENGYPLHAPEAYFPYFRKHNVTTIIRLNKKM------YDSKRFTDVGFKHHDLFFVD 253

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM- 167
               ND  + + + I + A   + +HCK+G  RTG     YL         EA   + + 
Sbjct: 254 GSTPNDSIVSRFLHICENADGVIAVHCKAGLGRTGTLIGCYLMKHFRLTAAEAIAWIRIC 313

Query: 168 LYGHFPVLKTITMDITFEKIT---QLYPNNVSK 197
             G     +   +D     +    +LY   +++
Sbjct: 314 RPGSVIGPQQNFVDEMQSSLWAEGELYRQKINE 346


>gi|254449478|ref|ZP_05062915.1| protein tyrosine/serine phosphatase [Octadecabacter antarcticus
           238]
 gi|198263884|gb|EDY88154.1| protein tyrosine/serine phosphatase [Octadecabacter antarcticus
           238]
          Length = 223

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 72/159 (45%), Gaps = 2/159 (1%)

Query: 30  LGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE 89
                  +  +  N   + P  ++RS  P    +     + G  +I+ LRG     W   
Sbjct: 38  RWFDHGILRRYWTNMFEIAPG-VWRSNHPTAARL-TALAQQGTHTIITLRGNRTTPWALL 95

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
           E +A   LG++L    L +    N   ++ LI + +   KP+L HCKSGADRTGLAS +Y
Sbjct: 96  EHEACTRLGLRLETLALRSQHAPNRHDLQTLIDLFRRVEKPVLFHCKSGADRTGLASVIY 155

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           L ++   P  +A + LS  Y H    K   +D+  +   
Sbjct: 156 LLVIEKQPLAQARKMLSWRYVHLSWTKAGVLDLLLDDFA 194


>gi|104737931|gb|ABF74568.1| CDC14A variant 4 [Homo sapiens]
          Length = 610

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|114557967|ref|XP_001135122.1| PREDICTED: CDC14 homolog A isoform 4 [Pan troglodytes]
          Length = 536

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 87  DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 146

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 147 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 200

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 201 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 260

Query: 175 LKTITM 180
            +   +
Sbjct: 261 PQQHFL 266


>gi|304320094|ref|YP_003853737.1| hypothetical protein PB2503_02597 [Parvularcula bermudensis
           HTCC2503]
 gi|303298997|gb|ADM08596.1| hypothetical protein PB2503_02597 [Parvularcula bermudensis
           HTCC2503]
          Length = 233

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 86/182 (47%), Gaps = 7/182 (3%)

Query: 29  SLGLYFLT-ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG----KLP 83
           +L L     + T   N H + P  + R+ QP+   I     + G+K+++NLRG       
Sbjct: 22  ALWLDDHGWLRTLYDNTHEL-PGGMRRTYQPSPGRIARY-AQEGVKTLINLRGIKTDGRQ 79

Query: 84  ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
              +  E++A    GI L++    +      E +  L +  ++   P ++HCKSGADR G
Sbjct: 80  SGVYWLEKEACEAAGIALVDLRAYSREAPKPEFLVDLDACFRSIAYPAVMHCKSGADRAG 139

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
           LA+ +YL++   +P EEA  QL+  YGH    KT  +D  F    +    +    + +  
Sbjct: 140 LAAVLYLFLKEGWPLEEALAQLTYRYGHVKSGKTGVLDHFFAVYREAARRDGVVPNRDHF 199

Query: 204 MN 205
           +N
Sbjct: 200 LN 201


>gi|291398423|ref|XP_002715878.1| PREDICTED: CDC14 homolog A [Oryctolagus cuniculus]
          Length = 624

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|332809643|ref|XP_003308291.1| PREDICTED: dual specificity protein phosphatase CDC14A [Pan
           troglodytes]
          Length = 610

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|299133235|ref|ZP_07026430.1| protein tyrosine/serine phosphatase [Afipia sp. 1NLS2]
 gi|298593372|gb|EFI53572.1| protein tyrosine/serine phosphatase [Afipia sp. 1NLS2]
          Length = 227

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 67/174 (38%), Positives = 102/174 (58%), Gaps = 4/174 (2%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSIL 76
           KI L ++V  AV   L+   +   T N H +   + YRSAQ +   +  L  +  I++++
Sbjct: 41  KICLRLIVFGAVCALLWAGYLRM-TGNVHTIEEGQAYRSAQLSANALLKLIGDKKIRTVI 99

Query: 77  NLRG-KLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           NLRG    ++W+  E +A +  GI  ++  LSA R+L+D+Q+ +L  IL  +PKP+LIHC
Sbjct: 100 NLRGYNGGKNWYDAEIEATHKAGITHVDLALSANRKLSDQQLSRLSDILIKSPKPILIHC 159

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV--LKTITMDITFEKI 187
           + GADR GLA+A+Y  IVA      A  QLS  +GHFP    +T+ MD T++  
Sbjct: 160 EGGADRAGLAAAMYELIVAGRSALVAGTQLSFRFGHFPWLGSRTVAMDQTWDHF 213


>gi|15451929|ref|NP_003663.2| dual specificity protein phosphatase CDC14A isoform 1 [Homo
           sapiens]
 gi|55976620|sp|Q9UNH5|CC14A_HUMAN RecName: Full=Dual specificity protein phosphatase CDC14A; AltName:
           Full=CDC14 cell division cycle 14 homolog A
 gi|5732662|gb|AAD49217.1| dual-specificity phosphatase [Homo sapiens]
 gi|47777659|gb|AAT38107.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|55665698|emb|CAH70070.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|119593365|gb|EAW72959.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae), isoform
           CRA_d [Homo sapiens]
          Length = 594

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|114557965|ref|XP_513593.2| PREDICTED: CDC14 homolog A isoform 7 [Pan troglodytes]
          Length = 582

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 133 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 192

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 193 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 246

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 247 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 306

Query: 175 LKTITM 180
            +   +
Sbjct: 307 PQQHFL 312


>gi|296208635|ref|XP_002751181.1| PREDICTED: dual specificity protein phosphatase CDC14A-like
           [Callithrix jacchus]
          Length = 694

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 214 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 273

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 274 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 327

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 328 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHGEIIAWIKICRPGSIIG 387

Query: 175 LKTITM 180
            +   +
Sbjct: 388 PQQHFL 393


>gi|58039233|ref|YP_191197.1| hypothetical protein GOX0767 [Gluconobacter oxydans 621H]
 gi|58001647|gb|AAW60541.1| Hypothetical protein GOX0767 [Gluconobacter oxydans 621H]
          Length = 220

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 78/187 (41%), Gaps = 13/187 (6%)

Query: 3   KIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTF 62
           +I  P      ++  + +                      N   VVP +++R   P    
Sbjct: 5   RITSPAARRRAWWDSLFV------------DHSIFRLGWTNLAPVVPGKVWRCNHPTPAR 52

Query: 63  IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           +  L +   +K+++NLRG            A+  LG+  ++    +    + ++I +   
Sbjct: 53  LRSLTRRLHLKTLVNLRGHRKCGSDALSRGASAKLGLTHLDMAFESRGAPHRDRILRFYD 112

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDI 182
           + +T   P+L+HCKSGADR GLAS + L        ++A  QL   +GHF   +T  +D 
Sbjct: 113 MYQTLAFPMLMHCKSGADRAGLASGLVLM-FEGGTAQDALGQLHWRFGHFNRSRTGILDA 171

Query: 183 TFEKITQ 189
            F +  +
Sbjct: 172 FFLRYQK 178


>gi|297664329|ref|XP_002810600.1| PREDICTED: LOW QUALITY PROTEIN: dual specificity protein
           phosphatase CDC14A-like [Pongo abelii]
          Length = 620

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTKGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|332222027|ref|XP_003260165.1| PREDICTED: dual specificity protein phosphatase CDC14A isoform 2
           [Nomascus leucogenys]
          Length = 610

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|114557959|ref|XP_001135275.1| PREDICTED: dual specificity protein phosphatase CDC14A isoform 6
           [Pan troglodytes]
          Length = 594

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|327270628|ref|XP_003220091.1| PREDICTED: dual specificity protein phosphatase CDC14A-like [Anolis
           carolinensis]
          Length = 621

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 62/186 (33%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G +         Y         +F+ +VP +    + P+         
Sbjct: 172 DCLQGIKKALQHGFVDFKTFDADEYEHYERVENGDFNWIVPGKFLAFSGPHPKTKIENGY 231

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 232 PLHAPEAYFPYFRKHNVTTVIRLNKKI------YEAKRFTDGGFEHYDLFFIDGSTPSDS 285

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            ++Q +SI + A   + +HCK+G  RTG   A Y+     +   EA   + M   G    
Sbjct: 286 ILRQFLSICEEAEGAIAVHCKAGLGRTGTLIACYIMKHYRFTHSEAIAWIRMCRPGSIIG 345

Query: 175 LKTITM 180
            +   +
Sbjct: 346 PQQHFL 351


>gi|114557957|ref|XP_001135196.1| PREDICTED: CDC14 homolog A isoform 5 [Pan troglodytes]
          Length = 595

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 146 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 205

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 206 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 259

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 260 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 319

Query: 175 LKTITM 180
            +   +
Sbjct: 320 PQQHFL 325


>gi|297472927|ref|XP_002686214.1| PREDICTED: CDC14 cell division cycle 14 homolog A (S. cerevisiae)
           [Bos taurus]
 gi|296489422|gb|DAA31535.1| CDC14 cell division cycle 14 homolog A [Bos taurus]
          Length = 626

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|124249117|ref|NP_001074287.1| dual specificity protein phosphatase CDC14A isoform 1 [Mus
           musculus]
 gi|56748600|sp|Q6GQT0|CC14A_MOUSE RecName: Full=Dual specificity protein phosphatase CDC14A; AltName:
           Full=CDC14 cell division cycle 14 homolog A
          Length = 603

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKNNVTTIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|73959461|ref|XP_852997.1| PREDICTED: similar to CDC14 homolog A isoform 2 isoform 2 [Canis
           familiaris]
          Length = 625

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFIDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTDGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|332222025|ref|XP_003260164.1| PREDICTED: dual specificity protein phosphatase CDC14A isoform 1
           [Nomascus leucogenys]
          Length = 594

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|198442880|ref|NP_001128328.1| CDC14 cell division cycle 14 homolog A isoform 1 [Rattus
           norvegicus]
          Length = 597

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDADEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKNNVTTIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|149611239|ref|XP_001520276.1| PREDICTED: similar to Cdc14A2 phosphatase, partial [Ornithorhynchus
           anatinus]
          Length = 518

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 59/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ ++P +    + P+         
Sbjct: 42  DCLQGIQKGLQHGFFDFETFDVEEYEHYERVENGDFNWIIPGKFLAFSGPHPKSKIENGY 101

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + SI+ L  ++       E K   D G +  +         +D 
Sbjct: 102 PLHAPEAYFPYFRKHNVTSIIRLNKRI------YEAKRFTDAGFEHHDLFFVDGSTPSDN 155

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y      +   E    + +   G    
Sbjct: 156 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYAMKHYRFTHAEIIAWIRICRPGSIIG 215

Query: 175 LKTITM 180
            +   +
Sbjct: 216 PQQHFL 221


>gi|149194653|ref|ZP_01871748.1| protein tyrosine/serine phosphatase [Caminibacter mediatlanticus
           TB-2]
 gi|149135076|gb|EDM23557.1| protein tyrosine/serine phosphatase [Caminibacter mediatlanticus
           TB-2]
          Length = 210

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/161 (32%), Positives = 87/161 (54%), Gaps = 1/161 (0%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
              I+ FT NFH +     YRSAQP    +E + K+Y IK++LN+RG+  ++    +++ 
Sbjct: 12  HSFISLFTFNFHKI-DDNFYRSAQPTDKHLEEIIKKYNIKTVLNVRGEEHKNILASQKEI 70

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
                ++LI   L +    + E+I +L  IL T+  P+L+HCKSG+DRTGL + +Y + +
Sbjct: 71  CKKYNVELITIKLHSRGIPSKEKINRLYEILTTSKYPMLVHCKSGSDRTGLVATLYCHWI 130

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
                +E  +  +  Y HF   KT  +D  FE+  +    N
Sbjct: 131 KGKDIKEIKQLKAFPYLHFKHSKTGLIDKYFEEYLKFKQKN 171


>gi|329851178|ref|ZP_08265935.1| protein tyrosine/serine phosphatase [Asticcacaulis biprosthecum
           C19]
 gi|328840024|gb|EGF89596.1| protein tyrosine/serine phosphatase [Asticcacaulis biprosthecum
           C19]
          Length = 229

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 80/161 (49%), Gaps = 3/161 (1%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
            L      +     N H + P  + R+ QP    +   KK+ GI++++NLRG    S++ 
Sbjct: 28  FLWADHAYLRLGFTNAHWIGPDMV-RTNQPWPFQLASWKKK-GIRTVINLRG-GKGSFYY 84

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
            E+ A   LG+ L +F L++      ++++   ++ +    P L+HCKSGADR G+ S +
Sbjct: 85  MEKYACEKLGLILEDFGLTSRSLPTAQEMRDAKALFERIQYPALLHCKSGADRAGMMSVL 144

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           Y +     P E A +QLSM Y H     T  +D  FE   +
Sbjct: 145 YCHFHLKQPIEVAAQQLSMKYLHMKAGMTGVLDHLFEVYLR 185


>gi|301770791|ref|XP_002920815.1| PREDICTED: dual specificity protein phosphatase CDC14A-like
           [Ailuropoda melanoleuca]
          Length = 624

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVMAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTDGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|149025787|gb|EDL82030.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) (predicted),
           isoform CRA_c [Rattus norvegicus]
          Length = 357

 Score =  136 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 114 DCLQGIRKGLQHGFFDFETFDADEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 173

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K+       E K   D G +  +         +D 
Sbjct: 174 PLHAPEAYFPYFKKNNVTTIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 227

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 228 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 287

Query: 175 LKTITM 180
            +   +
Sbjct: 288 PQQHFL 293


>gi|281339089|gb|EFB14673.1| hypothetical protein PANDA_009608 [Ailuropoda melanoleuca]
          Length = 610

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 131 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 190

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 191 PLHAPEAYFPYFKKHNVMAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 244

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 245 IVRRFLNICENTDGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 304

Query: 175 LKTITM 180
            +   +
Sbjct: 305 PQQHFL 310


>gi|119593366|gb|EAW72960.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae), isoform
           CRA_e [Homo sapiens]
          Length = 284

 Score =  136 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 46  DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 105

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 106 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 159

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 160 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 219

Query: 175 LKTITM 180
            +   +
Sbjct: 220 PQQHFL 225


>gi|291167780|ref|NP_001167024.1| dual specificity protein phosphatase CDC14A isoform 2 [Mus
           musculus]
 gi|49258188|gb|AAH72644.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Mus
           musculus]
          Length = 554

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 29/184 (15%), Positives = 60/184 (32%), Gaps = 20/184 (10%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG---------- 60
           L+  Y  +  G           Y         +F+ +VP +    + P+           
Sbjct: 98  LIGAYAGLQHGFFDFETFDAEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPL 157

Query: 61  ---TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
                     K+  + +I+ L  K+       E K   D G +  +         +D  +
Sbjct: 158 HAPEAYFPYFKKNNVTTIVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDNIV 211

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLK 176
           ++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G     +
Sbjct: 212 RRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQ 271

Query: 177 TITM 180
              +
Sbjct: 272 QHFL 275


>gi|157888759|emb|CAP09233.1| novel protein similar to CDC14 cell division cycle 14 homolog A (S.
           cerevisiae) (CDC14A, zgc:63654) [Danio rerio]
          Length = 592

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 60/188 (31%), Gaps = 20/188 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP ++   + P+         
Sbjct: 143 DCLQGIRKALQHGFFDFENFDVEEYEHYERVENGDFNWIVPGKLLAFSGPHPKSKIENGY 202

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ +  ++ L  K+       E +   D G +  +         +D 
Sbjct: 203 PLHAPEAYFSYFRQHNVTDVVRLNKKI------YEGRRFTDAGFEHHDLFFVDGTTPSDL 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
             ++ + I ++A   + +HCK+G  RTG     YL     +   EA     +   G    
Sbjct: 257 LTRRFLHICESAKGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAPEAIAWTRICRPGSVIG 316

Query: 175 LKTITMDI 182
            +   ++ 
Sbjct: 317 PQQHFLEQ 324


>gi|41055837|ref|NP_957443.1| CDC14 cell division cycle 14 homolog A, a [Danio rerio]
 gi|32766368|gb|AAH55188.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae), a [Danio
           rerio]
          Length = 592

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 60/188 (31%), Gaps = 20/188 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP ++   + P+         
Sbjct: 143 DCLQGIRKALQHGFFDFENFDVEEYEHYERVENGDFNWIVPGKLLAFSGPHPKSKIENGY 202

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ +  ++ L  K+       E +   D G +  +         +D 
Sbjct: 203 PLHAPEAYFSYFRQHNVTDVVRLNKKI------YEGRRFTDAGFEHHDLFFVDGTTPSDL 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
             ++ + I ++A   + +HCK+G  RTG     YL     +   EA     +   G    
Sbjct: 257 LTRRFLHICESAKGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAPEAIAWTRICRPGSVIG 316

Query: 175 LKTITMDI 182
            +   ++ 
Sbjct: 317 PQQHFLEQ 324


>gi|15451933|ref|NP_201570.1| dual specificity protein phosphatase CDC14A isoform 3 [Homo
           sapiens]
 gi|3136330|gb|AAC16660.1| Cdc14A3 phosphatase [Homo sapiens]
 gi|55665696|emb|CAH70068.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|62739607|gb|AAH93916.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|62740039|gb|AAH93918.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae) [Homo
           sapiens]
 gi|119593362|gb|EAW72956.1| CDC14 cell division cycle 14 homolog A (S. cerevisiae), isoform
           CRA_a [Homo sapiens]
          Length = 383

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|114557963|ref|XP_001134788.1| PREDICTED: CDC14 homolog A isoform 1 [Pan troglodytes]
          Length = 383

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G        +  Y         +F+ +VP +    + P+         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 204

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 205 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 258

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 259 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 318

Query: 175 LKTITM 180
            +   +
Sbjct: 319 PQQHFL 324


>gi|89067809|ref|ZP_01155253.1| hypothetical protein OG2516_05128 [Oceanicola granulosus HTCC2516]
 gi|89046407|gb|EAR52463.1| hypothetical protein OG2516_05128 [Oceanicola granulosus HTCC2516]
          Length = 242

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 80/171 (46%), Gaps = 1/171 (0%)

Query: 31  GLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            L    +     N   + P  ++RS QP    +  L+  +G+ +ILNLRG+   + +   
Sbjct: 39  WLDHAHLRRVWTNQVEIAPG-VWRSNQPTFRRLRELRDRHGVHTILNLRGEDVFAHYLFL 97

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
            +    LG++L++  L+AT     E++ +L+       +P L+HCKSGADRTGLA+A+++
Sbjct: 98  REECAALGLRLVDVKLNATTAPTRERLVELLEAFDRVERPFLMHCKSGADRTGLAAALWM 157

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
            +      E+A  QL   + H+       +D   +             DT 
Sbjct: 158 MLKEGQSLEQARDQLHRRHWHYRNGPAGVIDEILDLYEARNTRAPVAIDTW 208


>gi|298571356|gb|ADI87699.1| hypothetical protein LW2_0240 [uncultured Nitrospirae bacterium
           MY2-3C]
          Length = 180

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/174 (37%), Positives = 101/174 (58%), Gaps = 1/174 (0%)

Query: 16  IKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSI 75
             ++L   V+    L L +++ T    NFH +   + YRSAQ     ++Y    YGI+SI
Sbjct: 4   RNVILRADVVLLYILLLSYISYTMAAGNFHVITQGKAYRSAQLEQRQLQYYINNYGIRSI 63

Query: 76  LNLRGKLPES-WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIH 134
           LNLRG+ P + W++ E + +    I   +  LS+ RE    ++ +L+ I   AP+P+LIH
Sbjct: 64  LNLRGQNPRAAWYETEVRFSGLHNIAHYDIALSSAREPTARELNELMRIFAEAPRPILIH 123

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
           C SG+DR+GL +A++  +V   PK +AHRQLS+LYGH P      +D  FEK +
Sbjct: 124 CWSGSDRSGLVAAMWKVVVEKEPKAKAHRQLSILYGHLPFGDAAVLDRFFEKWS 177


>gi|220936409|ref|YP_002515308.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997719|gb|ACL74321.1| protein tyrosine/serine phosphatase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 223

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/162 (29%), Positives = 75/162 (46%), Gaps = 3/162 (1%)

Query: 30  LGLYFLTITTF-TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE-SWH 87
           L      +  F   NFH +     +RS QP+   +      +GI++++NLRG+ P+    
Sbjct: 20  LWADDGWVREFGLNNFHRISE-RAFRSGQPSPRHLSLRIPRHGIRTVINLRGEEPDNPML 78

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
             E  A   LG++L +    +      E I Q   +L+    P+  HCKSGADR GL + 
Sbjct: 79  ALEADACERLGVRLEHLRTYSRDLPTREVIHQAHELLQRIEYPVWFHCKSGADRAGLMAT 138

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           +YL+ +   P E+  +     Y H+   KT  +D  FE   +
Sbjct: 139 LYLHWIEGVPLEQTRQLKLWPYFHYRYAKTGLLDYFFETYLK 180


>gi|301609253|ref|XP_002934198.1| PREDICTED: dual specificity protein phosphatase CDC14A-like
           [Xenopus (Silurana) tropicalis]
          Length = 575

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 59/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 143 DCLQGIRKALYFGFFNFENFDADEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 202

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ I++++ L  K+       + K   D G    +         +D 
Sbjct: 203 PLHAPEAYFPYFRKHNIRAVIRLNKKI------YDAKRFTDAGFDHYDLFFVDGSTPSDG 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ +++ +     + +HCK+G  RTG   A Y+         EA   + +   G    
Sbjct: 257 IVRRFLNLCENTDGAIAVHCKAGLGRTGTLIACYIMKHYRLTHSEAIAWIRICRPGSIIG 316

Query: 175 LKTITM 180
            +   +
Sbjct: 317 PQQHFL 322


>gi|224088701|ref|XP_002191306.1| PREDICTED: similar to CDC14 homolog B [Taeniopygia guttata]
          Length = 566

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 63/196 (32%), Gaps = 21/196 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                    +  G L      +  Y         +F+ ++P++    + P+         
Sbjct: 263 DCFHAINKALQYGFLDFNTFDVNEYEHYERAENGDFNWIIPNKFIAFSGPHSRSKIENGY 322

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K+  + +I+ L  K        + K   D G +  +   +     +D 
Sbjct: 323 PRHAPEAYFPYFKQNKVTTIIRLNKK------LYDAKRFTDAGFEHFDLFFADGSTPSDT 376

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K  ++I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 377 IVKTFLNICENAEGVIAVHCKAGLGRTGTLIACYIMKHYQMTAAETIAWIRINRPGSVIG 436

Query: 175 LKTITM-DITFEKITQ 189
            +   + D   E  T+
Sbjct: 437 PQQHFLMDKQAELWTE 452


>gi|2662417|gb|AAB88277.1| cdc14 homolog [Homo sapiens]
          Length = 580

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 61/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G      + +  Y         +F+ +VP +    + P+         
Sbjct: 131 DCLQGIRKGLQHGFFDFETIDVDEYEHYERVENGDFNCIVPGKFLAFSGPHPKSKIENGY 190

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +++ L  K+       E K   D G +  +         +D 
Sbjct: 191 PLHAPEAYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDN 244

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 245 IVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIG 304

Query: 175 LKTITM 180
            +   +
Sbjct: 305 PQQHFL 310


>gi|320104233|ref|YP_004179824.1| protein tyrosine/serine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319751515|gb|ADV63275.1| protein tyrosine/serine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 275

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 80/143 (55%), Gaps = 1/143 (0%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-WHKEEEKAANDLG 98
              NF  V P   YR AQP G  +E     +GI ++LNLRG  PE  W+ +E +     G
Sbjct: 61  IDTNFGVVQPGVAYRCAQPQGDDLERFIDAHGIATVLNLRGGKPEDQWYAKEVETVQKRG 120

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +   + P+SAT+     Q+  ++ +L+ AP+P+LIHCK+GADRTGLASA+   ++   P 
Sbjct: 121 VTYYDLPMSATKRPERRQMLWILDVLRDAPRPILIHCKAGADRTGLASALQKLVIQGEPP 180

Query: 159 EEAHRQLSMLYGHFPVLKTITMD 181
            +A    ++ +GHF    T  + 
Sbjct: 181 RQALSAFTLRHGHFAWGPTGVLH 203


>gi|190570272|ref|NP_001122010.1| dual specificity protein phosphatase CDC14A [Danio rerio]
 gi|148725636|emb|CAN88651.1| novel protein similar to vertebrate CDC14 cell division cycle 14
           homolog A (S. cerevisiae) (CDC14A) [Danio rerio]
          Length = 510

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G L      +  Y         + + + P ++   + P+         
Sbjct: 161 DCLQGIRKALQHGFLNFETFDVNEYEHYERVENGDLNWITPGKLLAFSGPHPKSKVENGY 220

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +I+ L  K+       + K   D G    +         +D 
Sbjct: 221 PLHAPEAYFPYFRKHNVTTIVRLNKKI------YDAKRFTDAGFDHYDLFFVDGSTPSDI 274

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
             ++ + I ++    + +HCK+G  RTG     YL     +   EA   + +   G    
Sbjct: 275 ITRRFLHICESTSGAVAVHCKAGLGRTGTLIGCYLMKHYRFTSAEAIAWIRICRPGSIIG 334

Query: 175 LKTITM 180
            +   +
Sbjct: 335 PQQHYL 340


>gi|118104173|ref|XP_425045.2| PREDICTED: similar to Cdc14B2 phosphatase [Gallus gallus]
          Length = 527

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 61/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                    +  G L      +  Y         +F+ ++P++    + P+         
Sbjct: 182 DCFHAINKALQYGFLDFDEFDVNEYEHYERAENGDFNWIIPNKFIAFSGPHSRSKIENGY 241

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +I+ L  K+       + +   D G +  +   +     ND 
Sbjct: 242 PHHAPEAYFPYFRKHKVTTIIRLNKKM------YDARRFTDAGFEHFDLFFADGSIPNDT 295

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K  ++I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 296 IVKAFLNICENAEGVVAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWIRINRPGSVIG 355

Query: 175 LKTITM 180
            +   +
Sbjct: 356 PQQHFL 361


>gi|323650064|gb|ADX97118.1| dual specificity protein phosphatase CDC14a [Perca flavescens]
          Length = 403

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 26/193 (13%), Positives = 62/193 (32%), Gaps = 20/193 (10%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG- 60
           +        L   +  +  G L      +  Y         + + ++P +    + P+  
Sbjct: 128 MYNLNILDCLRGVHKALQYGWLDFSNFDVEEYEHYERAENGDLNWIIPKKFLAFSGPHPK 187

Query: 61  ------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
                              +++ I +I+ L  K+       + +   + G +  +     
Sbjct: 188 SKIENGYPLHAPEAYIPYFRKHNITTIIRLNKKM------YDARRFTESGFEHHDLFFVD 241

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM- 167
               ND  +++ ++I + A   + +HCK+G  RTG     Y+         EA   + + 
Sbjct: 242 GSTPNDAIVRKFLNICENAEGAIAVHCKAGLGRTGTLIGCYMMKHYCLSAAEAIAWIRIC 301

Query: 168 LYGHFPVLKTITM 180
             G     +   +
Sbjct: 302 RPGSIIGPQQNFV 314


>gi|291383511|ref|XP_002708314.1| PREDICTED: CDC14 homolog B [Oryctolagus cuniculus]
          Length = 583

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 29/186 (15%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L     +L  Y         +F+ ++P                   
Sbjct: 279 DCFHAVKKAMQYGFLDFNTFNLDEYEHYEKAENGDFNWIIPDRFIAFCGPHARSRLESGY 338

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  K+       + K   D G    +   +      D 
Sbjct: 339 HQHSPETYIPYFKNHNVTTIIRLNKKM------YDAKRFTDAGFDHHDLFFADGSTPTDT 392

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 393 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 452

Query: 175 LKTITM 180
            +   +
Sbjct: 453 PQQQFL 458


>gi|291291829|gb|ADD91787.1| cell division cycle 14-like protein B [Gallus gallus]
          Length = 460

 Score =  131 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 61/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                    +  G L      +  Y         +F+ ++P++    + P+         
Sbjct: 182 DCFHAINKALQYGFLDFDEFDVNEYEHYERAENGDFNWIIPNKFIAFSGPHSRSKIENGY 241

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +I+ L  K+       + +   D G +  +   +     ND 
Sbjct: 242 PHHAPEAYFPYFRKHKVTTIIRLNKKM------YDARRFTDAGFEHFDLFFADGSIPNDT 295

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K  ++I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 296 IVKAFLNICENAEGVVAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWIRINRPGSVIG 355

Query: 175 LKTITM 180
            +   +
Sbjct: 356 PQQHFL 361


>gi|198282552|ref|YP_002218873.1| protein tyrosine/serine phosphatase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218668152|ref|YP_002424743.1| hypothetical protein AFE_0236 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247073|gb|ACH82666.1| protein tyrosine/serine phosphatase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218520365|gb|ACK80951.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 226

 Score =  131 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 50/162 (30%), Positives = 82/162 (50%), Gaps = 5/162 (3%)

Query: 31  GLYFLTIT-TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHK 88
                     F  NFH + P  ++RSAQP+   + + +++YG+ ++LNLR   P E  ++
Sbjct: 21  WTDHGIFRELFYANFHEIAPG-VFRSAQPSPVQLRHWQQKYGLCTVLNLRAPAPHEPHYR 79

Query: 89  EEEKAANDLGIQLINFP-LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
            E++A + LG+  +      +      +++   I++L   P+P L+HCKSGADR G  S 
Sbjct: 80  LEQEACDALGMTHLTLHGFGSRDLPERDKLLAGIAVLDQLPQPFLLHCKSGADRAGFISV 139

Query: 148 VYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEKIT 188
           +YL++V   P   A RQL    +GH     T  +D  F    
Sbjct: 140 LYLHLVLGIPLSAAQRQLRLWPFGHIRHANTGILDWFFVNYH 181


>gi|149029147|gb|EDL84432.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) (predicted),
           isoform CRA_b [Rattus norvegicus]
          Length = 498

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    I  G L   + +L  Y         +F+ ++P                   
Sbjct: 181 DCFHAVKKAIQYGFLNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 241 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAEA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 295 IVQEFLDICENVEGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|291223425|ref|XP_002731710.1| PREDICTED: CDC14 homolog A-like, partial [Saccoglossus kowalevskii]
          Length = 561

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/216 (13%), Positives = 67/216 (31%), Gaps = 23/216 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G        +  Y         +F+ ++P +    + P+         
Sbjct: 152 DCLKAIDRALDNGFFHFDTFDVEEYEHYERVENGDFNWIIPDKFLAFSGPHNKSKIENGY 211

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ I +++ L  K        + +   D G    +         +D 
Sbjct: 212 PLHAPEAYFPYFRKHNITTVVRLNKKN------YDSRRFTDAGFDHHDLFFIDGSTPSDA 265

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ +SI + A   + +HCK+G  RTG     Y+     +   E    L +   G    
Sbjct: 266 HVQRFLSISENAEGAISVHCKAGLGRTGTLIGCYMMKHYKFTAAETIAWLRICRPGSVIG 325

Query: 175 LKTITMDITFEKIT---QLYPNNVSKGDTEQPMNAT 207
            +   ++     +     +Y   + +G      + T
Sbjct: 326 PQQNYLEEKQASMWVQGDIYRKKLKEGRLTNKSSVT 361


>gi|156717220|ref|NP_001096152.1| CDC14 cell division cycle 14 homolog B [Xenopus (Silurana)
           tropicalis]
 gi|134024521|gb|AAI36224.1| cdc14a protein [Xenopus (Silurana) tropicalis]
          Length = 362

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 57/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                 +  +           +  Y         +F+ ++P +    + P+         
Sbjct: 80  DCFFAVHKALQYNFFDFKTFDVEEYQHYERAENGDFNWIIPEKFLAFSGPHQKSKIESGY 139

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ I +I+ L  K+       E K   D   +  +         +D 
Sbjct: 140 PHHAPEAYFPYFRKHNITTIIRLNKKM------YEAKRFTDANFEHYDLFFVDGSTPSDA 193

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I + A   + +HCK+G  RTG     Y+         E    + +   G    
Sbjct: 194 IVRKFLNICENAEGAIAVHCKAGLGRTGTLIGSYMMKHYRMTAAETIAWIRICRPGSVIG 253

Query: 175 LKTITM 180
            +   M
Sbjct: 254 PQQQFM 259


>gi|147903219|ref|NP_001084450.1| CDC14 cell division cycle 14 homolog A [Xenopus laevis]
 gi|49256255|gb|AAH74311.1| CDC14a protein [Xenopus laevis]
          Length = 576

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 143 DCLQGIRKALHFGFFNFENFDADEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 202

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ I++++ L  K+       + K   D G    +         +D 
Sbjct: 203 PLHAPEAYFPYFRKHNIRAVIRLNKKI------YDAKRFTDAGFDHYDLFFVDGSTPSDG 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ +++ +     + +HCK+G  RTG   A Y+     +   E    +     G    
Sbjct: 257 IVRRFLNLCENTDGAIAVHCKAGLGRTGTLIACYIMKHYRFTHSETIAWIRTCRPGSIIG 316

Query: 175 LKTITM 180
            +   +
Sbjct: 317 PQQHFL 322


>gi|43242518|gb|AAS20606.2| cell division cycle 14 alpha protein [Xenopus laevis]
 gi|55831962|gb|AAV66581.1| protein phosphatase CDC14A [Xenopus laevis]
          Length = 575

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 58/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G           Y         +F+ +VP +    + P+         
Sbjct: 143 DCLQGIRKALHFGFFNFENFDADEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGY 202

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ I++++ L  K+       + K   D G    +         +D 
Sbjct: 203 PLHAPEAYFPYFRKHNIRAVIRLNKKI------YDAKRFTDAGFDHYDLFFVDGSTPSDG 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ +++ +     + +HCK+G  RTG   A Y+     +   E    +     G    
Sbjct: 257 IVRRFLNLCENTDGAIAVHCKAGLGRTGTLIACYIMKHYRFTHSETIAWIRTCRPGSIIG 316

Query: 175 LKTITM 180
            +   +
Sbjct: 317 PQQHFL 322


>gi|297684896|ref|XP_002820047.1| PREDICTED: dual specificity protein phosphatase CDC14B-like isoform
           3 [Pongo abelii]
          Length = 581

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 264 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 323

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 324 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 377

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 378 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 437

Query: 175 LKTITM 180
            +   +
Sbjct: 438 PQQQFL 443


>gi|156375475|ref|XP_001630106.1| predicted protein [Nematostella vectensis]
 gi|156217120|gb|EDO38043.1| predicted protein [Nematostella vectensis]
          Length = 374

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 67/208 (32%), Gaps = 14/208 (6%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTF------ 62
             L  F   I  G        L  Y      F  N   +VP +I   + P          
Sbjct: 151 DCLKGFEKAISRGFFSFEDFDLNRYEEDEKAFDSN--WIVPGKILAMSDPQRRNEVKASR 208

Query: 63  ---IEYLKKEYGIKSILNLRGKLPESWHKEEEKA--ANDLGIQLINFPLSATRELNDEQI 117
              +    ++ G+K+++ L        +     A      G    +             +
Sbjct: 209 FAKLRKHFRQNGVKTVVRLNRDDNMIKYGLVYDARCFTANGFAHSDQYFEDGGIPTKAIV 268

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLK 176
           K+   IL      + IHC++G  RTG   A YL     +   EA   L +   G    L+
Sbjct: 269 KRFTRILDHCEGAVAIHCRAGLGRTGTLIACYLIKQYKFSAAEAVGWLRICRPGSVSSLQ 328

Query: 177 TITMDITFEKITQLYPNNVSKGDTEQPM 204
              ++   E I + Y  +++  D  + M
Sbjct: 329 HCFLEHKQEAIQRGYTEDLTLEDLSETM 356


>gi|157817249|ref|NP_001101874.1| dual specificity protein phosphatase CDC14B [Rattus norvegicus]
 gi|149029146|gb|EDL84431.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) (predicted),
           isoform CRA_a [Rattus norvegicus]
          Length = 520

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    I  G L   + +L  Y         +F+ ++P                   
Sbjct: 181 DCFHAVKKAIQYGFLNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 241 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAEA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 295 IVQEFLDICENVEGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|256087847|ref|XP_002580074.1| dual specificity protein phosphatase cdc14 [Schistosoma mansoni]
 gi|238665580|emb|CAZ36313.1| dual specificity protein phosphatase cdc14, putative [Schistosoma
           mansoni]
          Length = 712

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 26/187 (13%), Positives = 56/187 (29%), Gaps = 20/187 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      +L   L      L  Y         +   ++P++      P          
Sbjct: 154 DCLFAVNKALLNKFLDFDTFDLQEYEHFEKVENGDLSWIIPNKFLAFCGPHSQTKIENGY 213

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
              +        ++  + +I+ L  K+       + K   + G    +   +     +D+
Sbjct: 214 PLHSPEAYFPYFRKRNVTTIIRLNKKV------YDAKRFTNAGFAHYDLFFTDGSCPSDQ 267

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + + I +     + +HCK+G  RTG     YL         E    + +   G    
Sbjct: 268 IMNRFLEICENVSGAIAVHCKAGLGRTGTLIGCYLMKHYKLTSREVIGWIRICRPGSIIG 327

Query: 175 LKTITMD 181
            +   +D
Sbjct: 328 PQQHWLD 334


>gi|148684284|gb|EDL16231.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae), isoform
           CRA_a [Mus musculus]
          Length = 498

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         +F+ ++P                   
Sbjct: 181 DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 241 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAES 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 295 IVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|326935133|ref|XP_003213633.1| PREDICTED: dual specificity protein phosphatase CDC14B-like,
           partial [Meleagris gallopavo]
          Length = 306

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 65/195 (33%), Gaps = 20/195 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                    +  G L      +  Y         +F+ ++P++    + P+         
Sbjct: 41  DCFHAISKALQYGFLDFDEFDVNEYEHYERAENGDFNWIIPNKFIAFSGPHSRSKIENGY 100

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +I+ L  K+       + +   D G +  +   +     ND 
Sbjct: 101 PHHAPEAYFPYFRKHKVTTIIRLNKKM------YDARRFTDAGFEHFDLFFADGSIPNDT 154

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K  +SI + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 155 IVKAFLSICENAEGVIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWIRINRPGSVIG 214

Query: 175 LKTITMDITFEKITQ 189
            +   +    +++ +
Sbjct: 215 PQQHFLMEKQQELWR 229


>gi|148684285|gb|EDL16232.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae), isoform
           CRA_b [Mus musculus]
          Length = 520

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         +F+ ++P                   
Sbjct: 181 DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 241 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAES 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 295 IVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|22902095|gb|AAN10162.1| CDC14 [Takifugu rubripes]
          Length = 431

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 59/182 (32%), Gaps = 14/182 (7%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP--N 59
           +        L      +  G L   +  +  Y   +     + + ++P        P   
Sbjct: 136 MYNLNILDCLRAVNKALQYGWLDFSSFDVEEYEHYVRAENGDLNWIIPE-----GYPLHA 190

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
                   ++  + +I+ L  K+       + K   + G +  +         ND  +++
Sbjct: 191 PEAYIPYFRKNNVTTIIRLNKKM------YDAKRFTETGFEHHDLFFVDGSTPNDSIVRK 244

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
            +SI + A   + +HCK+G  RTG     Y+         EA   + +   G     +  
Sbjct: 245 FLSICENAEGAVAVHCKAGLGRTGTLIGCYMMKHYRLTAAEAIAWIRICRPGSIIGPQQN 304

Query: 179 TM 180
            +
Sbjct: 305 FV 306


>gi|114625695|ref|XP_001152510.1| PREDICTED: CDC14 homolog B isoform 3 [Pan troglodytes]
 gi|114625697|ref|XP_001152575.1| PREDICTED: CDC14 homolog B isoform 4 [Pan troglodytes]
          Length = 403

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 86  DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 145

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 146 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 199

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 200 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 259

Query: 175 LKTITM 180
            +   +
Sbjct: 260 PQQQFL 265


>gi|119613063|gb|EAW92657.1| hCG32512, isoform CRA_d [Homo sapiens]
          Length = 500

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|332865189|ref|XP_003318472.1| PREDICTED: dual specificity protein phosphatase CDC14C-like isoform
           2 [Pan troglodytes]
          Length = 554

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 258 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 317

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 318 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 371

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 372 IVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 431

Query: 175 LKTITM 180
            +   +
Sbjct: 432 PQQQFL 437


>gi|148684287|gb|EDL16234.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae), isoform
           CRA_d [Mus musculus]
 gi|148684288|gb|EDL16235.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae), isoform
           CRA_d [Mus musculus]
          Length = 491

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         +F+ ++P                   
Sbjct: 187 DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 246

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 247 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAES 300

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 301 IVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 360

Query: 175 LKTITM 180
            +   +
Sbjct: 361 PQQQFL 366


>gi|15451936|ref|NP_201588.1| dual specificity protein phosphatase CDC14B isoform 2 [Homo
           sapiens]
 gi|114625681|ref|XP_001152707.1| PREDICTED: CDC14 homolog B isoform 6 [Pan troglodytes]
 gi|114625683|ref|XP_520708.2| PREDICTED: CDC14 homolog B isoform 10 [Pan troglodytes]
 gi|297684892|ref|XP_002820045.1| PREDICTED: dual specificity protein phosphatase CDC14B-like isoform
           1 [Pongo abelii]
 gi|55976216|sp|O60729|CC14B_HUMAN RecName: Full=Dual specificity protein phosphatase CDC14B; AltName:
           Full=CDC14 cell division cycle 14 homolog B
 gi|3136332|gb|AAC16661.1| Cdc14B2 phosphatase [Homo sapiens]
 gi|57160682|emb|CAI39616.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|57162205|emb|CAI40536.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|119613065|gb|EAW92659.1| hCG32512, isoform CRA_f [Homo sapiens]
 gi|162319048|gb|AAI56667.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [synthetic
           construct]
 gi|307685951|dbj|BAJ20906.1| CDC14 cell division cycle 14 homolog B [synthetic construct]
          Length = 498

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|320104940|ref|YP_004180531.1| hypothetical protein Isop_3424 [Isosphaera pallida ATCC 43644]
 gi|319752222|gb|ADV63982.1| hypothetical protein Isop_3424 [Isosphaera pallida ATCC 43644]
          Length = 265

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 56/175 (32%), Positives = 92/175 (52%), Gaps = 1/175 (0%)

Query: 16  IKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSI 75
            ++  G L+L A      F+       NF  + P E+YRSAQ +   ++ +  ++GI+++
Sbjct: 27  WRVWAGRLMLLAGLAVAGFVGWRVAIGNFAVIEPGELYRSAQLSAAQLDRVIADHGIRAV 86

Query: 76  LNLRGKLP-ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIH 134
           LNLRG  P E W++ E       G   I+  +S+    +  Q+ +++ IL+TAP+PLLIH
Sbjct: 87  LNLRGHNPDEPWYRNEVATTLKRGATQIDVAMSSCDWASRAQMNEIVRILETAPRPLLIH 146

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
           C  G++RTGL SA+ + +      EEA RQ S  Y + P    +T     ++   
Sbjct: 147 CWHGSERTGLVSALAILLRPGSTLEEAERQFSWRYLYVPFGDGVTTYAHLKQYKH 201


>gi|116008458|ref|NP_001070649.1| dual specificity protein phosphatase CDC14B isoform 3 [Homo
           sapiens]
 gi|114625689|ref|XP_001152956.1| PREDICTED: dual specificity protein phosphatase CDC14B isoform 9
           [Pan troglodytes]
 gi|193785168|dbj|BAG54321.1| unnamed protein product [Homo sapiens]
          Length = 461

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 144 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 203

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 204 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 258 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 PQQQFL 323


>gi|172072671|ref|NP_766175.3| dual specificity protein phosphatase CDC14B isoform 1 [Mus
           musculus]
 gi|55976439|sp|Q6PFY9|CC14B_MOUSE RecName: Full=Dual specificity protein phosphatase CDC14B; AltName:
           Full=CDC14 cell division cycle 14 homolog B
 gi|34785386|gb|AAH57357.1| Cdc14b protein [Mus musculus]
          Length = 485

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         +F+ ++P                   
Sbjct: 181 DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 241 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAES 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 295 IVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|332222838|ref|XP_003260576.1| PREDICTED: dual specificity protein phosphatase CDC14B [Nomascus
           leucogenys]
          Length = 461

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 144 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 203

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 204 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 258 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 PQQQFL 323


>gi|114625685|ref|XP_001152444.1| PREDICTED: CDC14 homolog B isoform 2 [Pan troglodytes]
          Length = 495

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|114625691|ref|XP_001152898.1| PREDICTED: CDC14 homolog B isoform 8 [Pan troglodytes]
          Length = 458

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 144 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 203

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 204 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 258 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 PQQQFL 323


>gi|194862944|ref|XP_001970199.1| GG23504 [Drosophila erecta]
 gi|190662066|gb|EDV59258.1| GG23504 [Drosophila erecta]
          Length = 1039

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 27/187 (14%), Positives = 56/187 (29%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ + I +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AIMKKFLCICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|195147338|ref|XP_002014637.1| GL18848 [Drosophila persimilis]
 gi|194106590|gb|EDW28633.1| GL18848 [Drosophila persimilis]
          Length = 1091

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 150 DCLNAVHKGLQAGFFNFDDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 209

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        +E  + +++ L  K+          +  + G    +         +D
Sbjct: 210 YPCHAPERYFSYFRENHVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 263

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 264 AIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYMMKHYGFTALEAIAWLRLCRPGSVI 323

Query: 174 VLKTITM 180
             +   M
Sbjct: 324 GHQQQWM 330


>gi|195034156|ref|XP_001988836.1| GH11379 [Drosophila grimshawi]
 gi|193904836|gb|EDW03703.1| GH11379 [Drosophila grimshawi]
          Length = 1099

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 58/187 (31%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G L         Y         +F+ +VP +      P+         
Sbjct: 150 DCLQAVHKGLQAGYLNFNDFDAEEYEHFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 209

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 210 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 263

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 264 AILKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYMMKHYGFSALEAIAWLRLCRPGSVI 323

Query: 174 VLKTITM 180
             +   M
Sbjct: 324 GHQQQWM 330


>gi|29436758|gb|AAH49794.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Mus
           musculus]
          Length = 485

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         +F+ ++P                   
Sbjct: 181 DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 241 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAES 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 295 IVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|198473863|ref|XP_001356478.2| GA20127 [Drosophila pseudoobscura pseudoobscura]
 gi|198138141|gb|EAL33542.2| GA20127 [Drosophila pseudoobscura pseudoobscura]
          Length = 1067

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 150 DCLNAVHKGLQAGFFNFDDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 209

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        +E  + +++ L  K+          +  + G    +         +D
Sbjct: 210 YPCHAPERYFSYFRENHVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 263

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 264 AIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYMMKHYGFTALEAIAWLRLCRPGSVI 323

Query: 174 VLKTITM 180
             +   M
Sbjct: 324 GHQQQWM 330


>gi|327263489|ref|XP_003216552.1| PREDICTED: dual specificity protein phosphatase CDC14B-like [Anolis
           carolinensis]
          Length = 457

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 59/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                    +  G L      +  Y         +F+ ++P +    + P+         
Sbjct: 144 DCFHGVNKALQYGFLDFSTFDVDEYEHYEKAENGDFNWIIPKKFLAFSGPHARSRIENGY 203

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       + + I +++ L  ++       + +   D G +  +   +     +D 
Sbjct: 204 PHHAPEAYFPYFRRHNITTVIRLNKRV------YDARRFRDGGFEHYDLFFADGSTPSDT 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            I+  ++I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 258 IIRTFLNICENAEGAIAVHCKAGLGRTGTLIACYMMKHYRMTAAECMAWIRICRPGSVIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 AQQHFL 323


>gi|172072673|ref|NP_001116461.1| dual specificity protein phosphatase CDC14B isoform 2 [Mus
           musculus]
 gi|26334249|dbj|BAC30842.1| unnamed protein product [Mus musculus]
          Length = 448

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         +F+ ++P                   
Sbjct: 144 DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 203

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 204 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAES 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 258 IVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 PQQQFL 323


>gi|115692107|ref|XP_781590.2| PREDICTED: similar to CDC14a protein [Strongylocentrotus
           purpuratus]
 gi|115970873|ref|XP_001191121.1| PREDICTED: similar to CDC14a protein [Strongylocentrotus
           purpuratus]
          Length = 534

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 29/186 (15%), Positives = 62/186 (33%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G L      +  Y         +F+ +VP++    + P+         
Sbjct: 143 DCLKGIDKAVTHGFLDFENFDVEEYEHYERVENGDFNWIVPNKYLAFSGPHPKSKIENGY 202

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ I SI+ L  K+       + +   D G    +         +D 
Sbjct: 203 PYHAPEAYFPYFRKHNITSIVRLNKKI------YDARRFTDAGFDHYDLFFIDGSTPSDS 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I +++   L +HCK+G  RTG     Y+     +   E    + +   G    
Sbjct: 257 ILQKFLAISESSEGSLAVHCKAGLGRTGTLIGCYIMKHFRFTAAEVIAWMRICRPGSVIG 316

Query: 175 LKTITM 180
            +   M
Sbjct: 317 PQQHYM 322


>gi|148684286|gb|EDL16233.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae), isoform
           CRA_c [Mus musculus]
          Length = 454

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         +F+ ++P                   
Sbjct: 187 DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY 246

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +          + 
Sbjct: 247 HQHSPETYIPYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFPDGSTPAES 300

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I +     + +HCK+G  RTG     YL         E+   L +   G    
Sbjct: 301 IVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIG 360

Query: 175 LKTITM 180
            +   +
Sbjct: 361 PQQQFL 366


>gi|195471417|ref|XP_002088001.1| GE18332 [Drosophila yakuba]
 gi|194174102|gb|EDW87713.1| GE18332 [Drosophila yakuba]
          Length = 1054

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|114625693|ref|XP_001152646.1| PREDICTED: CDC14 homolog B isoform 5 [Pan troglodytes]
          Length = 475

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 158 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 217

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 218 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 271

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 272 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 331

Query: 175 LKTITM 180
            +   +
Sbjct: 332 PQQQFL 337


>gi|24582611|ref|NP_609153.1| cdc14, isoform A [Drosophila melanogaster]
 gi|22945904|gb|AAF52562.2| cdc14, isoform A [Drosophila melanogaster]
          Length = 1052

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|51094654|gb|EAL23905.1| hypothetical protein MGC26484 [Homo sapiens]
          Length = 520

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 224 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 283

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 284 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 337

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 338 IVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 397

Query: 175 LKTITM 180
            +   +
Sbjct: 398 PQQQFL 403


>gi|51094655|gb|EAL23906.1| hypothetical protein MGC26484 [Homo sapiens]
          Length = 554

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 258 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 317

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 318 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 371

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 372 IVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 431

Query: 175 LKTITM 180
            +   +
Sbjct: 432 PQQQFL 437


>gi|119613062|gb|EAW92656.1| hCG32512, isoform CRA_c [Homo sapiens]
          Length = 491

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|168702681|ref|ZP_02734958.1| hypothetical protein GobsU_24351 [Gemmata obscuriglobus UQM 2246]
          Length = 343

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/148 (31%), Positives = 75/148 (50%), Gaps = 1/148 (0%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL-PESWHKEEEKAANDLGIQ 100
            N H V+P  +YR+AQ     +  L  E G+++++NLRG     +W+  E +  +   + 
Sbjct: 47  TNEHTVIPGRVYRTAQLKPEQLRELIAEKGVRTVVNLRGVCTDTAWYLGECRTTHAANVN 106

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
             +   SA R     ++++L+ +L     P++ HC+ GADRTGLAS V + +        
Sbjct: 107 QEDITFSAKRFPAPGEVRRLVEVLDHTAYPIVFHCQRGADRTGLASTVAVLLHTDADLAT 166

Query: 161 AHRQLSMLYGHFPVLKTITMDITFEKIT 188
           A RQL   YGH  V +T  +D  F+   
Sbjct: 167 ARRQLWPRYGHVAVGRTAVLDAFFDYYE 194


>gi|281364580|ref|NP_001162905.1| cdc14, isoform C [Drosophila melanogaster]
 gi|272406935|gb|ACZ94196.1| cdc14, isoform C [Drosophila melanogaster]
          Length = 700

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|269849544|sp|A4D256|CC14C_HUMAN RecName: Full=Dual specificity protein phosphatase CDC14C; AltName:
           Full=CDC14 cell division cycle 14 homolog C
          Length = 554

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 258 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 317

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 318 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 371

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 372 IVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 431

Query: 175 LKTITM 180
            +   +
Sbjct: 432 PQQQFL 437


>gi|55831964|gb|AAV66582.1| protein phosphatase CDC14B [Xenopus laevis]
          Length = 464

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                 +  +           +  Y         +F+ +VP +    + P+         
Sbjct: 144 DCFNAVHKALQYDFFDFKTFDVEEYQHYERAENGDFNWIVPEKFLAFSGPHQKSKMESGY 203

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +I+ L  K     +        D   +  +         +D 
Sbjct: 204 PHHAPEAYFPYFRKHHLTTIIRLNKK----MYDANR--FTDADFEHHDLFFVDGSTPSDA 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ ++I + A   + +HCK+G  RTG     Y+         E    + +   G    
Sbjct: 258 IVKKFLNICENADGAIAVHCKAGLGRTGTLIGCYMMKHYRMTAAETIAWIRICRPGSVIG 317

Query: 175 LKTITM 180
            +   M
Sbjct: 318 PQQQFM 323


>gi|148793101|gb|ABR12627.1| CDC14B isoform [Homo sapiens]
          Length = 485

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|119613061|gb|EAW92655.1| hCG32512, isoform CRA_b [Homo sapiens]
          Length = 477

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|82802746|gb|ABB92424.1| CDC14B2 [Pongo pygmaeus]
          Length = 456

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 178 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 237

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 238 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 291

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K  + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 292 IVKGFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 351

Query: 175 LKTITM 180
            +   +
Sbjct: 352 PQQQFL 357


>gi|281364578|ref|NP_001162904.1| cdc14, isoform B [Drosophila melanogaster]
 gi|54650886|gb|AAV37021.1| GH01148p [Drosophila melanogaster]
 gi|272406934|gb|ACZ94195.1| cdc14, isoform B [Drosophila melanogaster]
          Length = 693

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|109112399|ref|XP_001106436.1| PREDICTED: dual specificity protein phosphatase CDC14B-like isoform
           3 [Macaca mulatta]
          Length = 461

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 144 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 203

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 204 HQHSPETYIQYFKNHSVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 258 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 PQQQFL 323


>gi|126333895|ref|XP_001362632.1| PREDICTED: similar to hCG32512, [Monodelphis domestica]
          Length = 490

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
                 +  I  G L      L  Y         + + ++P        P          
Sbjct: 181 DCFQAVHKAIRYGFLNFEKFDLVEYEHYEKAENGDLNWIIPGRFIAFCGPHPRNRLESGY 240

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K + + +I+ L  K        + +   D G        +     +D 
Sbjct: 241 HYHTPEAYVPYFKRHNVTTIIRLNKK------AYDARRFTDAGFDHHELFFADGSIPSDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ ++I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLNICENAEGVVAVHCKAGLGRTGTLIACYIIKHYRMTVPETIAWIRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQHFL 360


>gi|82802742|gb|ABB92422.1| CDC14B2 [Pan troglodytes]
          Length = 459

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|4502699|ref|NP_003662.1| dual specificity protein phosphatase CDC14B isoform 1 [Homo
           sapiens]
 gi|114625687|ref|XP_001152769.1| PREDICTED: CDC14 homolog B isoform 7 [Pan troglodytes]
 gi|297684894|ref|XP_002820046.1| PREDICTED: dual specificity protein phosphatase CDC14B-like isoform
           2 [Pongo abelii]
 gi|2662463|gb|AAB88293.1| tyrosine phosphatase [Homo sapiens]
 gi|57160683|emb|CAI39617.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|57162206|emb|CAI40537.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|119613064|gb|EAW92658.1| hCG32512, isoform CRA_e [Homo sapiens]
          Length = 459

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|194765665|ref|XP_001964947.1| GF22838 [Drosophila ananassae]
 gi|190617557|gb|EDV33081.1| GF22838 [Drosophila ananassae]
          Length = 1052

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAVHKGLQAGFFNFDDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFTYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AILKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|170044330|ref|XP_001849805.1| phosphatase [Culex quinquefasciatus]
 gi|167867522|gb|EDS30905.1| phosphatase [Culex quinquefasciatus]
          Length = 746

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 29/186 (15%), Positives = 57/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             +      +  G           Y         +F+ +VP +      P+         
Sbjct: 148 DCIHAIARALEAGFFSFDDFDSQQYEHFERVENGDFNWIVPDKFLAFCGPHSKSRLDNGY 207

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +I+ L  K+       +       G    +         ND 
Sbjct: 208 PIHAPETYFEYFRKHNVTTIIRLNVKI------YDAARFTSAGFTHHDLFFVDGSTPNDA 261

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ ++I + A   + +HCK+G  RTG     YL    ++   EA   L +   G    
Sbjct: 262 ILKKFLTICEQADGGIAVHCKAGLGRTGTLIGAYLIKHYNFSALEAIAWLRLCRPGSVIG 321

Query: 175 LKTITM 180
            +   M
Sbjct: 322 HQQQWM 327


>gi|297680446|ref|XP_002818002.1| PREDICTED: dual specificity protein phosphatase CDC14C-like [Pongo
           abelii]
          Length = 484

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K  + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKGFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|195339011|ref|XP_002036115.1| GM13298 [Drosophila sechellia]
 gi|194129995|gb|EDW52038.1| GM13298 [Drosophila sechellia]
          Length = 985

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|297288334|ref|XP_001083391.2| PREDICTED: dual specificity protein phosphatase CDC14C-like [Macaca
           mulatta]
          Length = 484

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSA------------ 56
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRTRLESGY 240

Query: 57  -QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 PQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFMDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKKFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHFRMTAAETIAWVRICRPGLVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|195577383|ref|XP_002078550.1| GD22466 [Drosophila simulans]
 gi|194190559|gb|EDX04135.1| GD22466 [Drosophila simulans]
          Length = 1039

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 57/187 (30%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|119581390|gb|EAW60986.1| hCG2003284 [Homo sapiens]
          Length = 301

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 57/190 (30%), Gaps = 20/190 (10%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS--------- 55
             P          +  G L   + +L  Y         + + ++P               
Sbjct: 1   PLPVSCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWLIPDRFIAFCGPHSRARL 60

Query: 56  ----AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
                Q +        K + + +I+ L  ++       + K   D G    +   +    
Sbjct: 61  ESGYHQHSPETYIQYFKNHNVTTIIRLNKRI------YDAKRFTDAGFDHHDLFFADGST 114

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYG 170
             D  +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G
Sbjct: 115 PTDAIVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPG 174

Query: 171 HFPVLKTITM 180
                +   +
Sbjct: 175 LVIGPQQQFL 184


>gi|147903213|ref|NP_001084486.1| CDC14 cell division cycle 14 homolog B [Xenopus laevis]
 gi|42651865|gb|AAS22334.1| cell division cycle 14 beta protein [Xenopus laevis]
 gi|51703466|gb|AAH81026.1| CDC14beta protein [Xenopus laevis]
          Length = 452

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                 +  +           +  Y         +F+ +VP +    + P+         
Sbjct: 144 DCFNAVHKALQYDFFDFKTFDVEEYQHYERAENGDFNWIVPEKFLAFSGPHQKSKMESGY 203

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +I+ L  K     +        D   +  +         +D 
Sbjct: 204 PHHAPEAYFPYFRKHHLTTIIRLNKK----MYDANR--FTDADFEHHDLFFVDGSTPSDA 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ ++I + A   + +HCK+G  RTG     Y+         E    + +   G    
Sbjct: 258 IVKKFLNICENADGAIAVHCKAGLGRTGTLIGCYMMKHYRMTAAETIAWIRICRPGSVIG 317

Query: 175 LKTITM 180
            +   M
Sbjct: 318 PQQQFM 323


>gi|300794713|ref|NP_001180167.1| dual specificity protein phosphatase CDC14B [Bos taurus]
          Length = 498

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         + + ++P                   
Sbjct: 181 DCFYAVKKAMQYGFFNFNSFNLDEYEYYEKAENGDLNWIIPDRFLAFCGPHSRTRLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +++ L  ++       + K   + G    +   +      D 
Sbjct: 241 HQHSPEAYIPYFKNHNVTTVIRLNKRM------YDAKRFTNAGFDHYDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTATETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|57160685|emb|CAI39619.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|57162208|emb|CAI40539.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
          Length = 455

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 151 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 210

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 211 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 264

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 265 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 324

Query: 175 LKTITM 180
            +   +
Sbjct: 325 PQQQFL 330


>gi|260815501|ref|XP_002602511.1| hypothetical protein BRAFLDRAFT_60600 [Branchiostoma floridae]
 gi|229287822|gb|EEN58523.1| hypothetical protein BRAFLDRAFT_60600 [Branchiostoma floridae]
          Length = 325

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 60/186 (32%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      +  G +      +  Y         +F+ +VP++    + P+         
Sbjct: 144 DCLHGIDKALQNGFINFETFDVDEYEHYEKVENGDFNWIVPNKFLAFSGPHPKSKIENGY 203

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ + +I+ L  K+       + +   D G    +         +D 
Sbjct: 204 PLHAPEAYFPYFRKHNVTTIIRLNKKI------YDARRFTDAGFDHYDLFFVDGSTPSDS 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ I I + A   + +HCK+G  RTG     Y+     +   E    + +   G    
Sbjct: 258 IVRRFIQICENAEGAIAVHCKAGLGRTGTLIGCYMMKHFRFTAGECISYIRICRPGSIIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 PQQHWL 323


>gi|194224681|ref|XP_001916096.1| PREDICTED: CDC14 cell division cycle 14 homolog B (S. cerevisiae)
           [Equus caballus]
          Length = 469

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 152 DCFYAVKKAMHYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFLAFCGPHSRTRLESGY 211

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K     G    +   +      D 
Sbjct: 212 HQHSPEAYIPYFKNHNVTTIVRLNKRM------YDAKRFTSAGFDHYDLFFADGSTPTDA 265

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 266 IVKEFLDICENAEGAVAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 325

Query: 175 LKTITM 180
            +   +
Sbjct: 326 PQQQFL 331


>gi|297478144|ref|XP_002689878.1| PREDICTED: CDC14 cell division cycle 14 homolog B (S. cerevisiae)
           [Bos taurus]
 gi|296484491|gb|DAA26606.1| CDC14 cell division cycle 14 homolog B [Bos taurus]
          Length = 501

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G     + +L  Y         + + ++P                   
Sbjct: 184 DCFYAVKKAMQYGFFNFNSFNLDEYEYYEKAENGDLNWIIPDRFLAFCGPHSRTRLESGY 243

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +++ L  ++       + K   + G    +   +      D 
Sbjct: 244 HQHSPEAYIPYFKNHNVTTVIRLNKRM------YDAKRFTNAGFDHYDLFFADGSTPTDA 297

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 298 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTATETIAWVRICRPGSVIG 357

Query: 175 LKTITM 180
            +   +
Sbjct: 358 PQQQFL 363


>gi|114625679|ref|XP_001152257.1| PREDICTED: CDC14 homolog B isoform 1 [Pan troglodytes]
 gi|5706724|gb|AAC16662.2| Cdc14B3 phosphatase [Homo sapiens]
 gi|50234991|gb|AAT70726.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
 gi|119613060|gb|EAW92654.1| hCG32512, isoform CRA_a [Homo sapiens]
          Length = 471

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|296189505|ref|XP_002742803.1| PREDICTED: dual specificity protein phosphatase CDC14B [Callithrix
           jacchus]
          Length = 461

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 144 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRSRLESGY 203

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 204 HQHSPDTYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPADA 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 258 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 PQQQFL 323


>gi|82802744|gb|ABB92423.1| CDC14B2 [Gorilla gorilla]
          Length = 459

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|195118469|ref|XP_002003759.1| GI18084 [Drosophila mojavensis]
 gi|193914334|gb|EDW13201.1| GI18084 [Drosophila mojavensis]
          Length = 1117

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 59/187 (31%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G L         Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAIHKSLQAGFLNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G +  +         +D
Sbjct: 209 YPCHAPERYFTYFRDNNVTTVIRLNAKV------YHASSFENAGFEHRDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 TILKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|332865187|ref|XP_003318471.1| PREDICTED: dual specificity protein phosphatase CDC14C-like isoform
           1 [Pan troglodytes]
          Length = 447

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 151 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 210

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 211 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 264

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 265 IVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 324

Query: 175 LKTITM 180
            +   +
Sbjct: 325 PQQQFL 330


>gi|82802740|gb|ABB92421.1| CDC14B2 [Homo sapiens]
          Length = 459

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 181 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 240

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 241 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 294

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 295 IVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 354

Query: 175 LKTITM 180
            +   +
Sbjct: 355 PQQQFL 360


>gi|195385928|ref|XP_002051656.1| GJ16755 [Drosophila virilis]
 gi|194148113|gb|EDW63811.1| GJ16755 [Drosophila virilis]
          Length = 709

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 29/187 (15%), Positives = 58/187 (31%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +  +  G L         Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAIHKGLQAGFLNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFSYFRDNNVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AILKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFSALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|166226979|sp|A6N3Q4|CC14C_HYLSY RecName: Full=Dual specificity protein phosphatase CDC14C; AltName:
           Full=CDC14 cell division cycle 14 homolog C
 gi|148763625|gb|ABR10606.1| CDC14Bretro [Symphalangus syndactylus]
          Length = 483

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 28/186 (15%), Positives = 54/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 180 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 239

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K   + +I+ L  K+       + K   D G    +   +      D 
Sbjct: 240 HQHSPETYIQYFKNRNVTTIIRLNKKM------YDAKCFTDAGFDHHDLFFADGSSPTDA 293

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K  + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 294 IVKGFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGLVIG 353

Query: 175 LKTITM 180
            +   +
Sbjct: 354 PQQQFL 359


>gi|308493241|ref|XP_003108810.1| CRE-CDC-14 protein [Caenorhabditis remanei]
 gi|308247367|gb|EFO91319.1| CRE-CDC-14 protein [Caenorhabditis remanei]
          Length = 767

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 54/183 (29%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      +  G L         Y         +F+ ++P +I     P          
Sbjct: 166 DVLRGIEKALKFGWLDFTNFDHEEYEHYERVENGDFNWIIPGKILSFCGPHNESREENGY 225

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
              +         +  + +I+ L  K        +       G   ++         +DE
Sbjct: 226 PYHSPEVYFEYFHKTKVSTIVRLNAKN------YDASKFTRAGFDHVDLFFVDGSTPSDE 279

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I+++  A   + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 280 IMLKFINVVDNAKGGVAVHCKAGLGRTGTLIACWMMKEFGLTAGECMGWLRVCRPGSVIG 339

Query: 175 LKT 177
            + 
Sbjct: 340 PQQ 342


>gi|301786697|ref|XP_002928762.1| PREDICTED: dual specificity protein phosphatase CDC14B-like
           [Ailuropoda melanoleuca]
          Length = 461

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +    L   + +L  Y         + + ++P                   
Sbjct: 144 DCFHAVKKAMQYDFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRTKLESGY 203

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   + G    +   +      D 
Sbjct: 204 HQHSPEAYIPYFKNHNVTTIIRLNKRM------YDAKRFTNAGFDHYDLFFADGSTPTDA 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 258 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 317

Query: 175 LKTITM 180
            +   +
Sbjct: 318 PQQQFL 323


>gi|307188173|gb|EFN73005.1| Dual specificity protein phosphatase CDC14A [Camponotus floridanus]
          Length = 669

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 59/209 (28%), Gaps = 20/209 (9%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN-------- 59
           +  L   Y    LG        +  Y         + + +VP +      P+        
Sbjct: 147 KDCLSAIYKCHQLGFFNFEDFCVKEYEHFERVENGDLNWIVPGKFIAFCGPHARSKMEDG 206

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        +   + +I+ L  K+       +  +  D G    +          D
Sbjct: 207 YPLHGPESYFTYFRRNNVTTIVRLNKKV------YDASSFTDAGFIHKDLFFMDGSTPTD 260

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             + Q + I + A   + IHCK+G  RTG     Y+    H    E    + +   G   
Sbjct: 261 SIMHQFLKIAENANGAVAIHCKAGLGRTGSLIGCYIMKHYHLTAHETIAWIRICRPGSVI 320

Query: 174 VLKTITMDITFEKITQLYPNNVSKGDTEQ 202
             +   ++     +  L    +   +   
Sbjct: 321 GHQQQWLEKKESYLRSLLKEPLQLENRNS 349


>gi|322798632|gb|EFZ20236.1| hypothetical protein SINV_09194 [Solenopsis invicta]
          Length = 579

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 59/206 (28%), Gaps = 20/206 (9%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN-------- 59
           +  L   Y    LG        +  Y         + + VVP +      P+        
Sbjct: 147 KDCLSAIYKCHQLGFFNFEDFCVNEYEHFERVENGDLNWVVPGKFIAFCGPHARSKMEDG 206

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                  +         + +I+ L  K+       +  +  D G    +          D
Sbjct: 207 YPLHGPEWYFTYFHRNNVTTIVRLNKKV------YDASSFTDAGFIHKDLFFMDGSTPTD 260

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             + Q + I + A   + +HCK+G  RTG     Y+    H    E    + +   G   
Sbjct: 261 AIMHQFLKIAENASGAVAVHCKAGLGRTGSLIGCYIMKHYHLTAHETIAWIRICRPGSVI 320

Query: 174 VLKTITMDITFEKITQLYPNNVSKGD 199
             +   ++     +  L    +   +
Sbjct: 321 GHQQQWLERKEAYLRSLLKEPLQPEN 346


>gi|73946378|ref|XP_533499.2| PREDICTED: similar to CDC14 homolog B isoform 3 [Canis familiaris]
          Length = 653

 Score =  124 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +   +L   + +L  Y         + + ++P                   
Sbjct: 363 DCFHAVKKAMQYDLLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRTRLESGY 422

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   + G    +   +      D 
Sbjct: 423 HQHSPEAYIPYFKNHNVSTIIRLNKRM------YDAKRFTNAGFDHYDLFFADGSTPTDA 476

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A YL         E    + +   G    
Sbjct: 477 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYLMKHYRMTAAETIAWVRICRPGSVIG 536

Query: 175 LKTITM 180
            +   +
Sbjct: 537 PQQQFL 542


>gi|167527428|ref|XP_001748046.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163773464|gb|EDQ87103.1| predicted protein [Monosiga brevicollis MX1]
          Length = 711

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 68/214 (31%), Gaps = 21/214 (9%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN-------- 59
           R  +   Y  +L G + +    L  Y         +F  ++P++    A P+        
Sbjct: 384 RYVISGAYQALLNGFIDVHTFDLDTYDHFERVENGDFTTIIPNKFIALAGPHNTRHVDDG 443

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                   +    +  G+  I+ L  K+       +       G    +           
Sbjct: 444 YTHLAPENLFEPFRRLGVTDIVRLNKKM------YDRTKFTQAGFAHHDLFFIDGTCPPP 497

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             ++  + I +      ++HCK+G  RTG     Y+     +   E    L +   G   
Sbjct: 498 AILESFLEITEKCTGTAVVHCKAGLGRTGSLIGCYMMKHYRFNAPETIAWLRIARPGSVI 557

Query: 174 VL-KTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
              +T  ++   +      P    KG+ ++P+ A
Sbjct: 558 GPQQTYLVNHQADMWLASPPTAKRKGEADRPLAA 591


>gi|119613066|gb|EAW92660.1| hCG32512, isoform CRA_g [Homo sapiens]
          Length = 450

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/180 (15%), Positives = 57/180 (31%), Gaps = 20/180 (11%)

Query: 15  YIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS-------------AQPNGT 61
            + +  G L   + +L  Y         + + ++P                    Q +  
Sbjct: 179 LLAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPE 238

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
                 K + + +I+ L  ++       + K   D G    +   +      D  +K+ +
Sbjct: 239 TYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL 292

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
            I + A   + +HCK+G  RTG   A Y+         E    + +   G     +   +
Sbjct: 293 DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFL 352


>gi|156548058|ref|XP_001606041.1| PREDICTED: similar to CDC14A [Nasonia vitripennis]
          Length = 372

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/187 (14%), Positives = 56/187 (29%), Gaps = 20/187 (10%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN-------- 59
           +  L   Y    LG       +L  Y         + + ++P +      P+        
Sbjct: 190 QDCLSAIYKCHQLGFFDFHDFNLKEYEHFERVENGDLNWILPGKFIAFCGPHSNNQFEFG 249

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        + + + +I+ L  K        +  +  + G    +           
Sbjct: 250 YMLHAPESYFKYFRRHNVTTIVRLNKKR------YDAASFVEAGFDHKDLFFVDGSPPTL 303

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             ++Q + I +     + +HCK+G  RTG   A Y+    H    EA   + +   G   
Sbjct: 304 SIVRQFLKISEKTNGAVAVHCKAGLGRTGTLIACYIMKHYHLSALEAIAWIRICRPGSVI 363

Query: 174 VLKTITM 180
             +   +
Sbjct: 364 GHQQQWL 370


>gi|281344907|gb|EFB20491.1| hypothetical protein PANDA_018800 [Ailuropoda melanoleuca]
          Length = 435

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 25/186 (13%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +    L   + +L  Y         + + ++P                   
Sbjct: 130 DCFHAVKKAMQYDFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRTKLESGY 189

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   + G    +   +      D 
Sbjct: 190 HQHSPEAYIPYFKNHNVTTIIRLNKRM------YDAKRFTNAGFDHYDLFFADGSTPTDA 243

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 244 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 303

Query: 175 LKTITM 180
            +   +
Sbjct: 304 PQQQFL 309


>gi|325119774|emb|CBZ55327.1| putative dual specificity protein phosphatase CDC14A [Neospora
           caninum Liverpool]
          Length = 502

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/212 (14%), Positives = 67/212 (31%), Gaps = 26/212 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      + LG       ++  Y         + + ++P+ I   + P          
Sbjct: 152 DCLKGLEFAMKLGWFDYKTFNVDEYDYYEKLKNGDMNWIIPNRILAFSCPSSATGNHDGY 211

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     +    GIK+++ L  K      + + +   D  I+ ++         + E
Sbjct: 212 TTCTPEDYVDIFNRMGIKTVIRLNKK------QYDARKFTDRNIEHVDLFFVDGTCPSRE 265

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM----LYGH 171
            I+  + +++    P+ +HCK+G  RTG     Y      +P   A   +        G 
Sbjct: 266 IIQAFLQVVENRDHPIAVHCKAGLGRTGTLIGCYAVKNFKFP---AVEWIGWNRLCRPGS 322

Query: 172 FPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
               +   +     ++ Q+   N  +     P
Sbjct: 323 ILGPQQQFLTEIQHELLQMTRENSLRTRRIHP 354


>gi|34811073|pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14
 gi|34811074|pdb|1OHD|A Chain A, Structure Of Cdc14 In Complex With Tungstate
          Length = 348

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 143 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 202

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 203 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 257 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 316

Query: 175 LKTITM 180
            +   +
Sbjct: 317 PQQQFL 322


>gi|25147869|ref|NP_740991.1| Cell Division Cycle related family member (cdc-14) [Caenorhabditis
           elegans]
 gi|21450595|gb|AAM54206.1|U28739_7 Cell division cycle related protein 14, isoform d [Caenorhabditis
           elegans]
 gi|50313195|gb|AAT74545.1| CDC-14 phosphatase isoform D [Caenorhabditis elegans]
          Length = 695

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 53/183 (28%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ ++P +I     P+         
Sbjct: 162 DVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGY 221

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 222 PYHAPDVYFDYFRENKVSTIVRLNAKN------YDASKFTKAGFDHVDLFFIDGSTPSDE 275

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++      + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 276 IMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIG 335

Query: 175 LKT 177
            + 
Sbjct: 336 PQQ 338



 Score = 38.9 bits (89), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 45/131 (34%), Gaps = 23/131 (17%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            ++P+ +Y    PN   I+   K       +N+  K                     +F 
Sbjct: 19  ELLPNRLYFGCFPNPDAIDKSDKSVKKTCFININNKFHYEPF-------------YEDFG 65

Query: 106 LSATRELNDEQIK--QLISILKTAPKPLLIHCKS-GADR-------TGLASAVYLYIVAH 155
                 L    ++  +L+ + +   + +++ C+  G  +       T      YL I   
Sbjct: 66  PWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQG 125

Query: 156 YPKEEAHRQLS 166
           +  ++A+ ++S
Sbjct: 126 FSADDAYLKVS 136


>gi|25147862|ref|NP_495085.2| Cell Division Cycle related family member (cdc-14) [Caenorhabditis
           elegans]
 gi|21450594|gb|AAM54205.1|U28739_4 Cell division cycle related protein 14, isoform a [Caenorhabditis
           elegans]
 gi|50313189|gb|AAT74542.1| CDC-14 phosphatase isoform A [Caenorhabditis elegans]
          Length = 693

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 53/183 (28%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ ++P +I     P+         
Sbjct: 162 DVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGY 221

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 222 PYHAPDVYFDYFRENKVSTIVRLNAKN------YDASKFTKAGFDHVDLFFIDGSTPSDE 275

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++      + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 276 IMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIG 335

Query: 175 LKT 177
            + 
Sbjct: 336 PQQ 338



 Score = 38.9 bits (89), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 45/131 (34%), Gaps = 23/131 (17%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            ++P+ +Y    PN   I+   K       +N+  K                     +F 
Sbjct: 19  ELLPNRLYFGCFPNPDAIDKSDKSVKKTCFININNKFHYEPF-------------YEDFG 65

Query: 106 LSATRELNDEQIK--QLISILKTAPKPLLIHCKS-GADR-------TGLASAVYLYIVAH 155
                 L    ++  +L+ + +   + +++ C+  G  +       T      YL I   
Sbjct: 66  PWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQG 125

Query: 156 YPKEEAHRQLS 166
           +  ++A+ ++S
Sbjct: 126 FSADDAYLKVS 136


>gi|7496224|pir||T34098 hypothetical protein C17G10.4a - Caenorhabditis elegans
          Length = 708

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 53/183 (28%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ ++P +I     P+         
Sbjct: 162 DVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGY 221

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 222 PYHAPDVYFDYFRENKVSTIVRLNAKN------YDASKFTKAGFDHVDLFFIDGSTPSDE 275

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++      + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 276 IMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIG 335

Query: 175 LKT 177
            + 
Sbjct: 336 PQQ 338



 Score = 38.9 bits (89), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 45/131 (34%), Gaps = 23/131 (17%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            ++P+ +Y    PN   I+   K       +N+  K                     +F 
Sbjct: 19  ELLPNRLYFGCFPNPDAIDKSDKSVKKTCFININNKFHYEPF-------------YEDFG 65

Query: 106 LSATRELNDEQIK--QLISILKTAPKPLLIHCKS-GADR-------TGLASAVYLYIVAH 155
                 L    ++  +L+ + +   + +++ C+  G  +       T      YL I   
Sbjct: 66  PWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQG 125

Query: 156 YPKEEAHRQLS 166
           +  ++A+ ++S
Sbjct: 126 FSADDAYLKVS 136


>gi|310816645|ref|YP_003964609.1| protein tyrosine/serine phosphatase [Ketogulonicigenium vulgare
           Y25]
 gi|308755380|gb|ADO43309.1| protein tyrosine/serine phosphatase [Ketogulonicigenium vulgare
           Y25]
          Length = 205

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 53/183 (28%), Positives = 85/183 (46%), Gaps = 6/183 (3%)

Query: 21  GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG 80
           G        L L    +     N   V    ++RS       +    ++ GIK+IL LRG
Sbjct: 12  GWRDTLDF-LFLDHAVLRYTWCNQAKVCDD-VWRSNHAGFGRLRR-LRDQGIKAILTLRG 68

Query: 81  KLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGAD 140
             P + ++ E  A + LG+ L +  L A R    +++ +L +  +  P+P L+HCKSGAD
Sbjct: 69  SSPSAANRFEAAACHTLGLHLYSVSLEARRAPKRDEVLRLFNTFRALPRPFLMHCKSGAD 128

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKIT---QLYPNNVSK 197
           R GLA A+YL  +     E+A +QLS+ Y H    +T  +D   +      + YP  + +
Sbjct: 129 RAGLAGALYLLGMQGATIEQARKQLSLRYLHIRASQTGVLDHVLDLYENDFRRYPIGIEE 188

Query: 198 GDT 200
              
Sbjct: 189 WFA 191


>gi|71982346|ref|NP_001021969.1| Cell Division Cycle related family member (cdc-14) [Caenorhabditis
           elegans]
 gi|50058074|gb|AAT68903.1| Cell division cycle related protein 14, isoform e [Caenorhabditis
           elegans]
 gi|50313197|gb|AAT74546.1| CDC-14 phosphatase isoform E [Caenorhabditis elegans]
          Length = 707

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 53/183 (28%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ ++P +I     P+         
Sbjct: 162 DVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGY 221

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 222 PYHAPDVYFDYFRENKVSTIVRLNAKN------YDASKFTKAGFDHVDLFFIDGSTPSDE 275

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++      + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 276 IMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIG 335

Query: 175 LKT 177
            + 
Sbjct: 336 PQQ 338



 Score = 38.9 bits (89), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 45/131 (34%), Gaps = 23/131 (17%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            ++P+ +Y    PN   I+   K       +N+  K                     +F 
Sbjct: 19  ELLPNRLYFGCFPNPDAIDKSDKSVKKTCFININNKFHYEPF-------------YEDFG 65

Query: 106 LSATRELNDEQIK--QLISILKTAPKPLLIHCKS-GADR-------TGLASAVYLYIVAH 155
                 L    ++  +L+ + +   + +++ C+  G  +       T      YL I   
Sbjct: 66  PWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQG 125

Query: 156 YPKEEAHRQLS 166
           +  ++A+ ++S
Sbjct: 126 FSADDAYLKVS 136


>gi|298292204|ref|YP_003694143.1| protein tyrosine/serine phosphatase [Starkeya novella DSM 506]
 gi|296928715|gb|ADH89524.1| protein tyrosine/serine phosphatase [Starkeya novella DSM 506]
          Length = 191

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 70/181 (38%), Positives = 104/181 (57%), Gaps = 4/181 (2%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
            L  + + L   L    V +GLY         N H VV  E+YRSA  +   ++ + +  
Sbjct: 4   RLNIWRRWLTRGLAGGLVLVGLY-AGWAYANGNLHTVVEGELYRSATLSSAQLQEVIESR 62

Query: 71  GIKSILNLRGKLPES-WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK 129
           GI++I+NLRG+   S W++EE + A +  ++LI+ P  A+REL D Q+     +L  AP+
Sbjct: 63  GIRTIVNLRGRNAYSAWYREEARVAAETNVKLIDLPWLASRELTDAQVAAFFEVLADAPR 122

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF--PVLKTITMDITFEKI 187
           P+LIHC+SGADRTGLA+A+YL  +    +  A  QLS+L+GH   P      MD TFE++
Sbjct: 123 PILIHCRSGADRTGLAAALYLAAIKKVDEFTAELQLSLLFGHISLPFAPFYAMDETFERL 182

Query: 188 T 188
            
Sbjct: 183 E 183


>gi|17531941|ref|NP_495086.1| Cell Division Cycle related family member (cdc-14) [Caenorhabditis
           elegans]
 gi|2731379|gb|AAB93458.1| Cell division cycle related protein 14, isoform c [Caenorhabditis
           elegans]
 gi|2738258|gb|AAB94407.1| protein phosphatase CDC14 [Caenorhabditis elegans]
 gi|50313193|gb|AAT74544.1| CDC-14 phosphatase isoform C [Caenorhabditis elegans]
          Length = 681

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 53/183 (28%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ ++P +I     P+         
Sbjct: 162 DVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGY 221

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 222 PYHAPDVYFDYFRENKVSTIVRLNAKN------YDASKFTKAGFDHVDLFFIDGSTPSDE 275

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++      + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 276 IMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIG 335

Query: 175 LKT 177
            + 
Sbjct: 336 PQQ 338



 Score = 38.9 bits (89), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 45/131 (34%), Gaps = 23/131 (17%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            ++P+ +Y    PN   I+   K       +N+  K                     +F 
Sbjct: 19  ELLPNRLYFGCFPNPDAIDKSDKSVKKTCFININNKFHYEPF-------------YEDFG 65

Query: 106 LSATRELNDEQIK--QLISILKTAPKPLLIHCKS-GADR-------TGLASAVYLYIVAH 155
                 L    ++  +L+ + +   + +++ C+  G  +       T      YL I   
Sbjct: 66  PWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQG 125

Query: 156 YPKEEAHRQLS 166
           +  ++A+ ++S
Sbjct: 126 FSADDAYLKVS 136


>gi|71982332|ref|NP_495084.3| Cell Division Cycle related family member (cdc-14) [Caenorhabditis
           elegans]
 gi|30315908|sp|P81299|CDC14_CAEEL RecName: Full=Probable tyrosine-protein phosphatase cdc-14;
           AltName: Full=Cell division cycle-related protein 14
 gi|2731380|gb|AAB93459.1| Cell division cycle related protein 14, isoform b [Caenorhabditis
           elegans]
 gi|50313191|gb|AAT74543.1| CDC-14 phosphatase isoform B [Caenorhabditis elegans]
          Length = 1063

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 53/183 (28%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ ++P +I     P+         
Sbjct: 162 DVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGY 221

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 222 PYHAPDVYFDYFRENKVSTIVRLNAKN------YDASKFTKAGFDHVDLFFIDGSTPSDE 275

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++      + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 276 IMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIG 335

Query: 175 LKT 177
            + 
Sbjct: 336 PQQ 338



 Score = 38.9 bits (89), Expect = 0.44,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 45/131 (34%), Gaps = 23/131 (17%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            ++P+ +Y    PN   I+   K       +N+  K                     +F 
Sbjct: 19  ELLPNRLYFGCFPNPDAIDKSDKSVKKTCFININNKFHYEPF-------------YEDFG 65

Query: 106 LSATRELNDEQIK--QLISILKTAPKPLLIHCKS-GADR-------TGLASAVYLYIVAH 155
                 L    ++  +L+ + +   + +++ C+  G  +       T      YL I   
Sbjct: 66  PWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQG 125

Query: 156 YPKEEAHRQLS 166
           +  ++A+ ++S
Sbjct: 126 FSADDAYLKVS 136


>gi|221127911|ref|XP_002162225.1| PREDICTED: similar to CDC14 homolog A [Hydra magnipapillata]
          Length = 376

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 58/182 (31%), Gaps = 20/182 (10%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSA-------------QPN 59
                I  G L         Y         +F+ ++P +    A             Q  
Sbjct: 148 GVKKGIQHGFLDFEHFDPMEYEHYERVENGDFNWILPGKFLALAGPHEETKIFNGYPQHA 207

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
                   +++ +K+I+ L  K+       + K   + G    +         +D  +++
Sbjct: 208 PESYFAYFRKHNVKAIVRLNKKV------YDAKRFQNAGFDHYDLFFVDGSIPDDSIVRR 261

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
             +I +     + +HCK+G  RTG   A Y+     +   +A   + +   G     +  
Sbjct: 262 FNAIAENTKGAVAVHCKAGLGRTGTLIACYIMKHYRFTAAQAIAWIRLCRPGSIIGPQQH 321

Query: 179 TM 180
            +
Sbjct: 322 FL 323


>gi|195434338|ref|XP_002065160.1| GK15301 [Drosophila willistoni]
 gi|194161245|gb|EDW76146.1| GK15301 [Drosophila willistoni]
          Length = 1109

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 56/187 (29%), Gaps = 21/187 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +     G           Y         +F+ +VP +      P+         
Sbjct: 149 DCLNAIHKAQQCGFFNFDDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        ++  + +++ L  K+          +  + G    +         +D
Sbjct: 209 YPCHAPERYFTYFRDNSVTTVIRLNAKV------YHASSFENAGFDHKDLFFIDGSTPSD 262

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             +K+ +SI +T    + +HCK+G  RTG     Y+     +   EA   L +   G   
Sbjct: 263 AILKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYMMKHYGFSALEAIAWLRLCRPGSVI 322

Query: 174 VLKTITM 180
             +   M
Sbjct: 323 GHQQQWM 329


>gi|332017862|gb|EGI58522.1| Dual specificity protein phosphatase CDC14A [Acromyrmex echinatior]
          Length = 604

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 60/206 (29%), Gaps = 20/206 (9%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN-------- 59
           R  L   Y    LG        +  Y         + + +VP +      P+        
Sbjct: 148 RDCLSAIYKCHRLGFFNFEDFCVKEYEHFERVENGDLNWIVPGKFIAFCGPHARSKMEDG 207

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                  +     +   + +I+ L  K+       +  +  D G    +          D
Sbjct: 208 YPLHGPEWYFTYFRRNNVTTIIRLNKKV------YDAASFTDAGFIHKDLFFMDGSTPTD 261

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             + Q + I + A   + +HCK+G  RTG     Y+    H    E    + +   G   
Sbjct: 262 AIMHQFLKIAENASGAVAVHCKAGLGRTGSLIGCYIMKHYHLTAHETIAWIRICRPGSVI 321

Query: 174 VLKTITMDITFEKITQLYPNNVSKGD 199
             +   ++     +  L    +   +
Sbjct: 322 GHQQQWLERKEMYLRSLLKEPLQSEN 347


>gi|158288754|ref|XP_310601.4| AGAP000492-PA [Anopheles gambiae str. PEST]
 gi|157018722|gb|EAA06425.4| AGAP000492-PA [Anopheles gambiae str. PEST]
          Length = 365

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/221 (14%), Positives = 66/221 (29%), Gaps = 29/221 (13%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN-- 59
           ++    +                        Y         + + +VP +      P+  
Sbjct: 111 LRYLSLKDCFGGVLKAHQRNFFNFQDFDHAAYEHYERVDNGDLNWIVPGKFLAFCGPHCQ 170

Query: 60  -----------GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
                              +   + +++ L  +      K + KA  + G Q  +     
Sbjct: 171 THVANGVAVLGPDAYLEYFRRNHVTTVVRLNMR------KYDAKAFTEAGFQHHDLIFPD 224

Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM- 167
               +D+ ++Q + I ++    + +HCK+G  RTG     YL     +   EA   L + 
Sbjct: 225 GSNPDDDILQQFLKICESTGGAVAVHCKAGLGRTGTLIGAYLIKHYRFTAAEAIAWLRVC 284

Query: 168 --------LYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
                           +T  ++   +   Q YPN+  +  T
Sbjct: 285 RPGSVIGQQQLWLKTKQTELLNAGNQ-FRQYYPNHTPERHT 324


>gi|156376370|ref|XP_001630334.1| predicted protein [Nematostella vectensis]
 gi|156217352|gb|EDO38271.1| predicted protein [Nematostella vectensis]
          Length = 329

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 61/185 (32%), Gaps = 20/185 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +      L    +  Y         +F+ +VP +    + P+         
Sbjct: 129 DVLSGLQKALQNDFFNLDTFDVHEYEYYERVENGDFNWIVPGKFLAFSGPHNKSRIKDGY 188

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ I +++ L  K        + +   D GI+  +         +D 
Sbjct: 189 PLHAPEAYIPYFKKHNISTVVRLNKK------LYDAQRFTDHGIEHYDLFFIDGSVPSDM 242

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ ++I + A   + IHCK+G  RTG   A YL     +   E+   L +   G    
Sbjct: 243 IVRRFLTIAENAKGGIAIHCKAGLGRTGTLIACYLMKHYRFTAAESIGWLRVCRPGSIIG 302

Query: 175 LKTIT 179
            +   
Sbjct: 303 PQQNF 307


>gi|324509209|gb|ADY43876.1| Tyrosine-protein phosphatase cdc-14 [Ascaris suum]
          Length = 538

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 62/184 (33%), Gaps = 20/184 (10%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN----------- 59
           L      + L  +         Y         +F+ ++P ++     P+           
Sbjct: 147 LRGVEKALKLKWVSFENFDPDEYEFYERVENGDFNWIIPGKVLSFCGPHNKSIVENGYPY 206

Query: 60  --GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
                     + + + +I+ L  ++       + K   D G   I+         +DE +
Sbjct: 207 HAPEVYFDYFRRHNVSTIIRLNKRM------YDAKRFVDAGFDHIDLFFVDGSTPSDEIV 260

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLK 176
           ++ I+++ +A   + +HCK+G  RTG   A ++         E+   L +   G     +
Sbjct: 261 QRFINVIDSAKGAVAVHCKAGLGRTGTLIACWMMKEYGVTAAESMAWLRICRPGSVIGPQ 320

Query: 177 TITM 180
              +
Sbjct: 321 QQFL 324


>gi|156843057|ref|XP_001644598.1| hypothetical protein Kpol_1003p45 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115244|gb|EDO16740.1| hypothetical protein Kpol_1003p45 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 280

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 45/169 (26%), Positives = 69/169 (40%), Gaps = 15/169 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  EIYRS+ P      YL+ +  +KSIL L   +PE +  E  +     GI+L 
Sbjct: 120 NFSHVV-GEIYRSSFPRIENFPYLQNQLKLKSILVL---IPEEYPPENLEFLEKSGIRLY 175

Query: 103 NFPLSATRELNDEQIKQLI-----SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E        L+      ++     P+LIHC  G  RTG        +  ++ 
Sbjct: 176 QVGMSGNKEPFVNIPSDLLTKALEIVINPENHPILIHCNRGKHRTGCLIGCIRKL-QNWS 234

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPMN 205
                  +   Y  F   K   +D  F E    +Y   V++ +T  P+ 
Sbjct: 235 ----LTMIFDEYRRFAFPKARALDQQFIELYDDIYIKKVAEKNTWLPLQ 279


>gi|268531260|ref|XP_002630756.1| Hypothetical protein CBG02450 [Caenorhabditis briggsae]
          Length = 657

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 55/183 (30%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ +VP +I     P+         
Sbjct: 144 DVLRGIEKALRFGWLDFSDFDYEEYEFYERVENGDFNWIVPGKILSFCGPHNESREENGY 203

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 204 PYHAPDVYFDYFREKKVSTIVRLNAKN------YDAAKFTKAGFDHVDLFFVDGSTPSDE 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++ +A   + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 258 IMLKFIKVVDSAQGGVAVHCKAGLGRTGTLIACWMMKEFGLTAGECMGWLRVCRPGSVIG 317

Query: 175 LKT 177
            + 
Sbjct: 318 PQQ 320


>gi|309365246|emb|CAP24071.2| hypothetical protein CBG_02450 [Caenorhabditis briggsae AF16]
          Length = 698

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 55/183 (30%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ +VP +I     P+         
Sbjct: 165 DVLRGIEKALRFGWLDFSDFDYEEYEFYERVENGDFNWIVPGKILSFCGPHNESREENGY 224

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 225 PYHAPDVYFDYFREKKVSTIVRLNAKN------YDAAKFTKAGFDHVDLFFVDGSTPSDE 278

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++ +A   + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 279 IMLKFIKVVDSAQGGVAVHCKAGLGRTGTLIACWMMKEFGLTAGECMGWLRVCRPGSVIG 338

Query: 175 LKT 177
            + 
Sbjct: 339 PQQ 341


>gi|196008923|ref|XP_002114327.1| hypothetical protein TRIADDRAFT_27920 [Trichoplax adhaerens]
 gi|190583346|gb|EDV23417.1| hypothetical protein TRIADDRAFT_27920 [Trichoplax adhaerens]
          Length = 441

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 59/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G +      +  Y         +F+ ++P +    + P+         
Sbjct: 154 HCLKALKKGMDNGFVSFDTFDVDEYEYYEKVENGDFNWIIPKKFLAFSGPHDKTTVENGY 213

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                        ++ I  ++ L  K+       + K   + GI   +   +     +D+
Sbjct: 214 PLHAPEAYISYFHKHNITFVIRLNKKI------YDAKRFTNNGIDHKDLFFTDGSTPSDK 267

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + + + +     + +HCK+G  RTG     YL     +   EA   L +   G    
Sbjct: 268 IVNEFLRLCEKNVGAIAVHCKAGLGRTGTLLGCYLMKHYRFTASEAIGWLRICRPGSVIG 327

Query: 175 LKTITM 180
            +   +
Sbjct: 328 PQQHFL 333


>gi|168701753|ref|ZP_02734030.1| protein tyrosine/serine phosphatase [Gemmata obscuriglobus UQM
           2246]
          Length = 191

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 56/132 (42%), Gaps = 8/132 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG--KLPESWHKEEEKAANDLGIQ 100
           NF  V P  +YRS Q   +  E L  ++GIK++++LR      E     EE      GI+
Sbjct: 30  NFGVVEPGVLYRSGQLTPSAFERLLTDHGIKTVVSLRPLRDEAEKSDAHEETICQSRGIK 89

Query: 101 LINFPLS------ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
            +  P            L     + L  +   A  P+ +HC +G DRTG   AVY     
Sbjct: 90  FVRIPPRETGAEPGGSPLEPVAREFLAVMADPANHPVYVHCTAGRDRTGTVCAVYRVDHD 149

Query: 155 HYPKEEAHRQLS 166
            +  E+A  ++ 
Sbjct: 150 GWSPEQAVAEMR 161


>gi|255019986|ref|ZP_05292059.1| hypothetical protein ACA_1196 [Acidithiobacillus caldus ATCC 51756]
 gi|254970515|gb|EET28004.1| hypothetical protein ACA_1196 [Acidithiobacillus caldus ATCC 51756]
          Length = 228

 Score =  121 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 72/158 (45%), Gaps = 5/158 (3%)

Query: 31  GLYFLTIT-TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR-GKLPESWHK 88
                        NFH V     YRSAQP    +    + YG++++LNLR     E   +
Sbjct: 23  WNDHGVFRELLYVNFHEVGMGA-YRSAQPAPYQLRRWHRRYGLRAVLNLRAPAAHEPQFQ 81

Query: 89  EEEKAANDLGIQLINFP-LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
            E++  + LG++ +    + +      EQ  + I  L+  P+P L+HCKSGADR G  S 
Sbjct: 82  LEQEVCDALGMEHVLLHGIGSRDLPRREQFLEAIETLERLPRPFLMHCKSGADRAGFMSV 141

Query: 148 VYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITF 184
           +Y ++      EEA  QL    YGH     T  +D  F
Sbjct: 142 LYSHLQLGQSLEEASAQLRIWPYGHIRHANTGILDWFF 179


>gi|221487729|gb|EEE25961.1| protein-tyrosine phosphatase, putative [Toxoplasma gondii GT1]
          Length = 502

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 64/206 (31%), Gaps = 26/206 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      + LG       ++  Y         + + ++P  I   + P          
Sbjct: 152 DCLKGLEFAMKLGWFDYKTFNVDEYDYYEKLKNGDMNWIIPSRILAFSCPSSATGNHDGY 211

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     +    GIK+++ L  K      + + +   D  I+ ++         + E
Sbjct: 212 STCTPEDYANIFNSLGIKTVVRLNKK------QYDARKFTDRNIEHVDLFFVDGTCPSRE 265

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM----LYGH 171
            I+  + +++    P+ +HCK+G  RTG     Y      +P   A   +        G 
Sbjct: 266 IIQAFLQVVENRDHPIAVHCKAGLGRTGTLIGCYAIKNFKFP---AVEWIGWNRLCRPGS 322

Query: 172 FPVLKTITMDITFEKITQLYPNNVSK 197
               +   +     ++ Q+   N   
Sbjct: 323 ILGPQQQFLTEIQHELLQMNRENSIH 348


>gi|268531264|ref|XP_002630758.1| C. briggsae CBR-CDC-14 protein [Caenorhabditis briggsae]
 gi|187037403|emb|CAP24069.1| CBR-CDC-14 protein [Caenorhabditis briggsae AF16]
          Length = 1044

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 55/183 (30%), Gaps = 20/183 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L      +  G L         Y         +F+ +VP +I     P+         
Sbjct: 144 DVLRGIEKALRFGWLDFSDFDYEEYEFYERVENGDFNWIVPGKILSFCGPHNESREENGY 203

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +E  + +I+ L  K        +       G   ++         +DE
Sbjct: 204 PYHAPDVYFDYFREKKVSTIVRLNAKN------YDAAKFTKAGFDHVDLFFVDGSTPSDE 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + I ++ +A   + +HCK+G  RTG   A ++         E    L +   G    
Sbjct: 258 IMLKFIKVVDSAQGGVAVHCKAGLGRTGTLIACWMMKEFGLTAGECMGWLRVCRPGSVIG 317

Query: 175 LKT 177
            + 
Sbjct: 318 PQQ 320


>gi|307203955|gb|EFN82862.1| Dual specificity protein phosphatase CDC14A [Harpegnathos saltator]
          Length = 578

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 57/199 (28%), Gaps = 20/199 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   Y    LG        +  Y         + + +VP +      P+         
Sbjct: 148 DCLSAIYKCHQLGFFNFEDFCVKEYEHFERVENGDLNWIVPGKFIAFCGPHARSKVEDGY 207

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +   + +I+ L  K+       +  +  D G    +          D 
Sbjct: 208 PLHGPESYFTYYRRNNVTTIVRLNKKI------YDASSFTDAGFNHKDLFFVDGSTPTDS 261

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + Q + I + A   + +HCK+G  RTG     Y+    H    E    + +   G    
Sbjct: 262 IMHQFLKIAENASGAVAVHCKAGLGRTGSLIGCYIMKHYHLTAHETIAWIRICRPGSVIG 321

Query: 175 LKTITMDITFEKITQLYPN 193
            +   ++     +  L  +
Sbjct: 322 HQQQWLEKKEAYLRSLLKD 340


>gi|34811075|pdb|1OHE|A Chain A, Structure Of Cdc14b Phosphatase With A Peptide Ligand
          Length = 348

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 26/186 (13%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 143 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 202

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 203 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +H K+G  RTG   A Y+         E    + +   G    
Sbjct: 257 IVKEFLDICENAEGAIAVHSKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 316

Query: 175 LKTITM 180
            +   +
Sbjct: 317 PQQQFL 322


>gi|168704910|ref|ZP_02737187.1| hypothetical protein GobsU_35559 [Gemmata obscuriglobus UQM 2246]
          Length = 222

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 79/202 (39%), Gaps = 25/202 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           +N L + +  ++  LVL A  + LY        + F  V P  +YRS Q           
Sbjct: 2   RNGLRWVLGCVVAALVLGA-PVALYRAQY-IQAKRFREVEPGRLYRSGQMTAAGFREAVD 59

Query: 69  EYGIKSILNLRGKLPESWHKE---------EEKAANDLGIQLINFPLS--------ATRE 111
            YGIK+++NL+ + P+    +         E +    LG++                   
Sbjct: 60  RYGIKTVVNLQHEEPDPLLPDHWLGKGQVRESELCAQLGVRYRLLTPDILPPGNQLDWEP 119

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYG 170
              +Q + L+     +  P+L+HCK+G  RTG  +A+Y      +   EA R+L    YG
Sbjct: 120 PAVKQWRDLLD--DESNYPVLLHCKAGLHRTGRLTAIYRMEYRGWSPGEALRELRANGYG 177

Query: 171 HFPVLKTITMDITFEKITQLYP 192
           +    +    D    +  Q Y 
Sbjct: 178 YVAASEG---DEFVIQFVQNYK 196


>gi|237830691|ref|XP_002364643.1| dual specificity protein phosphatase CDC14A, putative [Toxoplasma
           gondii ME49]
 gi|211962307|gb|EEA97502.1| dual specificity protein phosphatase CDC14A, putative [Toxoplasma
           gondii ME49]
 gi|221507522|gb|EEE33126.1| protein-tyrosine phosphatase, putative [Toxoplasma gondii VEG]
          Length = 479

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 30/206 (14%), Positives = 64/206 (31%), Gaps = 26/206 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      + LG       ++  Y         + + ++P  I   + P          
Sbjct: 152 DCLKGLEFAMKLGWFDYKTFNVDEYDYYEKLKNGDMNWIIPSRILAFSCPSSATGNHDGY 211

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     +    GIK+++ L  K      + + +   D  I+ ++         + E
Sbjct: 212 STCTPEDYANIFNSLGIKTVVRLNKK------QYDARKFTDRNIEHVDLFFVDGTCPSRE 265

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM----LYGH 171
            I+  + +++    P+ +HCK+G  RTG     Y      +P   A   +        G 
Sbjct: 266 IIQAFLQVVENRDHPIAVHCKAGLGRTGTLIGCYAIKNFKFP---AVEWIGWNRLCRPGS 322

Query: 172 FPVLKTITMDITFEKITQLYPNNVSK 197
               +   +     ++ Q+   N   
Sbjct: 323 ILGPQQQFLTEIQHELLQMNRENSIH 348


>gi|317146237|ref|XP_001821385.2| tyrosine phosphatase family protein [Aspergillus oryzae RIB40]
          Length = 242

 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/161 (23%), Positives = 64/161 (39%), Gaps = 15/161 (9%)

Query: 29  SLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           SL       +    NF  VV   IYRSA P+   +    +  G+K+I+ L   + E +  
Sbjct: 35  SLAESEPMYSELPPNFGEVVEG-IYRSAFPSPWNL-PALENLGLKTIITL---VEEPYSV 89

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTG 143
                  + GI      + A ++  ++    +I+     +L  A  P+LIHC  G  RTG
Sbjct: 90  SHMSFLRENGIAHFRIIVQANKDPEEKTPDHVINGILEILLNKANHPILIHCNKGKHRTG 149

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
              A +   V  +   +   +    Y  +   K+  +D  F
Sbjct: 150 CVVACFR-KVQGWNLRDVLDE----YLSYSWPKSRALDERF 185


>gi|198436633|ref|XP_002127684.1| PREDICTED: similar to cell division cycle 14 alpha protein [Ciona
           intestinalis]
          Length = 669

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
             L      I              Y         +F+ V+P +    + P+         
Sbjct: 210 DCLHAVDRAITHRFYCPDTFDPDEYEHYERVENGDFNWVLPEKFLAFSGPHPRSKIENGY 269

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++G+  I+ L  K+       + +   D G    +         +D 
Sbjct: 270 PLHAPEAYFPYFRKHGVSCIVRLNKKM------YDARRFQDAGFDHHDLFFVDGSTPSDS 323

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I +     + +HCK+G  RTG   A Y+     +   E    + +   G    
Sbjct: 324 ILKRFLDICENTDGAIAVHCKAGLGRTGTLIACYMMKHYRFTAAECIAWIRIARPGSIIG 383

Query: 175 LKTITM 180
            +   +
Sbjct: 384 PQQHYL 389


>gi|189196232|ref|XP_001934454.1| tyrosine-protein phosphatase SIW14 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187980333|gb|EDU46959.1| tyrosine-protein phosphatase SIW14 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 279

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 44/166 (26%), Positives = 64/166 (38%), Gaps = 18/166 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AV+P  +YRS  P         KE GIK+IL L   +PE      +    + GIQ  
Sbjct: 97  NYGAVIPGCVYRSGYPKEENF-GFLKELGIKTILTL---VPEPISPAYQNFMKEAGIQHF 152

Query: 103 NFPLSATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +  + A +      + E  + L  I+  A  P+L+HC  G  RTG   A +   V     
Sbjct: 153 HAHIRANKGEVRVESCEMSRALRLIMDRANHPILVHCNKGKHRTGCTIACFR-RVLGVDP 211

Query: 159 EEAHRQLSMLYGHFPVLKTITMDI-TFEKITQLYPNNVSKGDTEQP 203
           E    +    Y  +   K   +D   FE        N+      Q 
Sbjct: 212 ETVREE----YHTYAGPKARFLDEVFFENFDL----NLVMWIARQE 249


>gi|302771786|ref|XP_002969311.1| hypothetical protein SELMODRAFT_91859 [Selaginella moellendorffii]
 gi|300162787|gb|EFJ29399.1| hypothetical protein SELMODRAFT_91859 [Selaginella moellendorffii]
          Length = 341

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 59/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             +        +G +     +L  Y         + + +VP+++   + P          
Sbjct: 150 DCIQAVAKGKKVGWIDFSTFNLEEYEYFEQVENGDLNWIVPNKLVAFSGPAPRRSQMYGY 209

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K  G+ +++ L  +        + +   D GI   +          + 
Sbjct: 210 RSLVPEDYIEYFKRVGVVAVVRLNKR------LYDRRRFTDHGINHYDLYFPDGSCPPER 263

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I++     + +HCK+G  RTG+    Y+     +   E    L +   G    
Sbjct: 264 IVQRFMEIVEETAGAIAVHCKAGLGRTGVLIGCYIMKHFRFTCNEVLGYLRLTRPGSVIG 323

Query: 175 LKTITM 180
            +   +
Sbjct: 324 PQQHFL 329


>gi|170575711|ref|XP_001893353.1| Protein-tyrosine phosphatase containing protein [Brugia malayi]
 gi|158600701|gb|EDP37810.1| Protein-tyrosine phosphatase containing protein [Brugia malayi]
          Length = 552

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 62/184 (33%), Gaps = 20/184 (10%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN----------- 59
           L      +  G L         Y         + + ++P ++     P+           
Sbjct: 151 LRSIEKAMKFGWLAFDTFDPDEYEYYEKVENGDLNWIIPTKVLSFCGPHNKSVVENGYPY 210

Query: 60  --GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
                     + + I +I+ L  ++       + K   D G + ++         +DE +
Sbjct: 211 HAPEVYFDYFRTHNISTIIRLNKRM------YDAKRFLDAGFEHVDLFFVDGSVPSDEIV 264

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLK 176
           ++ I+++ +A   + +HCK+G  RTG   A +L         E+   L +   G     +
Sbjct: 265 ERFINVVDSAKGGVAVHCKAGLGRTGTLIACWLMKEYGVTAAESIAWLRICRPGSVIGPQ 324

Query: 177 TITM 180
              +
Sbjct: 325 QEFL 328


>gi|326432544|gb|EGD78114.1| Cdc14A3 phosphatase [Salpingoeca sp. ATCC 50818]
          Length = 831

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 27/172 (15%), Positives = 56/172 (32%), Gaps = 19/172 (11%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN-------- 59
           R  +   Y  +L G + L   S   Y         +F+ +V  +    A P+        
Sbjct: 140 RDVVAGVYQGLLNGFVDLTTFSPEEYDFYERIEHGDFNWMVADKFISMAGPHNQRHINNG 199

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                     +  +++ +  ++ L           +       G++  +   +       
Sbjct: 200 YPHFAPEDFVWYFQQHNVTDVVRLN------APLYDRTKFTRHGLRHHDMCFTDGTTPPP 253

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
             ++Q +   ++A   + +HCK+G  RTG   A Y+         EA   L 
Sbjct: 254 HILRQFLDACESAEGAIAVHCKAGLGRTGTLMACYIMKHYKLTAREAIAWLR 305


>gi|327398356|ref|YP_004339225.1| protein tyrosine/serine phosphatase [Hippea maritima DSM 10411]
 gi|327180985|gb|AEA33166.1| protein tyrosine/serine phosphatase [Hippea maritima DSM 10411]
          Length = 381

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 66/161 (40%), Positives = 96/161 (59%), Gaps = 3/161 (1%)

Query: 40  FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLG 98
              NFH V    +YRS Q +   + Y  K+Y IKSI+NLRGK   ++W+KEE K +  L 
Sbjct: 221 ENGNFHTVENGALYRSGQLDKDELLYYIKQYHIKSIVNLRGKQQGKNWYKEEIKLSKQLN 280

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +  I+F LS  +     ++ +LI+IL+  PKP+LIHCK+GADR+GL SA++ Y V +YP 
Sbjct: 281 LVHIDFRLSPNKIAKPRKLIKLINILEKIPKPILIHCKAGADRSGLVSAIWKYYVENYPI 340

Query: 159 EEAHRQLSMLYGHFPV--LKTITMDITFEKITQLYPNNVSK 197
           + +  QLS+LY HFP     +  MD +F    +      S+
Sbjct: 341 KRSDEQLSLLYLHFPYLGSPSEAMDKSFWIFVKKAKKRQSR 381


>gi|302810223|ref|XP_002986803.1| hypothetical protein SELMODRAFT_3248 [Selaginella moellendorffii]
 gi|300145457|gb|EFJ12133.1| hypothetical protein SELMODRAFT_3248 [Selaginella moellendorffii]
          Length = 294

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 59/186 (31%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             +        +G +     +L  Y         + + +VP+++   + P          
Sbjct: 107 DCIQAVAKGKKIGWIDFSTFNLEEYEYFEQVENGDLNWIVPNKLVAFSGPAPRRSQMYGY 166

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K  G+ +++ L  +        + +   D GI   +          + 
Sbjct: 167 RSLVPEDYIEYFKRVGVVAVVRLNKR------LYDRRRFTDHGINHYDLYFPDGSCPPER 220

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +++ + I++     + +HCK+G  RTG+    Y+     +   E    L +   G    
Sbjct: 221 IVQRFMEIVEETAGAIAVHCKAGLGRTGVLIGCYIMKHFRFTCNEVLGYLRLTRPGSVIG 280

Query: 175 LKTITM 180
            +   +
Sbjct: 281 PQQHFL 286


>gi|70994698|ref|XP_752126.1| tyrosine phosphatase family protein [Aspergillus fumigatus Af293]
 gi|66849760|gb|EAL90088.1| tyrosine phosphatase family protein [Aspergillus fumigatus Af293]
 gi|159124960|gb|EDP50077.1| tyrosine phosphatase family protein [Aspergillus fumigatus A1163]
          Length = 241

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 44/192 (22%), Positives = 75/192 (39%), Gaps = 18/192 (9%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           LG   L   SL    +       NF  VV   +YRS+ P         K+ G++ I+ L 
Sbjct: 24  LGYRPLQETSLESEIIHTEKLPPNFGDVVKG-VYRSSFPQPWHF-QALKKLGLRMIVTL- 80

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ-----LISILKTAPKPLLIH 134
             +   + ++ +    + GI+     + A ++             L  +L     PLL+H
Sbjct: 81  --VEGDYTQDHQVFLKENGIEHRRILILANKDPTIRTPDHVVNRVLEIMLNKTNHPLLLH 138

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI---TQLY 191
           C  G  RTG     +   V  +      ++    Y +F + K+  +D  F ++   T+L 
Sbjct: 139 CNKGKHRTGCIVGCFR-KVQGWDMPAIRKE----YLNFSLPKSRPLDERFIELFDDTRLG 193

Query: 192 PNNVSKGDTEQP 203
           P  VS G +  P
Sbjct: 194 PLAVSSGASSWP 205


>gi|255718429|ref|XP_002555495.1| KLTH0G10626p [Lachancea thermotolerans]
 gi|238936879|emb|CAR25058.1| KLTH0G10626p [Lachancea thermotolerans]
          Length = 303

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 68/169 (40%), Gaps = 15/169 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  EIYRS+ P      +L++   +KSI+ L   +PE + +E  +     GI+L 
Sbjct: 143 NFSHVV-GEIYRSSFPRPENFSFLQQRIKLKSIMVL---IPEEYPQENLEFMARAGIKLF 198

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +S  +E        L++      +     P+LIHC  G  RTG        +  ++ 
Sbjct: 199 QFGMSGNKEPFVNIPSDLLTSALEVAINPENHPVLIHCNRGKHRTGCLVGCIRRL-QNWS 257

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPMN 205
                  +   Y  F   K   +D  F E   +     +++     P+ 
Sbjct: 258 ----LTMIFDEYRRFAFPKARALDQQFIEMYDEDKIKRIAQEKQWLPIQ 302


>gi|116623982|ref|YP_826138.1| hypothetical protein Acid_4894 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116227144|gb|ABJ85853.1| protein of unknown function DUF442 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 180

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/153 (26%), Positives = 76/153 (49%), Gaps = 7/153 (4%)

Query: 16  IKILLGVLVLCAVSLGLYFLTITTFT---QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
            +IL  +++ C++                 NFH V  H +YR  QP+    E    + G+
Sbjct: 7   RRILAALVLCCSILTWQALAETPAIAIPIPNFHQVNEH-VYRGGQPSPETWE-HLAKIGV 64

Query: 73  KSILNLRGKLPESWH-KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPL 131
           K++++LR +  E     +E +A    G+  +N P+       D+QI +++++L T  +P+
Sbjct: 65  KTVIDLRREGEEEHSVAQEAEAVKKAGMTYVNVPMKGVVAPTDDQIAKVMALLNT-NEPV 123

Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
            +HCK G+DRTG   A Y      + +++A ++
Sbjct: 124 FVHCKRGSDRTGAVIACYRISHDRWQQKQALQE 156


>gi|91094781|ref|XP_968252.1| PREDICTED: similar to Dual specificity protein phosphatase CDC14A
           (CDC14 cell division cycle 14 homolog A) [Tribolium
           castaneum]
 gi|270016553|gb|EFA12999.1| hypothetical protein TcasGA2_TC001964 [Tribolium castaneum]
          Length = 421

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/193 (14%), Positives = 57/193 (29%), Gaps = 20/193 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      +  G           Y         + + +VP +      P          
Sbjct: 146 DCLKAVKKALDCGFFDFENFDFFEYEHYERVENGDLNWIVPEKFIAFCGPHHKSIIDKGY 205

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
              +        + + + +++ L  K     +          G    +         ND 
Sbjct: 206 PIHSPETYFAYFRRHNVTTVIRLNKK----AYDSNR--FVQAGFDHKDLFFIDGGIPNDR 259

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + ISI + A   + +HCK+G  RTG   A Y+     +  +EA   + +   G    
Sbjct: 260 ILNKFISICENAKGVIAVHCKAGLGRTGTLIACYIMKHYKFTAQEAIAWIRICRPGSIIA 319

Query: 175 LKTITMDITFEKI 187
            +   +    E++
Sbjct: 320 HQQTWLLEKQEQL 332


>gi|313235889|emb|CBY11276.1| unnamed protein product [Oikopleura dioica]
          Length = 454

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 62/195 (31%), Gaps = 20/195 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG-------- 60
                    +    +    + +  Y         +F+ +VP++    + P+         
Sbjct: 151 DCFHGLKKALQHNFVDFATLDVEEYEYYERVENGDFNWIVPNKFLAFSGPHPKSKIENGY 210

Query: 61  -----TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ IK+++ L  K+  +          D G    +   +      D 
Sbjct: 211 PLHAPEAYFPYFRKHNIKTVIRLNKKIYPAS------RFTDGGFDHHDMFFTDGSCPPDH 264

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +KQ + I++       IHCK+G  RTG   A YL     +   E    L +   G    
Sbjct: 265 ILKQFLHIVENMDGAAAIHCKAGLGRTGSLIACYLMKHYKFTAAETIGWLRLCRPGSVLG 324

Query: 175 LKTITMDITFEKITQ 189
            +   ++     + Q
Sbjct: 325 PQQHWLEEQQHVMWQ 339


>gi|238491852|ref|XP_002377163.1| tyrosine phosphatase family protein [Aspergillus flavus NRRL3357]
 gi|220697576|gb|EED53917.1| tyrosine phosphatase family protein [Aspergillus flavus NRRL3357]
          Length = 183

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 67/172 (38%), Gaps = 16/172 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRSA P+   +    +  G+K+I+ L   + E +         + GI  
Sbjct: 7   PNFGEVVEG-IYRSAFPSPWNL-PALENLGLKTIITL---VEEPYSVSHMSFLRENGIAH 61

Query: 102 INFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
               + A ++  ++    +I+     +L  A  P+LIHC  G  RTG   A +   V  +
Sbjct: 62  FRIIVQANKDPEEKTPDHVINGILEILLNKANHPILIHCNKGKHRTGCVVACFR-KVQGW 120

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMD-ITFEKITQLYPNNVSKGDTEQPMNAT 207
              +   +    Y  +   K+  +D    E       + V+K    +    T
Sbjct: 121 NLRDVLDE----YLSYSWPKSRALDERFIEAFDATKLDQVAKESGAKLWKPT 168


>gi|312078903|ref|XP_003141942.1| hypothetical protein LOAG_06358 [Loa loa]
 gi|307762894|gb|EFO22128.1| hypothetical protein LOAG_06358 [Loa loa]
          Length = 550

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 61/184 (33%), Gaps = 20/184 (10%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN----------- 59
           L      +  G L         Y         + + ++P +I     P+           
Sbjct: 151 LRSIEKAMKFGWLAFDTFDPDEYEYYEKVENGDLNWIIPTKILSFCGPHNKSVIENGYPY 210

Query: 60  --GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
                     + + I +I+ L  ++       + K   D G + I+         +DE +
Sbjct: 211 HAPEVYFDYFRAHNISTIIRLNKRM------YDAKRFLDAGFEHIDLFFVDGSVPSDEIV 264

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLK 176
           ++ I+++  A   + +HCK+G  RTG   A +L         E+   L +   G     +
Sbjct: 265 ERFINVVDNARGGVAVHCKAGLGRTGTLIACWLMKEYGVTAAESIAWLRICRPGSVIGPQ 324

Query: 177 TITM 180
              +
Sbjct: 325 QEFL 328


>gi|67528456|ref|XP_662030.1| hypothetical protein AN4426.2 [Aspergillus nidulans FGSC A4]
 gi|40741001|gb|EAA60191.1| hypothetical protein AN4426.2 [Aspergillus nidulans FGSC A4]
 gi|259482760|tpe|CBF77547.1| TPA: tyrosine phosphatase family protein (AFU_orthologue;
           AFUA_4G07000) [Aspergillus nidulans FGSC A4]
          Length = 232

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/160 (24%), Positives = 66/160 (41%), Gaps = 17/160 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   IYR A P    +    K  G+++I+ L   + E + +  EK   + GI   
Sbjct: 43  NFGEVVKG-IYRCAFPQPWNL-PALKTLGLRTIITL---VDEPYTQSHEKFLEETGITHH 97

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P  A ++             L  +L  +  P+LIHC  G  RTG  +A +  +   + 
Sbjct: 98  RIPFIANKDPAIKTPERVVNTILRLMLNKSNHPILIHCNKGKHRTGCVTACFRKL-QGWD 156

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           +++   +    Y  +   K   +D  F  I +  P+ +S 
Sbjct: 157 RQDIMNE----YIRYSRPKQRLLDEVF--IDEFDPSALSH 190


>gi|242012994|ref|XP_002427208.1| dual specificity protein phosphatase CDC14, putative [Pediculus
           humanus corporis]
 gi|212511500|gb|EEB14470.1| dual specificity protein phosphatase CDC14, putative [Pediculus
           humanus corporis]
          Length = 712

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/198 (15%), Positives = 63/198 (31%), Gaps = 26/198 (13%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L   Y    L        ++  Y    T    + + +VP++    A P          
Sbjct: 159 DCLNAIYQAHKLKFFDFDDFNVNEYEYYETVQNGDLNWIVPNKFLAFAGPQSKDYVNYGK 218

Query: 59  ---------NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
                             +E  + +I+ L  K        +       G   ++      
Sbjct: 219 NRILNPLIRTPESYVRYFRENNVTTIVRLNNK------LYDASKFTKEGFTHVDLFFIDG 272

Query: 110 RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-L 168
              +D+ + + +++ +T+   + +HCK+G  RTG   A YL     +   EA   + +  
Sbjct: 273 STPSDDLVNKFLTVSETSSGAVAVHCKAGLGRTGSMIACYLMKWYRFTAREAIAWIRICR 332

Query: 169 YGHFPVLKTITMDITFEK 186
                  +   ++IT + 
Sbjct: 333 PASIIGHQQEWLEITLKN 350


>gi|296414265|ref|XP_002836823.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295631662|emb|CAZ81014.1| unnamed protein product [Tuber melanosporum]
          Length = 188

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 56/158 (35%), Gaps = 17/158 (10%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             +YRS+ P         +E  +KSI+ L   + E+   E  +     GI+     +   
Sbjct: 6   GFVYRSSFPKPENF-PYLQELKLKSIITL---VSETHPAENNEFMRQNGIKHFQIGMPGN 61

Query: 110 REL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           +       +++    L  IL     P+LIHC  G  RTG        +        +   
Sbjct: 62  KVPFVNFSDEKISTALRIILDRRNHPILIHCNKGKHRTGCVVGCLRKVQ-----AWSLTL 116

Query: 165 LSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
           +   Y HF   K+  +D       +LY      G  +Q
Sbjct: 117 ILDEYRHFAGPKSRALDQL---RIELYREEACMGSAKQ 151


>gi|66363264|ref|XP_628598.1| CDC14 phosphatase [Cryptosporidium parvum Iowa II]
 gi|67623285|ref|XP_667925.1| CDC14 A isoform 2 [Cryptosporidium hominis TU502]
 gi|46229605|gb|EAK90423.1| CDC14 phosphatase [Cryptosporidium parvum Iowa II]
 gi|54659099|gb|EAL37694.1| CDC14 A isoform 2 [Cryptosporidium hominis]
          Length = 453

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/196 (13%), Positives = 55/196 (28%), Gaps = 26/196 (13%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             LL  Y  +LL         +  Y         +   V+P++    + P          
Sbjct: 151 DCLLGLYYAMLLKWFDYETFDINEYSTYEKVENGDISWVIPNKFIAFSGPSGTSVDEDGY 210

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                 F   + K+  + +++ L  K      + E +   + GI+               
Sbjct: 211 FSLTPEFYIPIFKKLKVSTVIRLNKK------QYESERFTNNGIKHEELFFIDGSCPPQN 264

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM----LYGH 171
            + + + + +       +HCK+G  RTG     Y      +    A   +        G 
Sbjct: 265 ILNRFLELTENEKGVFAVHCKAGLGRTGTLLGCYAIKNYRFT---ASAWIGWNRIARPGS 321

Query: 172 FPVLKTITMDITFEKI 187
               +   +      +
Sbjct: 322 VLGPQQQFLHEIEPNL 337


>gi|50294460|ref|XP_449641.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528955|emb|CAG62617.1| unnamed protein product [Candida glabrata]
          Length = 280

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 66/169 (39%), Gaps = 15/169 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  EIYRS+ P      +L+K   +KSIL L   +PE + +E         I+L 
Sbjct: 120 NFSHVV-GEIYRSSFPRTENFAFLQKRLKLKSILVL---IPEEYPQENLDFMEKANIKLF 175

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E        L++     +L    +P+LIHC  G  RTG        +   + 
Sbjct: 176 QVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCNRGKHRTGCLIGCIRKL-QSWS 234

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPMN 205
                  +   Y  F   K   +D  F E        +++  +   P+ 
Sbjct: 235 ----LTMIFDEYRRFAFPKARALDQQFIEMYDDDKIKSIATQNKWLPLQ 279


>gi|298713544|emb|CBJ27072.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 319

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/190 (13%), Positives = 52/190 (27%), Gaps = 21/190 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L                  +  Y         + + +V  +    A P          
Sbjct: 117 HCLKGLQKARHFSFFNFDTFDVEEYEHYEQVENGDLNWLVDGKFLAFAGPHSRSEMTREG 176

Query: 59  ----NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        K++ +  ++ L  K    ++ E      D GI  +            
Sbjct: 177 YRTLTPRNYIPYFKKHNVTLVVRLNKK----YYDE--GLFLDAGIDHLEAYFLDGSVPPP 230

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             I+Q I+  +  P  + +HCK+G  RTG     Y+     +   E    + +   G   
Sbjct: 231 SVIRQFIAACEATPGAVAVHCKAGLGRTGTCIGCYIMKHYSFTAAEVIGWMRICRPGSVI 290

Query: 174 VLKTITMDIT 183
             +   ++  
Sbjct: 291 GPQQHYLEQM 300


>gi|45187669|ref|NP_983892.1| ADL204Wp [Ashbya gossypii ATCC 10895]
 gi|44982430|gb|AAS51716.1| ADL204Wp [Ashbya gossypii ATCC 10895]
          Length = 217

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 42/152 (27%), Positives = 63/152 (41%), Gaps = 14/152 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  EIYRS+ P      +L++   ++SIL L   +PE +  E ++     GIQL 
Sbjct: 57  NFSPVV-GEIYRSSFPRPENFAFLQERVRLRSILVL---IPEEYPPENQEFVERAGIQLF 112

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E      +      L   L  A  P+LIHC  G  RTG        +  ++ 
Sbjct: 113 QVGMSGNKEPFVNIPRDVLTRALAIALDPANHPILIHCNRGKHRTGCLVGCIRKL-QNWS 171

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
                  +   Y  F   K   MD  F ++ +
Sbjct: 172 ----LTMIFDEYRRFAFPKARAMDQQFIEMYE 199


>gi|168699665|ref|ZP_02731942.1| hypothetical protein GobsU_09089 [Gemmata obscuriglobus UQM 2246]
          Length = 194

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/174 (19%), Positives = 76/174 (43%), Gaps = 12/174 (6%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
           ++ L F + +    LV+ A  +  Y     T  +NF  V    +YRS Q     ++ + +
Sbjct: 2   RDRLRFVLSLTAAALVIAAPLV--YSANENTHRRNFRVVEEGVLYRSGQLTPAGLDSVVR 59

Query: 69  EYGIKSILNLRGKLPESWHKE--EEKAANDLGIQLINFPLSATRE------LNDEQIKQL 120
           ++ I+++++LR     +   +  EE      G+  +                 ++ +++ 
Sbjct: 60  DHSIRTVVSLRTSRTAAPPPDSWEEGVCAAKGLNHVRIVPRVWGADEKGEIPAEQAVQEF 119

Query: 121 ISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFP 173
           +++++     P+L+HC +G  RTG   A++      +  E A  ++ + YG  P
Sbjct: 120 LTVMEKKENHPVLVHCFAGIHRTGTMCAIFRMEHHRWTAERAMTEMQL-YGFAP 172


>gi|328791811|ref|XP_395461.3| PREDICTED: dual specificity protein phosphatase CDC14A isoform 1
           [Apis mellifera]
          Length = 566

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 54/198 (27%), Gaps = 20/198 (10%)

Query: 10  NLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN---------- 59
            L   Y    LG        +  Y         + + ++P +      P           
Sbjct: 149 CLSAIYKCHKLGFFNFQDFCVKEYEYFERVENGDLNWIIPGKFIAFCGPYAKFKIENGYP 208

Query: 60  ---GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
                          + +I+ L  K+       +     D G    +          D  
Sbjct: 209 LHAPESYFTYFHYNNVTTIIRLNKKI------YDASIFTDAGFDHKDLFFLDGSTPTDSI 262

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVL 175
           ++Q + I + A   + +HC++G  RTG     Y+    H    E    + +   G     
Sbjct: 263 MRQFLKIAENASGAVAVHCRAGLGRTGSLIGCYIMKHYHLTAHETIAWIRICRPGSVIGH 322

Query: 176 KTITMDITFEKITQLYPN 193
           +   ++     +  L   
Sbjct: 323 QQEWLEKKEAYLHSLLKE 340


>gi|328771796|gb|EGF81835.1| hypothetical protein BATDEDRAFT_34606 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 263

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 68/171 (39%), Gaps = 20/171 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF+ V P  IYRSA P         K+ G++SIL L     E +  +  K  +D  I L 
Sbjct: 99  NFNLVAPG-IYRSAFPKKRNF-SFLKKLGLRSILTLIL---EDYPDQNRKFLDDNNIHLF 153

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F ++  +E   +  ++     L  I+     PLLIHC  G  RTG        +     
Sbjct: 154 QFGVAGNKEPFVDIPEETVCAALSVIMDERNHPLLIHCNKGKHRTGCLVGCLRKMQH--- 210

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP-----NNVSKGDTEQP 203
              +   +   Y  F   K+ +MD  F ++ + +       ++      QP
Sbjct: 211 --WSMTSIFDEYRRFSHPKSRSMDQQFIELFETHNVSIDIAHLPNWAEIQP 259


>gi|240995040|ref|XP_002404568.1| dual specificity protein phosphatase CDC-14 alpha, putative [Ixodes
           scapularis]
 gi|215491590|gb|EEC01231.1| dual specificity protein phosphatase CDC-14 alpha, putative [Ixodes
           scapularis]
          Length = 583

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 59/194 (30%), Gaps = 24/194 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      I    L      L  Y         + + +VPH+      P          
Sbjct: 148 DCLRAVEKAISHKFLDFENFDLEEYEYYERVENGDLNWIVPHKFIAFCGPHPKSKIENGH 207

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
              +         ++ + +++ L  K+       + +   + G    +         +D 
Sbjct: 208 PFHSPETYFPYFSKHNVSTVVRLNKKI------YDARRFAEQGFDHRDLFFVDGSTPSDA 261

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY-----G 170
            +++ I I +  P  L +HCK+G  RTG   A Y+     +   E+   + +       G
Sbjct: 262 IMREFIEISENTPGALAVHCKAGLGRTGTLIACYIMKHYRFTAAESIAWIRICRPGSIIG 321

Query: 171 HFPVLKTITMDITF 184
           H         D  +
Sbjct: 322 HQQHWLEGKQDYLW 335


>gi|330945302|ref|XP_003306532.1| hypothetical protein PTT_19698 [Pyrenophora teres f. teres 0-1]
 gi|311315927|gb|EFQ85376.1| hypothetical protein PTT_19698 [Pyrenophora teres f. teres 0-1]
          Length = 279

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/166 (25%), Positives = 63/166 (37%), Gaps = 18/166 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AV+P  +YRS  P         KE GIK+IL L   +PE      +    + GIQ  
Sbjct: 97  NYGAVLPGCVYRSGYPKEENF-GFLKELGIKTILTL---VPEPISPAYQTFMKEAGIQHF 152

Query: 103 NFPLSATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +  + A +      + E  + L  I+     P+L+HC  G  RTG   A +   V     
Sbjct: 153 HAHIRANKGEVRIESCEMSRALRLIMDRTNHPILVHCNKGKHRTGCTIACFR-RVLGVDA 211

Query: 159 EEAHRQLSMLYGHFPVLKTITMDI-TFEKITQLYPNNVSKGDTEQP 203
           E    +    Y  +   K   +D   FE        N+      Q 
Sbjct: 212 ETVREE----YHTYAGPKARFLDEVFFENFDL----NLVMWIARQE 249


>gi|50308667|ref|XP_454336.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49643471|emb|CAG99423.1| KLLA0E08581p [Kluyveromyces lactis]
          Length = 274

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/150 (27%), Positives = 62/150 (41%), Gaps = 14/150 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V   EIYRS+ P     E+L+    +KSIL L   +PE +  E  K   + GI+L 
Sbjct: 114 NFSHVC-GEIYRSSFPRPENFEFLRDRLKLKSILVL---IPEEYPAENMKFMEETGIKLF 169

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E        L++     +L     P+LIHC  G  RTG        +  ++ 
Sbjct: 170 QVGMSGNKEPFVNIPSDLLTKALEVVLNPENHPILIHCNRGKHRTGCLVGCIRKL-QNWS 228

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   +D  F ++
Sbjct: 229 ----LTMIFDEYRRFAFPKVRALDQQFIEL 254


>gi|328871698|gb|EGG20068.1| putative protein tyrosine phosphatase [Dictyostelium fasciculatum]
          Length = 313

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 62/153 (40%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN        K+ G+KSIL L    PE + +         GI+L+
Sbjct: 158 NFSMVSSG-VYRSGYPNKKN-HPFLKKLGLKSILYL---CPEEYSESNTNFIRKNGIKLL 212

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           ++ +   +E   +   +     L+ +L     P+LIHC  G  RTG        +   + 
Sbjct: 213 HYRIVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCVVGCLRKL-QKWS 271

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
               +  +   Y  F   K   +D  F ++ +L
Sbjct: 272 ----YTYIFDEYRRFAGSKVRVLDQQFIELFKL 300


>gi|6324296|ref|NP_014366.1| Siw14p [Saccharomyces cerevisiae S288c]
 gi|1730719|sp|P53965|SIW14_YEAST RecName: Full=Tyrosine-protein phosphatase SIW14
 gi|1301872|emb|CAA95895.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285814619|tpg|DAA10513.1| TPA: Siw14p [Saccharomyces cerevisiae S288c]
          Length = 281

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 66/169 (39%), Gaps = 15/169 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        GI+L 
Sbjct: 121 NFSHVV-GEIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLTGIKLY 176

Query: 103 NFPLSATRELNDEQIKQLI-----SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E        L+      +L  A +P+LIHC  G  RTG        +  ++ 
Sbjct: 177 QVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIRKL-QNWS 235

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPMN 205
                  +   Y  F   K   +D  F E         ++  +   P+ 
Sbjct: 236 ----LTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRIASKNNWLPLQ 280


>gi|254569786|ref|XP_002492003.1| Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis [Pichia pastoris GS115]
 gi|238031800|emb|CAY69723.1| Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis [Pichia pastoris GS115]
 gi|328351503|emb|CCA37902.1| hypothetical protein PP7435_Chr2-0205 [Pichia pastoris CBS 7435]
          Length = 201

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 64/169 (37%), Gaps = 16/169 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  V    IYRS+ P     E   K   +KS++ L   +PE + +E  +   +  IQ 
Sbjct: 41  KNFSPVC-GNIYRSSFPTIENFE-FLKRINLKSVICL---IPEDYPEENREFLEEQHIQF 95

Query: 102 INFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
               LS  +E   +   QLI      +L     P+LIHC  G  RTG  S     +   +
Sbjct: 96  FQVGLSGNKEPFVKIKPQLIEQALKIVLNPENHPILIHCNRGKHRTGCLSGCIRKL-QKW 154

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPM 204
                   +   Y  F   K   +D  F E         ++  +   P+
Sbjct: 155 S----LTMIFDEYRKFAAPKERALDQQFIEMFDDTEVEKMAIENKWLPI 199


>gi|151944512|gb|EDN62790.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gi|190409013|gb|EDV12278.1| tyrosine-protein phosphatase SIW14 [Saccharomyces cerevisiae
           RM11-1a]
 gi|256269491|gb|EEU04779.1| Siw14p [Saccharomyces cerevisiae JAY291]
 gi|290771004|emb|CAY82175.2| Siw14p [Saccharomyces cerevisiae EC1118]
 gi|323303183|gb|EGA56982.1| Siw14p [Saccharomyces cerevisiae FostersB]
 gi|323306527|gb|EGA59920.1| Siw14p [Saccharomyces cerevisiae FostersO]
 gi|323331999|gb|EGA73411.1| Siw14p [Saccharomyces cerevisiae AWRI796]
          Length = 281

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 66/169 (39%), Gaps = 15/169 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        GI+L 
Sbjct: 121 NFSHVV-GEIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLTGIKLY 176

Query: 103 NFPLSATRELNDEQIKQLI-----SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E        L+      +L  A +P+LIHC  G  RTG        +  ++ 
Sbjct: 177 QVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIRKL-QNWS 235

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPMN 205
                  +   Y  F   K   +D  F E         ++  +   P+ 
Sbjct: 236 ----LTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRIASKNNWLPLQ 280


>gi|223940368|ref|ZP_03632223.1| protein tyrosine/serine phosphatase [bacterium Ellin514]
 gi|223890973|gb|EEF57479.1| protein tyrosine/serine phosphatase [bacterium Ellin514]
          Length = 188

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/146 (32%), Positives = 70/146 (47%), Gaps = 7/146 (4%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YR AQP+   I+   K  GIK+I+NLR   P+     EE  A+  GI   
Sbjct: 45  NFGKVSEG-LYRGAQPDEAGIQN-LKRLGIKTIVNLRM--PDDVLSGEETQAHANGITYT 100

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           N PL       DEQ+K ++++++T P P+ +HC+ G DRTG   A Y      +  E A 
Sbjct: 101 NVPLRGLGRPTDEQVKNVLALIETLPAPVFVHCQHGCDRTGTIVACYRIQHDKWLSETAL 160

Query: 163 RQLSMLYGHFPVLKTITMDITFEKIT 188
            + +  YG  P      M    ++  
Sbjct: 161 DE-AGHYGMSPF--ERGMRKFVKEFA 183


>gi|47227576|emb|CAG09573.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 443

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 26/245 (10%), Positives = 62/245 (25%), Gaps = 72/245 (29%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN-- 59
           +        L      +  G L   +  +  Y         + + ++P +    + P+  
Sbjct: 121 MYNLNILDCLRAVNKALQYGWLDFSSFDVEEYEHYERAENGDLNWIIPGKFLAFSGPHPK 180

Query: 60  ------------------------------------GTFIEYLKKEYGIKSILNLRGKLP 83
                                                       +++ + +I+ L  K+ 
Sbjct: 181 SKIENGKSRARDFRIYLSSSRNTRDLFFPSGYPLHAPEAYIPYFRKHNVTTIIRLNKKM- 239

Query: 84  ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCK------- 136
                 + K   + G +  +         ND  +++ ++I + A   + +HCK       
Sbjct: 240 -----YDAKRFTETGFEHHDLFFVDGSTPNDSIVRKFLNICENAEGAIAVHCKGPIPGIF 294

Query: 137 --------------------SGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVL 175
                               +G  RTG     Y+         EA   + +   G     
Sbjct: 295 LFPVVAESIDSFLIFFFFFPAGLGRTGTLIGCYMMKHYRLTAAEAIAWIRICRPGSIIGP 354

Query: 176 KTITM 180
           +   +
Sbjct: 355 QQNFV 359


>gi|50550115|ref|XP_502530.1| YALI0D07414p [Yarrowia lipolytica]
 gi|49648398|emb|CAG80718.1| YALI0D07414p [Yarrowia lipolytica]
          Length = 290

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/150 (28%), Positives = 60/150 (40%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  +IYRS+ P     E   K   +KSIL L   +PE +  E  +   +  IQ  
Sbjct: 131 NFSIVV-GQIYRSSFPRPENFE-YLKRLKLKSILVL---IPEIYPDENLQFMKENNIQFF 185

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E       D   + L   +  A  PLLIHC  G  RTG  S     +     
Sbjct: 186 QVGMSGNKEPFVHVPHDVITRALEIAINPANHPLLIHCNRGKHRTGCLSGCIRRLQ---- 241

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            + +   +   Y  F   K   +D  F ++
Sbjct: 242 -DWSLTMIFDEYRRFAYPKARPLDQQFIEL 270


>gi|145256757|ref|XP_001401506.1| tyrosine phosphatase [Aspergillus niger CBS 513.88]
 gi|134058415|emb|CAK47902.1| unnamed protein product [Aspergillus niger]
          Length = 225

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 57/144 (39%), Gaps = 15/144 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   IYRS+ P    +    K+ G+K+I+ L   + E +         + GI   
Sbjct: 40  NFGEVVKG-IYRSSFPYPWNL-TALKKLGLKTIITL---VDEPYPPSHVMFVKENGIAHH 94

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              + A ++      +    + L  +L  +  P+L+HC  G  RTG   A +  +   + 
Sbjct: 95  RILVQANKDPAVKIPDSVMCRILELLLDKSNHPILVHCNKGKHRTGCVVACFRKL-QAWD 153

Query: 158 KEEAHRQLSMLYGHFPVLKTITMD 181
             +   +    Y  +   K   +D
Sbjct: 154 SCDVIEE----YLRYAFPKPRLLD 173


>gi|123483784|ref|XP_001324104.1| Dual specificity protein phosphatase CDC14A [Trichomonas vaginalis
           G3]
 gi|121906981|gb|EAY11881.1| Dual specificity protein phosphatase CDC14A, putative [Trichomonas
           vaginalis G3]
          Length = 435

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 68/195 (34%), Gaps = 21/195 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L   Y  +  G       +             + + ++P ++   A P          
Sbjct: 142 HCLKGLYRAMQFGWYRPETFNSSETIYYEQVENGDMNWLIPGKLLAFASPYATNKIQGGY 201

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                  +  + +E GI  I+ L     + ++ E  K   + G +             ++
Sbjct: 202 TVSTPKELIPIFRERGITRIVRLC----QRFYDE--KLFVNAGFKHTELYFLDGSVPPND 255

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + + I+++    + +HCK+G  RTG  +A Y+     +  +EA   + +   G    
Sbjct: 256 ILNKFLDIIESHD-VIALHCKAGLGRTGTLAACYMIKDYGFDGDEAIGWIRICRPGSIIG 314

Query: 175 LKTITMDITFEKITQ 189
            +   +   +E I++
Sbjct: 315 PQQSYVLKFYELISK 329


>gi|76057138|emb|CAH19234.1| putative tyrosine phosphatase [Aspergillus niger]
          Length = 203

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 57/144 (39%), Gaps = 15/144 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   IYRS+ P    +    K+ G+K+I+ L   + E +         + GI   
Sbjct: 18  NFGEVVKG-IYRSSFPYPWNL-TALKKLGLKTIITL---VDEPYPPSHVMFVKENGIAHH 72

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              + A ++      +    + L  +L  +  P+L+HC  G  RTG   A +  +   + 
Sbjct: 73  RILVQANKDPAVKIPDSVMCRILELLLDKSNHPILVHCNKGKHRTGCVVACFRKL-QAWD 131

Query: 158 KEEAHRQLSMLYGHFPVLKTITMD 181
             +   +    Y  +   K   +D
Sbjct: 132 SCDVIEE----YLRYAFPKPRLLD 151


>gi|294651422|ref|ZP_06728736.1| phosphatase [Acinetobacter haemolyticus ATCC 19194]
 gi|292822668|gb|EFF81557.1| phosphatase [Acinetobacter haemolyticus ATCC 19194]
          Length = 197

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 16/173 (9%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +    +YRS QP+   I    K++ I +++NLR +              
Sbjct: 40  TLISNTHNFYQISQD-VYRSEQPDAELIAS-LKQHQIHTVINLRARNK----DANVFKDQ 93

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           D  +  I     A    +     + I   K   + +L+HC  G+DRTG   A+Y  I  +
Sbjct: 94  DFNLVHIPIYTWAINRDDLLTAMRAIQTAKQQNQKVLVHCYHGSDRTGATIAMYRIIFEN 153

Query: 156 YPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           +  E+A +++    YG+            ++ I  L+  +  K   +Q  N +
Sbjct: 154 WSIEDAVKEMKQGGYGYHV---------IWKNIEHLFTTDNVKWIQQQLSNPS 197


>gi|156537153|ref|XP_001603728.1| PREDICTED: similar to Dual specificity protein phosphatase CDC14A
           (CDC14 cell division cycle 14 homolog A) [Nasonia
           vitripennis]
          Length = 551

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 30/191 (15%), Positives = 56/191 (29%), Gaps = 16/191 (8%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L        LG   L       Y         + + +VP +      PN         
Sbjct: 216 DCLNALSKASSLGFFNLEDFDAREYEKYEQIKNGDLNWIVPRKFLAFLGPNTEQGTTSHY 275

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
                    +  + +++ L  K        E     + GI   +           + +KQ
Sbjct: 276 PEKYLNYFMKNEVAAVVRLNRKT------YESFRFTNAGILHYDIFFPDGTVPPKKVLKQ 329

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
            + I ++    + +HCK+G  RTG   A Y+         EA   L +   G     +  
Sbjct: 330 FLHIAESTRGAIAVHCKAGLGRTGTLIAAYVMKHYRMTAREAIAWLRICRPGSIIGHQQS 389

Query: 179 TMDITFEKITQ 189
            ++     + +
Sbjct: 390 WLEEMESSLWR 400


>gi|312212051|emb|CBX92135.1| similar to tyrosine-protein phosphatase SIW14 [Leptosphaeria
           maculans]
          Length = 273

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 67/165 (40%), Gaps = 15/165 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AVVP  IYRS+ P     E   K+  IKSI+ L   +PE    E +    + GIQ  
Sbjct: 92  NYGAVVPGMIYRSSYPEEKNYE-FLKDLKIKSIITL---VPEPLSPEYKDFMEEAGIQHF 147

Query: 103 NFPLSATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +  + A +      + +  + L  I+     P+LIHC  G  RTG   AV   I      
Sbjct: 148 HVHIRANKGEVRVESCDMSRALRLIMDRTNHPILIHCNKGKHRTGCTVAVLRRIFGKMSL 207

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
           +    +    Y  +  +K   +D   E   + +  N+      Q 
Sbjct: 208 DAIREE----YHTYAGVKARFLD---EVFFETFDLNLVMWMARQE 245


>gi|302661320|ref|XP_003022329.1| tyrosine phosphatase family protein [Trichophyton verrucosum HKI
           0517]
 gi|291186269|gb|EFE41711.1| tyrosine phosphatase family protein [Trichophyton verrucosum HKI
           0517]
          Length = 267

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 62/160 (38%), Gaps = 18/160 (11%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +     +  +K+I+ L   + E W  E      D GI  
Sbjct: 57  NNFAEVVKG-IYRSSFPLPVHLSS-LAQLNLKTIVTL---VDEEWSPEYSSFVRDNGITS 111

Query: 102 INFPLSATRELND-----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              P+ A ++ N        ++ L  +L T   P+++HC  G  RTG   A +      +
Sbjct: 112 RIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACFRKA-QGW 170

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVS 196
               A  +    Y +    KT T+D       Q +  N  
Sbjct: 171 TSVAAIAE----YIYHSAPKTRTLDR---NYIQEFDENTV 203


>gi|326469879|gb|EGD93888.1| hypothetical protein TESG_01419 [Trichophyton tonsurans CBS 112818]
 gi|326479102|gb|EGE03112.1| tyrosine phosphatase [Trichophyton equinum CBS 127.97]
          Length = 265

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 67/172 (38%), Gaps = 16/172 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +     +  +K+I+ L   + E W  E      D GI  
Sbjct: 55  NNFAEVVKG-IYRSSFPMPVHLSS-LAQLNLKTIVTL---VEEEWSPEYSAFVRDKGITS 109

Query: 102 INFPLSATRELND-----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              P+ A ++ N        ++ L  +L T   P+++HC  G  RTG   A +      +
Sbjct: 110 RIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACFRKA-QGW 168

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDI-TFEKITQLYPNNVSKGDTEQPMNAT 207
               A  +    Y +    KT T+D    ++  +    ++ K    Q    T
Sbjct: 169 TSVAAIAE----YIYHSAPKTRTLDRNYIQEFDESTVADLVKKTGAQKWLPT 216


>gi|321460315|gb|EFX71358.1| hypothetical protein DAPPUDRAFT_201727 [Daphnia pulex]
          Length = 335

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 59/203 (29%), Gaps = 24/203 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSA------------ 56
             L      I           +  Y         +F+ ++P +                 
Sbjct: 87  DCLHAIEKAIKFNFFDFSDFDVDEYEHYERVENGDFNWIIPGKFIAFCGPHSTKNEEEGA 146

Query: 57  -----QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
                Q          +EY + +I+ L  ++       +       G Q  +   +    
Sbjct: 147 LLLTRQHTPESYFNYFREYDVTTIVRLNKRI------YDAARFTRGGFQHRDLFFTDGST 200

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYG 170
            +D  +++ ++I +     + +HCK+G  RTG   A Y+         E+   L +   G
Sbjct: 201 PSDLIMERFLNISEATSGAVAVHCKAGLGRTGTLIACYMMKHYRMTAHESIAWLRICRPG 260

Query: 171 HFPVLKTITMDITFEKITQLYPN 193
                +   ++    K      N
Sbjct: 261 CVIGHQQTWVERLVGKYYMQNSN 283


>gi|157105881|ref|XP_001649066.1| protein phosphatase [Aedes aegypti]
 gi|108879975|gb|EAT44200.1| protein phosphatase [Aedes aegypti]
          Length = 313

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 53/174 (30%), Gaps = 10/174 (5%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVP-HEIYRSAQPNGTFIEYLK 67
             +      +  G           Y         +F+ +      Y              
Sbjct: 131 DCIHAVAKALDAGFFRFDDFDAQQYEYYERVENGDFNWISRLDNGY--PIHAPETYFEYF 188

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           ++Y + +I+ L  K+       +       G    +         ND  +K+ ++I + A
Sbjct: 189 RKYNVTTIIRLNVKI------YDAARFTSAGFTHHDLFFVDGSTPNDAILKKFLTICEQA 242

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
              + +HCK+G  RTG     YL    ++   EA   L +   G     +   M
Sbjct: 243 DGAIAVHCKAGLGRTGTLIGAYLIKHYNFNALEAIAWLRLCRPGSVIGHQQQWM 296


>gi|262371722|ref|ZP_06065001.1| protein tyrosine/serine phosphatase [Acinetobacter junii SH205]
 gi|262311747|gb|EEY92832.1| protein tyrosine/serine phosphatase [Acinetobacter junii SH205]
          Length = 194

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/172 (25%), Positives = 76/172 (44%), Gaps = 16/172 (9%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + + T NF+ +    +YRS QPN   +  L K+Y I++++NLR +        +      
Sbjct: 37  LISDTHNFYQISQD-VYRSEQPNSE-LIPLLKKYQIETVINLRARNE----DAKVLQNQS 90

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           L +  I     A    +  Q  Q I I K   + +L+HC  G+DRTG   A+Y  I  ++
Sbjct: 91  LNLVHIPIQTWAINRQDLLQAMQAIQIAKNNNQKVLVHCYHGSDRTGATIAMYRIIFENW 150

Query: 157 PKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             E A +++    YG+            ++ I  L+ +   +   +Q  N +
Sbjct: 151 SIENAVKEMKQGGYGYHI---------IWKNIENLFTSENVQWIQQQLSNPS 193


>gi|219125820|ref|XP_002183170.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405445|gb|EEC45388.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 298

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 60/198 (30%), Gaps = 23/198 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +    LG     +  +  Y         + + +V  +I   A P+         
Sbjct: 105 DCLRGMHKARSLGFYDEKSFDVEEYEHFEQVENGDLNWIVKDKILAFAGPSFERHVSPEG 164

Query: 60  -----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        +   ++ ++ L  K         E+     GI+ +            
Sbjct: 165 YCTLAPADYIPYFQRKKVELVVRLNKK------LYHEQDFEQAGIRHMEAFFIDGSCPPM 218

Query: 115 EQIKQLISILKTAP--KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGH 171
             ++Q++   ++ P  K   +HCK+G  RTG     YL     +   EA   + +   G 
Sbjct: 219 RILQQVLDGFESVPTGKAFAVHCKAGLGRTGTCIGAYLMKHYRFTAAEAIGWMRICRPGC 278

Query: 172 FPVLKTITMDITFEKITQ 189
               +   +     ++ Q
Sbjct: 279 VIGPQQHFLKQIESRMWQ 296


>gi|253567614|ref|ZP_04845025.1| tyrosine/serine phosphatase [Bacteroides sp. 1_1_6]
 gi|251841687|gb|EES69767.1| tyrosine/serine phosphatase [Bacteroides sp. 1_1_6]
          Length = 186

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 78/178 (43%), Gaps = 10/178 (5%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI 63
           I   ++  L  +I I++   V              +   N + +    +YRS QP+    
Sbjct: 2   IINNKRIWLGLFIGIVMSFSVYGQNINAEKITVPDSKLTNLYQIDSG-VYRSEQPSDADF 60

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
           +   ++YGI+ +LNLR +  +         A    I+L    + A    +++Q+   + I
Sbjct: 61  KA-LEKYGIREVLNLRNRHSDD------DEAAGTKIKLYRLKMKAHSV-SEDQLINALRI 112

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
           +K    P++ HC  G+DRTG   A+Y  +     K++A ++++   +G   + K I  
Sbjct: 113 IKNRKGPIVFHCHHGSDRTGAVCAMYRIVFQGVSKQKAIQEMTEGGFGFHRIYKNIIR 170


>gi|77920431|ref|YP_358246.1| hypothetical protein Pcar_2841 [Pelobacter carbinolicus DSM 2380]
 gi|77546514|gb|ABA90076.1| protein tyrosine/serine phosphatase [Pelobacter carbinolicus DSM
           2380]
          Length = 693

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/125 (32%), Positives = 66/125 (52%), Gaps = 8/125 (6%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N H +  + +YRSAQP  T ++   ++ GIK++LNLR          + KA  + G+  
Sbjct: 36  PNLHKLDEN-LYRSAQPTATGMKN-LEQMGIKTVLNLRS------FHSDRKAIGNTGLGY 87

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            +  + A     ++ I+ L  +      PLL+HC  GADRTG   AVY  +V  + KE+A
Sbjct: 88  EHLYMKAWHPEREDIIRFLRIVTDPERSPLLVHCLHGADRTGTMCAVYRIVVQGWTKEQA 147

Query: 162 HRQLS 166
            R+++
Sbjct: 148 LREMT 152


>gi|327294633|ref|XP_003232012.1| hypothetical protein TERG_07628 [Trichophyton rubrum CBS 118892]
 gi|326465957|gb|EGD91410.1| hypothetical protein TERG_07628 [Trichophyton rubrum CBS 118892]
          Length = 265

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 67/172 (38%), Gaps = 16/172 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +     +  +K+I+ L   + E W  E      D GI  
Sbjct: 55  NNFAEVVKG-IYRSSFPMPVHLSS-LAQLNLKTIVTL---VEEEWSPEYSAFVRDKGITS 109

Query: 102 INFPLSATRELND-----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              P+ A ++ N        ++ L  +L T   P+++HC  G  RTG   A +      +
Sbjct: 110 RIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCIMACFRKA-QGW 168

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDI-TFEKITQLYPNNVSKGDTEQPMNAT 207
               A  +    Y +    KT T+D    ++  +    ++ K    Q    T
Sbjct: 169 TSVAAIAE----YIYHSAPKTRTLDRNYIQEFDEGTVADLVKKTGAQKWLPT 216


>gi|288573895|ref|ZP_06392252.1| protein tyrosine/serine phosphatase [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288569636|gb|EFC91193.1| protein tyrosine/serine phosphatase [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 188

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 53/171 (30%), Positives = 89/171 (52%), Gaps = 7/171 (4%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEK 92
            L +     NFH V    +YRSAQ N   +    + + IKSI+NLRG      W++ E++
Sbjct: 16  LLYLRAV--NFHTVSKGVLYRSAQLNLDRLSRYVETHSIKSIVNLRGPQAGRRWYRREKE 73

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
            +   GI   +F LSA R++  +++ +++  ++ APKP+LIHC +GADRTGL +A++   
Sbjct: 74  FSLSKGIVHADFDLSAIRKIPVQELDRILEFMRNAPKPILIHCYAGADRTGLIAALWRLA 133

Query: 153 VAHYPKEEAH-RQLSMLYGHFPVLKTI---TMDITFEKITQLYPNNVSKGD 199
                  +A  RQL  + GHF  L       +   ++ +  +  +   +G 
Sbjct: 134 EDRDAPLQALNRQLCWMKGHFSTLHIGTNAMVRSFWDYVKHIQGDGPLRGR 184


>gi|118356199|ref|XP_001011358.1| Protein-tyrosine phosphatase containing protein [Tetrahymena
           thermophila]
 gi|89293125|gb|EAR91113.1| Protein-tyrosine phosphatase containing protein [Tetrahymena
           thermophila SB210]
          Length = 417

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/202 (12%), Positives = 65/202 (32%), Gaps = 20/202 (9%)

Query: 17  KILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP-------------NGTFI 63
            I L    +    L  Y         + + ++P +    + P                  
Sbjct: 182 AIKLKWFNVRDFKLRDYEYYERVENGDLNVIIPEKFIAFSGPSPTQRDADGYRTFTPEDY 241

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
             + K  G+  ++ L  K        E     + GI+ ++          D+ + + + +
Sbjct: 242 VPIFKNMGVTLVIRLNKKT------YEASRFTNNGIKHLDLYFLDGSCPPDDILHKFLDV 295

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDI 182
            +     + +HCK+G  RTG   A+Y      +P  +    + +   G     +   ++ 
Sbjct: 296 CQKEKGKIAVHCKAGLGRTGSLIAMYAMKHYRFPAADFIGWIRIARPGSILGPQQYYLNE 355

Query: 183 TFEKITQLYPNNVSKGDTEQPM 204
             +++ +   N+      +  +
Sbjct: 356 RQQEMWKAGENSPIWKSVKHLV 377


>gi|194665580|ref|XP_001788240.1| PREDICTED: CDC14 homolog A [Bos taurus]
          Length = 642

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 53/180 (29%), Gaps = 14/180 (7%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQP------NGT 61
             L      +  G        +  Y           H        Y    P         
Sbjct: 145 DCLQGIRKGLQHGFFDFETFDVDEYEHYEGFRVPGLHETTYVPFAYTCCFPLGYPLHAPE 204

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
                 K++ + +++ L  K+       E K   D G +  +         +D  +++ +
Sbjct: 205 AYFPYFKKHNVTAVVRLNKKI------YEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFL 258

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
           +I +     + +HCK+G  RTG   A Y+     +   E    + +   G     +   +
Sbjct: 259 NICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFL 318


>gi|240280078|gb|EER43582.1| tyrosine phosphatase [Ajellomyces capsulatus H143]
 gi|325088799|gb|EGC42109.1| tyrosine phosphatase [Ajellomyces capsulatus H88]
          Length = 254

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/147 (24%), Positives = 60/147 (40%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   +YRS+ P    ++       +K+I+ L   + E W  +  +     GI+  
Sbjct: 47  NFAEVVQG-VYRSSFPLPVHLDS-IARLNLKTIITL---VDEKWSPDYGEFIRKNGIKSH 101

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+ A +        +  I+ L  IL     P+LIHC  G  RTG   A +   V  + 
Sbjct: 102 VIPILANKAPQVSTPYETVIEVLKIILNPTNHPVLIHCNKGKHRTGCIIACFR-RVQGWS 160

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
              A ++    Y  +   K+  +D  +
Sbjct: 161 LMAALQE----YQKYSTPKSRVLDRIY 183


>gi|226954408|ref|ZP_03824872.1| phosphatase [Acinetobacter sp. ATCC 27244]
 gi|226834856|gb|EEH67239.1| phosphatase [Acinetobacter sp. ATCC 27244]
          Length = 196

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 72/172 (41%), Gaps = 16/172 (9%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +    +YRS QP+   I    K++ I +++NLR +              
Sbjct: 40  TLISNTHNFYQISQD-VYRSEQPDAELIAS-LKQHQIHTVINLRARNK----DANVFKDQ 93

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           D  +  I     A    +     + I   K   + +L+HC  G+DRTG   A+Y  I  +
Sbjct: 94  DFNLVHIPIYTWAINRDDLLTAMRAIQTAKQQNQKVLVHCYHGSDRTGATIAMYRIIFEN 153

Query: 156 YPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
           +  E+A +++    YG+            ++ I  L+  +  K   +Q  N 
Sbjct: 154 WSIEDAVKEMKQGGYGYHV---------IWKNIEHLFTTDNVKWIQQQLSNP 196


>gi|118387743|ref|XP_001026974.1| hypothetical protein TTHERM_00688720 [Tetrahymena thermophila]
 gi|89308744|gb|EAS06732.1| hypothetical protein TTHERM_00688720 [Tetrahymena thermophila
           SB210]
          Length = 465

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 62/187 (33%), Gaps = 20/187 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      I LG   L   +L  Y         + + ++P++    + P          
Sbjct: 176 DCLKGLEKAISLGWFSLETFNLVQYTNMYLFENGDMNWIIPNKFLAFSNPYATQYDKANR 235

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                  I    ++ GI+ I+ L  +      + +     + GI   +   +     +D+
Sbjct: 236 RRCTVEDIIPKFQQLGIERIVRLNSE------EYDANKFVENGISHTDLYFADGSAPSDD 289

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + + + + +     + +HCK+G  RTG   A Y      +P       + +   G    
Sbjct: 290 VVLKFLKVSEETKGKIAVHCKAGLGRTGTLIACYAMKHFKFPARAFIGWIRLCRPGSIHG 349

Query: 175 LKTITMD 181
            +   ++
Sbjct: 350 PQNTFLN 356


>gi|307110913|gb|EFN59148.1| hypothetical protein CHLNCDRAFT_18957 [Chlorella variabilis]
          Length = 324

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/184 (14%), Positives = 61/184 (33%), Gaps = 20/184 (10%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN----------- 59
           +   Y    +G+     + L  Y         + + +VP +    + P+           
Sbjct: 147 IAGMYRAKEVGLYRGEQLDLEEYEHYEQVENGDLNWIVPGKFMAFSGPSAQPKHFGGWRT 206

Query: 60  --GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
                     +E+ + +++ L  K+       E       G++            +++ +
Sbjct: 207 YMPEDYIEYFREHNVGAVVRLNKKM------YEASRFTQYGVRHHEMYFPDGTCPSEQIL 260

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLK 176
            + +   +  P  L +HCK+G  RTG+    Y+     +  EEA   + +   G     +
Sbjct: 261 LRFLDTAEREPGALAVHCKAGLGRTGVLICSYMIKHFGFSAEEAMGYIRVCRPGSVIGPQ 320

Query: 177 TITM 180
              +
Sbjct: 321 QHYL 324


>gi|145510654|ref|XP_001441260.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124408499|emb|CAK73863.1| unnamed protein product [Paramecium tetraurelia]
          Length = 407

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/196 (15%), Positives = 68/196 (34%), Gaps = 21/196 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      I L    +   +L  Y         + + ++P+++   + P          
Sbjct: 144 HCLRGLEYAIKLKWFDVRKFNLRDYEFYERVDNGDLNWIIPNKLIAFSGPSATQKDADGN 203

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     + K++ +  ++ L  K      + EE+     GI+  +          D+
Sbjct: 204 RTFTPEDYVPIFKQFEVTCVVRLNKK------QYEEQRFIKNGIKHEDIYFLDGSVPGDD 257

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
           +I + + I +   K + +HCK+G  RTG   A Y      +P ++    + +   G    
Sbjct: 258 KILRFLEIAE-REKAVAVHCKAGLGRTGTLIAAYAMKHYKFPAQDFIGWIRICRPGSILG 316

Query: 175 LKTITMDITFEKITQL 190
            + I +    + +  L
Sbjct: 317 PQQIFLLQKQDWLIDL 332


>gi|225560519|gb|EEH08800.1| tyrosine phosphatase [Ajellomyces capsulatus G186AR]
          Length = 254

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/147 (24%), Positives = 60/147 (40%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   +YRS+ P    ++       +K+I+ L   + E W  +  +     GI+  
Sbjct: 47  NFAEVVQG-VYRSSFPLPVHLDS-IARLNLKTIITL---VDEKWSPDYGEFIRKNGIKSH 101

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+ A +        +  I+ L  IL     P+LIHC  G  RTG   A +   V  + 
Sbjct: 102 VIPILANKAPQVSTPYETVIEVLKIILNPMNHPVLIHCNKGKHRTGCIIACFR-RVQGWS 160

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
              A ++    Y  +   K+  +D  +
Sbjct: 161 LMAALQE----YQKYSTPKSRVLDRIY 183


>gi|241759893|ref|ZP_04757993.1| protein tyrosine/serine phosphatase [Neisseria flavescens SK114]
 gi|241319901|gb|EER56297.1| protein tyrosine/serine phosphatase [Neisseria flavescens SK114]
          Length = 196

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/150 (30%), Positives = 71/150 (47%), Gaps = 9/150 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + +   ++YRS QP     E + K  GI+S++NLR          ++      G+ L+
Sbjct: 43  NLYRI-DDKLYRSEQPVAEDGEAIVK-LGIQSVINLRFFDR-----NDDDYLKAYGLTLL 95

Query: 103 NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL +      E  + L  I  +     +LIHC  GADRTGL + +Y  I   +  EEA
Sbjct: 96  NRPLLSWSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRIIYQGWTVEEA 155

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQL 190
             ++    YG+  + K I    T EK+ Q+
Sbjct: 156 KAEMQHGPYGYHSIWKNIANLFTEEKVKQV 185


>gi|91087805|ref|XP_967596.1| PREDICTED: similar to CDC14 cell division cycle 14 homolog A (S.
           cerevisiae), a [Tribolium castaneum]
 gi|270009373|gb|EFA05821.1| hypothetical protein TcasGA2_TC008603 [Tribolium castaneum]
          Length = 425

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 58/182 (31%), Gaps = 16/182 (8%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                    +   +      ++  Y +       N + ++P +      P          
Sbjct: 145 DCFSGVAKALQYNLFDFTDFNVQEYDVCDQVEKGNMNWIIPRKFLAFLGPTEPRVGVGHT 204

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
             F      ++ +K+++ L  K        +      +GI+  +         + + +  
Sbjct: 205 PGFYLEYFLQHDVKTVIRLNDK------LYDSSVFTRMGIEHHDLFFDDGSVPSMDILLS 258

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
            + I +TAP  + +HCK+G  RTG     YL        +EA   L +   G     +  
Sbjct: 259 FLRITETAPAAIAVHCKAGLGRTGTLIGAYLMKHYSMTAKEAVAWLRVCRPGSVTGAQQA 318

Query: 179 TM 180
            +
Sbjct: 319 YL 320


>gi|121706671|ref|XP_001271591.1| tyrosine phosphatase family protein [Aspergillus clavatus NRRL 1]
 gi|119399739|gb|EAW10165.1| tyrosine phosphatase family protein [Aspergillus clavatus NRRL 1]
          Length = 233

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 66/169 (39%), Gaps = 18/169 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   IYRS+ P    +    K+  +K I+     +   + ++ +    + GI+  
Sbjct: 44  NFGEVVQG-IYRSSFPQPWHL-PALKKLNLKMIVTF---VEGEYTRDHQVFLKENGIEHR 98

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              + A ++      +      L  +L  A  P+L+HC  G  RTG     +  +   + 
Sbjct: 99  RILVQANKDPAVRTPDHIVNYILEILLNKANHPMLVHCNKGRHRTGCIIGCFRKL-QGWD 157

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI---TQLYPNNVSKGDTEQP 203
                 +    Y +F   K+ ++D  F  +   T+L P  +S      P
Sbjct: 158 MAAIIEE----YLNFSWPKSRSLDEIFITLFDETRLRPLALSVDAPSWP 202


>gi|302500224|ref|XP_003012106.1| tyrosine phosphatase family protein [Arthroderma benhamiae CBS
           112371]
 gi|291175662|gb|EFE31466.1| tyrosine phosphatase family protein [Arthroderma benhamiae CBS
           112371]
          Length = 366

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 62/167 (37%), Gaps = 18/167 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +     +  +K+I+ L   + E W  E        GI  
Sbjct: 156 NNFAEVVKG-IYRSSFPLPVHLSS-LAQLNLKTIVTL---VDEEWSPEYSAFVRGNGITS 210

Query: 102 INFPLSATRELND-----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              P+ A ++ N        ++ L  +L T   P+++HC  G  RTG   A +      +
Sbjct: 211 RIIPILANKQPNVFTPYSTIVEVLTILLDTRNHPVMVHCNKGKHRTGCVMACFRKA-QGW 269

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
               A  +    Y +    KT T+D       Q +  +       + 
Sbjct: 270 TSVAAIAE----YIYHSAPKTRTLDR---NYIQEFDESTVADLVRRT 309


>gi|298384534|ref|ZP_06994094.1| protein tyrosine/serine phosphatase [Bacteroides sp. 1_1_14]
 gi|298262813|gb|EFI05677.1| protein tyrosine/serine phosphatase [Bacteroides sp. 1_1_14]
          Length = 186

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 77/178 (43%), Gaps = 10/178 (5%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI 63
           I   ++  L  +I I++   V              +   N + +    +YRS QP+    
Sbjct: 2   IINNKRIWLGLFIGIVMSFSVYGQNINAEKITVPDSKLTNLYQIDSG-VYRSEQPSDADF 60

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
           +   ++YGI+ +LNLR +  +         A    I+L    + A    ++ Q+   + I
Sbjct: 61  KA-LEKYGIREVLNLRNRHSDD------DEAAGTKIKLYRLKMKAHSV-SEGQLINALRI 112

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
           +K    P++ HC  G+DRTG   A+Y  +     K++A ++++   +G   + K I  
Sbjct: 113 IKNRKGPIVFHCHHGSDRTGAVCAMYRIVFQGVSKQKAIQEMTEGGFGFHRIYKNIIR 170


>gi|168053205|ref|XP_001779028.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669590|gb|EDQ56174.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 182

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 62/153 (40%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN   +    ++  ++S++ L    PE + +   +     GI++ 
Sbjct: 13  NFAMVDKG-VYRSGYPNKKNL-PFLQKLRLRSVVYL---CPEPYPEANIEFMEKNGIKMF 67

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +F +   +E   +  + +I      +L    +P+LIHC  G  RTG         V ++ 
Sbjct: 68  HFGIEGNKEPFVDIPENVIRDALKVLLDVKNQPILIHCNKGKHRTGCLVGCLR-KVQNWS 126

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K   +D  F ++  +
Sbjct: 127 ----LTSIFDEYRRFAGAKVRMLDQQFMELFDI 155


>gi|261331354|emb|CBH14348.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 321

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 65/171 (38%), Gaps = 19/171 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P         +  G+++I+ L    PE + +   K   + GI + 
Sbjct: 20  NFAMVCPG-VYRSGYPTRKNY-RFIRALGLRTIIYL---CPEDYAESNVKFCEESGITIR 74

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F     +E   +  + L+      ++ T   P+LIHC  G  RTG  +A    +   + 
Sbjct: 75  RFATEGNKEPFMDISEPLMHRILSALIDTRLHPVLIHCNKGKHRTGTVAACLRLL-QGWS 133

Query: 158 KEEAHRQLSMLYGHFPVLKTITMD----ITFEKITQLYPNNVSKGDTEQPM 204
                ++    Y  F   K    D      +  I ++ P  V+      P+
Sbjct: 134 LVSIFQE----YRSFAGDKVRMGDMQYVELYRPIVRISPPYVADWVCITPV 180


>gi|71744982|ref|XP_827121.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70831286|gb|EAN76791.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 321

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 65/171 (38%), Gaps = 19/171 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P         +  G+++I+ L    PE + +   K   + GI + 
Sbjct: 20  NFAMVCPG-VYRSGYPTRKNY-RFIRALGLRTIIYL---CPEDYAESNVKFCEESGITIR 74

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F     +E   +  + L+      ++ T   P+LIHC  G  RTG  +A    +   + 
Sbjct: 75  RFATEGNKEPFMDISEPLMHRILSALIDTRLHPVLIHCNKGKHRTGTVAACLRLL-QGWS 133

Query: 158 KEEAHRQLSMLYGHFPVLKTITMD----ITFEKITQLYPNNVSKGDTEQPM 204
                ++    Y  F   K    D      +  I ++ P  V+      P+
Sbjct: 134 LVSIFQE----YRSFAGDKVRMGDMQYVELYRPIVRISPPYVADWVCITPV 180


>gi|218782027|ref|YP_002433345.1| protein tyrosine/serine phosphatase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763411|gb|ACL05877.1| protein tyrosine/serine phosphatase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 194

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/200 (21%), Positives = 83/200 (41%), Gaps = 22/200 (11%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTF-------TQNFHAVVPHEIY 53
           M+  K   +   +F+  +   + +  A S       +            N + V    +Y
Sbjct: 1   MMNKKLSNRVFCLFHCAV---LFLFLAASCWADDACLDVAQCKELPGMSNMYQV-SDSLY 56

Query: 54  RSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELN 113
           R AQP     +   + +GIK+++NLR    +  +      A D  + L+  P+       
Sbjct: 57  RGAQPKAEGFKS-LEAHGIKTVVNLRITQGDERY------AGDTSMNLVGIPMFPWEPEE 109

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS---MLYG 170
           ++ I+ L      A  P+ +HC+ G+DRTG  +A Y  +V  +P E+A  +++     Y 
Sbjct: 110 EDVIQFLRLTQDPATAPVFLHCRHGSDRTGALTACYRVVVCGWPLEQAVEEMTKGGFGYH 169

Query: 171 HFPVLKTITM-DITFEKITQ 189
                    + D+ F++I +
Sbjct: 170 PIWWTLPRDLEDLDFDRIRR 189


>gi|253748142|gb|EET02468.1| Dual specificity protein phosphatase CDC14A [Giardia intestinalis
           ATCC 50581]
          Length = 609

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 55/200 (27%), Gaps = 20/200 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      +  G+  L       Y+        +   ++  +    A P          
Sbjct: 141 DCLFAMEKAMSKGLFNLNTFKYDDYYFYSQVENGDLTWMLLDKFVAFAGPVSQSHPFFRY 200

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     L +   I +++ L                   GI   + P        D+
Sbjct: 201 HPFTPASYIPLFQSRNITAVIRLNEAC------YNRADFIKAGIHHYDLPFPDGSCPPDK 254

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPV 174
            IKQ I I       + +HCK+G  RTG   A+Y+     +   E    L  +  G    
Sbjct: 255 IIKQFIEITDKETGGVAVHCKAGLGRTGSLIALYMMQRYDFTGREIIAWLRILRPGSILG 314

Query: 175 LKTITMDITFEKITQLYPNN 194
            +   +     KI   Y   
Sbjct: 315 QQQQFLISMESKIKAYYRQK 334


>gi|50408578|ref|XP_456793.1| DEHA2A10582p [Debaryomyces hansenii CBS767]
 gi|49652457|emb|CAG84762.1| DEHA2A10582p [Debaryomyces hansenii]
          Length = 270

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 45/168 (26%), Positives = 72/168 (42%), Gaps = 16/168 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+ ++IYRS+ P  +      K+  +KSIL L   +PE + +E E+      I+L 
Sbjct: 110 NFAPVI-NKIYRSSFPQPSNF-PFVKKLKLKSILCL---IPEDYPEEHEQFLEKENIKLF 164

Query: 103 NFPLSATRELNDEQIKQLI-----SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E   +    LI      +L  A +P+LIHC  G  RTG    V   +   + 
Sbjct: 165 QLGMSGNKEPFVKISHNLITEAIKIVLNPANQPILIHCNRGKHRTGCLVGVLRRL-QKWS 223

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPM 204
                  +   Y  F   K   MD  F E   ++     +K ++  P+
Sbjct: 224 LTI----IFDEYRKFAAPKERPMDQQFIELYNEVELEEYAKENSLLPI 267


>gi|299146344|ref|ZP_07039412.1| protein tyrosine/serine phosphatase [Bacteroides sp. 3_1_23]
 gi|298516835|gb|EFI40716.1| protein tyrosine/serine phosphatase [Bacteroides sp. 3_1_23]
          Length = 196

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 47/194 (24%), Positives = 86/194 (44%), Gaps = 10/194 (5%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           +I I   +K + +  + I+L V +          +   +   N + +    +YRS QP+ 
Sbjct: 5   IISILLMQKQIPLCLLAIVLSVSLFGQNLKADKIILFDSDLTNLYQIDSG-VYRSEQPSK 63

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
              +   ++YGI  +LNLR +  +         A    I+L      A   ++++Q+ Q 
Sbjct: 64  EGFKA-LEKYGIGEVLNLRNRHSDD------DEAKGTSIKLHRVKTKA-HSISEKQLIQA 115

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTIT 179
           + I+K    P++ HC  G+DRTG+  A Y  I  +  KE+A  +++   YG   + K I 
Sbjct: 116 LRIIKNRKAPIVFHCHHGSDRTGVVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNII 175

Query: 180 MDITFEKITQLYPN 193
             I    + Q+   
Sbjct: 176 RRIKEANVEQIRKE 189


>gi|251792715|ref|YP_003007441.1| protein tyrosine/serine phosphatase [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534108|gb|ACS97354.1| protein tyrosine/serine phosphatase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 204

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 48/161 (29%), Positives = 74/161 (45%), Gaps = 8/161 (4%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
            ++ T+ +  +N + +     YRS Q +    E L  +  IK+I+NLR          +E
Sbjct: 42  EHWATVISENENLYRI-DDNFYRSEQLD-RQAEPLLNKLNIKTIVNLRFFDR----NNDE 95

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYL 150
           +A     I LIN PL        E    L  I +     P+L+HC  GADRTGL  A+Y 
Sbjct: 96  QAFGHKNINLINTPLLTWSINTREVADILWQIRQHQKDGPVLVHCYHGADRTGLIVAMYR 155

Query: 151 YIVAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQL 190
            I  ++   EA R++    YG+  + K I    T E + ++
Sbjct: 156 VIYQNWDLNEAKREMQQAPYGYHSIWKNIDNFFTEENVAKI 196


>gi|308157762|gb|EFO60827.1| Dual specificity protein phosphatase CDC14A [Giardia lamblia P15]
          Length = 611

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 55/200 (27%), Gaps = 20/200 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      +  G+  L       Y+        +   ++  +    A P          
Sbjct: 141 DCLFAMEKAMSKGLFNLNTFKYDDYYFYSQVENGDLTWMLLDKFVAFAGPVSQSHPFFRY 200

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     L +   I +++ L                   GI   + P        D+
Sbjct: 201 HPFTPASYIPLFQSRNITAVIRLNEAC------YNRTDFIKAGIHHYDLPFPDGSCPPDK 254

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPV 174
            IKQ I I       + +HCK+G  RTG   A+Y+     +   E    L  +  G    
Sbjct: 255 IIKQFIEITDKETGGVAVHCKAGLGRTGSLIALYMMQRYDFTGREIIAWLRILRPGSILG 314

Query: 175 LKTITMDITFEKITQLYPNN 194
            +   +     KI   Y   
Sbjct: 315 QQQQFLISMESKIKAYYRQK 334


>gi|159116377|ref|XP_001708410.1| Dual specificity protein phosphatase CDC14A [Giardia lamblia ATCC
           50803]
 gi|157436521|gb|EDO80736.1| Dual specificity protein phosphatase CDC14A [Giardia lamblia ATCC
           50803]
          Length = 610

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/200 (16%), Positives = 55/200 (27%), Gaps = 20/200 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      +  G+  L       Y+        +   ++  +    A P          
Sbjct: 141 DCLFAMEKAMSKGLFNLNTFKYDDYYFYSQVENGDLTWMLLDKFVAFAGPVSQSHPFFRY 200

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     L +   I +++ L                   GI   + P        D+
Sbjct: 201 HPFTPASYIPLFQSRNITAVIRLNEAC------YNRTDFIKAGIHHYDLPFPDGSCPPDK 254

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPV 174
            IKQ I I       + +HCK+G  RTG   A+Y+     +   E    L  +  G    
Sbjct: 255 IIKQFIEITDKETGGVAVHCKAGLGRTGSLIALYMMQRYDFTGREIIAWLRILRPGSILG 314

Query: 175 LKTITMDITFEKITQLYPNN 194
            +   +     KI   Y   
Sbjct: 315 QQQQFLISMESKIKAYYRQK 334


>gi|261381013|ref|ZP_05985586.1| protein tyrosine/serine phosphatase [Neisseria subflava NJ9703]
 gi|284796046|gb|EFC51393.1| protein tyrosine/serine phosphatase [Neisseria subflava NJ9703]
          Length = 196

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/150 (29%), Positives = 71/150 (47%), Gaps = 9/150 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + +   ++YRS QP     E + K  GI+S++NLR          ++      G+ L+
Sbjct: 43  NLYRI-DDKLYRSEQPVAEDGEAIVK-LGIQSVINLRFFDR-----NDDDHLKAHGLTLL 95

Query: 103 NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL +      E  + L  I  +     +LIHC  GADRTGL + +Y  I   +  ++A
Sbjct: 96  NRPLLSWSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRIIYQGWSVDDA 155

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQL 190
             ++    YG+  + K I    T EK+ Q+
Sbjct: 156 KAEMQHGPYGYHSIWKNIAKLFTEEKVKQV 185


>gi|288576374|ref|ZP_05978680.2| protein tyrosine/serine phosphatase [Neisseria mucosa ATCC 25996]
 gi|288565650|gb|EFC87210.1| protein tyrosine/serine phosphatase [Neisseria mucosa ATCC 25996]
          Length = 203

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/196 (24%), Positives = 77/196 (39%), Gaps = 24/196 (12%)

Query: 7   PRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAV----------VPHEIYRSA 56
            ++ + I +   LL      +           T      AV          +  ++YRS 
Sbjct: 2   MKRTIPIIFSAFLLAACQASST------QETRTMNTRLWAVSVKQDANLYRIDDKLYRSE 55

Query: 57  QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
           QP          + GIKS++NLR          ++      GI +IN PL +      + 
Sbjct: 56  QPVPED-GETISQQGIKSVVNLRFFDR-----NDDDYLKQYGINIINRPLLSWNVKPKDI 109

Query: 117 IKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPV 174
            + L  I  +     +LIHC  GADRTGL + +Y  +   +  EEA  ++    YG+  +
Sbjct: 110 AEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRILYQGWQIEEAKAEMQHGPYGYHSI 169

Query: 175 LKTITMDITFEKITQL 190
            K I    T  KI ++
Sbjct: 170 WKNIANLFTEAKIQEV 185


>gi|145547284|ref|XP_001459324.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124427148|emb|CAK91927.1| unnamed protein product [Paramecium tetraurelia]
          Length = 401

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 62/186 (33%), Gaps = 21/186 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      I L    +   +L  Y         + + +VP++    + P          
Sbjct: 146 HCLRGLEYAIKLKWFDVRKFNLRDYEFYERVENGDLNWIVPNKFIAFSGPSATQKDADGN 205

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     + K++G+  ++ L  K        EE+     GI+             D+
Sbjct: 206 RTFTPEEYVPIFKQFGVTCVVRLNKK------AYEEQRFIKNGIKHEEIYFLDGSVPGDD 259

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
           +I + + I +     + +HCK+G  RTG   A Y+     +P  +    + +   G    
Sbjct: 260 KILRFLEIAEKEN-VVAVHCKAGLGRTGTLIAAYVIKHYRFPAPDFIGWIRICRPGSILG 318

Query: 175 LKTITM 180
            + I +
Sbjct: 319 PQQIFL 324


>gi|213403272|ref|XP_002172408.1| tyrosine-protein phosphatase SIW14 [Schizosaccharomyces japonicus
           yFS275]
 gi|212000455|gb|EEB06115.1| tyrosine-protein phosphatase SIW14 [Schizosaccharomyces japonicus
           yFS275]
          Length = 244

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/192 (20%), Positives = 66/192 (34%), Gaps = 40/192 (20%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P  +YRS  P+         +  I+SIL+LR    E +  EE        IQ 
Sbjct: 64  PNFGVVCPGLVYRSGCPS-LQAFPFLHQLHIRSILSLRQ---EEYTDEELAYMRQNNIQY 119

Query: 102 INFPLSATR-----------------------------ELNDEQIKQLISILKTAPKPLL 132
            +  +  ++                             +++    K L  +L +   P+L
Sbjct: 120 FHIAMPGSKLRKNGSSTSSSSATSTSNSTEVAGEFNDIDIDALVHKALSVLLDSKNLPIL 179

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
           +HC  G  RTG+    +  +   +  E+   +    Y  +   K   +D   E I    P
Sbjct: 180 VHCSGGKHRTGIVIGCFRAL-LGWQPEKRLEE----YSRYSHPKERDIDE--EYIRNFTP 232

Query: 193 NNVSKGDTEQPM 204
           +    G    P+
Sbjct: 233 DWSKHGYRRAPL 244


>gi|239610794|gb|EEQ87781.1| tyrosine phosphatase [Ajellomyces dermatitidis ER-3]
          Length = 255

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/159 (25%), Positives = 66/159 (41%), Gaps = 17/159 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   +YRS+ P    ++       +K+I+ L   + E W  +  +   + GI+  
Sbjct: 47  NFAEVVKG-VYRSSFPLPVHLDS-ISRLNLKTIITL---VDEEWSHDYGEFIQENGIKSY 101

Query: 103 NFPLSATR-----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+ A +        +  I+ L+ IL     P+LIHC  G  RTG   A +   V  + 
Sbjct: 102 VIPILANKNPLVFTPYETVIEVLMLILNPMNHPVLIHCNKGKHRTGCVIACFR-RVQGWS 160

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVS 196
              A ++    Y      K+  +D     I    PN++S
Sbjct: 161 LMAALQE----YQKHSTPKSRVLDR--NYIEGFDPNSLS 193


>gi|160883262|ref|ZP_02064265.1| hypothetical protein BACOVA_01231 [Bacteroides ovatus ATCC 8483]
 gi|260171024|ref|ZP_05757436.1| hypothetical protein BacD2_04084 [Bacteroides sp. D2]
 gi|156111246|gb|EDO12991.1| hypothetical protein BACOVA_01231 [Bacteroides ovatus ATCC 8483]
          Length = 196

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/194 (24%), Positives = 85/194 (43%), Gaps = 10/194 (5%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60
           +I I   +K + +  + I+L V +          +   +   N + +    +YRS QP+ 
Sbjct: 5   IISILLMQKQIPLCLLAIVLSVSLFGQNLKADKIILSDSDLTNLYQIDSG-VYRSEQPSK 63

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
              +   ++YGI  +LNLR +  +         A    I+L      A   ++++Q+ Q 
Sbjct: 64  EGFKA-LEKYGIGEVLNLRNRHSDD------DEAKGTSIKLHRVKTKA-HSISEKQLIQA 115

Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTIT 179
           + I+K    P++ HC  G+DRTG   A Y  I  +  KE+A  +++   YG   + K I 
Sbjct: 116 LRIIKNRKAPIVFHCHHGSDRTGAVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNII 175

Query: 180 MDITFEKITQLYPN 193
             I    + Q+   
Sbjct: 176 RRIKEANVEQIRKE 189


>gi|315056643|ref|XP_003177696.1| tyrosine-protein phosphatase SIW14 [Arthroderma gypseum CBS 118893]
 gi|311339542|gb|EFQ98744.1| tyrosine-protein phosphatase SIW14 [Arthroderma gypseum CBS 118893]
          Length = 265

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 64/160 (40%), Gaps = 18/160 (11%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   +YRS+ P    +     +  +K+I+ L   + E W  E      + GI  
Sbjct: 55  NNFAEVVKG-VYRSSFPMSVHLSS-LAQLNLKTIVTL---VEEEWSPEYSAFVREKGITS 109

Query: 102 INFPLSATRELND-----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              P+ A ++ +        ++ L  +L T   P+L+HC  G  RTG   A +      +
Sbjct: 110 RIIPILANKQPDVFTPFSTIVEVLTILLDTRNHPILVHCNKGKHRTGCVMACFRKA-QGW 168

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVS 196
               A  +    Y ++   KT T+D       Q +  ++ 
Sbjct: 169 NSVSAIAE----YIYYSAPKTRTLDR---NYIQEFDESLV 201


>gi|145482559|ref|XP_001427302.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124394382|emb|CAK59904.1| unnamed protein product [Paramecium tetraurelia]
          Length = 401

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 62/186 (33%), Gaps = 21/186 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      I L    +   +L  Y         + + +VP++    + P          
Sbjct: 146 HCLRGLEYAIKLKWFDVRKFNLRDYEFYERVENGDLNWIVPNKFIAFSGPSATQKDADGN 205

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     + K++G+  ++ L  K        EE+     GI+             D+
Sbjct: 206 RTFTPEEYVPIFKQFGVTCVVRLNKK------AYEEQRFIKNGIKHEEIYFLDGSVPGDD 259

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
           +I + + I +     + +HCK+G  RTG   A Y+     +P  +    + +   G    
Sbjct: 260 KILRFLEIAEKEN-VVAVHCKAGLGRTGTLIAAYVIKHYRFPAPDFIGWIRICRPGSILG 318

Query: 175 LKTITM 180
            + I +
Sbjct: 319 PQQIFL 324


>gi|260943213|ref|XP_002615905.1| hypothetical protein CLUG_04787 [Clavispora lusitaniae ATCC 42720]
 gi|238851195|gb|EEQ40659.1| hypothetical protein CLUG_04787 [Clavispora lusitaniae ATCC 42720]
          Length = 278

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/150 (26%), Positives = 60/150 (40%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+ + IYRS+ P         K   +KS+L L   +PE + +         GIQL 
Sbjct: 118 NFAPVI-NNIYRSSFPQPPSFA-FLKTLNLKSVLCL---IPEEYPQTHTDFFAREGIQLF 172

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E      +D   +    +L  A +P+LIHC  G  RTG    +   +   + 
Sbjct: 173 QLGMSGNKEPFVIISSDLITEAAKIVLNPANQPILIHCNRGKHRTGCLVGILRRL-QGWS 231

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   MD  F ++
Sbjct: 232 LTI----IFDEYRKFAAPKERPMDQQFIEL 257


>gi|322488043|emb|CBZ23288.1| putative tyrosine phosphatase [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 292

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 66/170 (38%), Gaps = 19/170 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + GI ++
Sbjct: 16  NFSMVCPG-VYRSGYPTKKNYAFLCA-LRLRSILYL---CPEDYAESNLKFCEENGIHVL 70

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            FP    +E   +  + L+      I  T   PLLIHC  G  RTG   A   ++   + 
Sbjct: 71  RFPTEGNKEPFCDISEPLMHRILGAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QGWS 129

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEK----ITQLYPNNVSKGDTEQP 203
                  +   Y  F   K    D  + +    I +L P  V+   T  P
Sbjct: 130 ----LVSIFEEYKRFASDKARVGDQQYVELYHPIVKLTPPFVASWVTVTP 175


>gi|327350326|gb|EGE79183.1| tyrosine phosphatase [Ajellomyces dermatitidis ATCC 18188]
          Length = 255

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 64/157 (40%), Gaps = 18/157 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   +YRS+ P    ++       +K+I+ L   + E W ++  +   + GI+  
Sbjct: 47  NFAEVVKG-VYRSSFPLPVHLDS-ISRLNLKTIITL---VDEEWSRDYGEFIQENGIKSY 101

Query: 103 NFPLSATR-----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+ A +        +  I+ L+ IL     P+LIHC  G  RTG   A +   V  + 
Sbjct: 102 VIPILANKNPLVFTPYETVIEVLMLILNPMNHPVLIHCNKGKHRTGCVIACFR-RVQGWS 160

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
              A ++    Y      K+  +D       + +  N
Sbjct: 161 LMAALQE----YQKHSTPKSRVLDR---NYIEGFDQN 190


>gi|154278639|ref|XP_001540133.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150413718|gb|EDN09101.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 264

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   +YRS+ P    ++       +K+I+ L   + E W  +  +     GI+  
Sbjct: 57  NFAEVVQG-VYRSSFPLPVHLDS-IARLNLKTIVTL---VDEKWSPDYGEFIRKNGIKSH 111

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+ A +        +  I+ L  IL     P+LIHC  G  RTG   A +   V  + 
Sbjct: 112 VIPILANKAPQVSTPYETVIEVLKIILNPTNHPVLIHCNKGKHRTGCIIACFR-RVQGWS 170

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
              + ++    Y  +   K+  +D  +
Sbjct: 171 LMASLQE----YQKYSTPKSRVLDRIY 193


>gi|134113933|ref|XP_774214.1| hypothetical protein CNBG1960 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256849|gb|EAL19567.1| hypothetical protein CNBG1960 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 279

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 57/155 (36%), Gaps = 15/155 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YR   P     +++ +   +K++L L     E + K   +      IQ +
Sbjct: 84  NFALVSSG-VYRCGFPKKRNFKFM-ETLRLKTVLTLVL---EEYPKANLEWCQSQDIQFM 138

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E  D   + +I      IL     P+LIHC  G  RTG        +     
Sbjct: 139 QFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTGCLIGCIRRLQ---- 194

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
              +   +   Y  F   K+  +D  F  +  + P
Sbjct: 195 -AWSLTSIFDEYRRFSAPKSRAVDQQFIDLFDIMP 228


>gi|321261553|ref|XP_003195496.1| tyrosine phosphatase; Siw14p [Cryptococcus gattii WM276]
 gi|317461969|gb|ADV23709.1| Tyrosine phosphatase, putative; Siw14p [Cryptococcus gattii WM276]
          Length = 281

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 57/155 (36%), Gaps = 15/155 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YR   P     +++ +   +K++L L     E + K   +      IQ +
Sbjct: 86  NFALVSSG-VYRCGFPKKRNFKFM-ETLRLKTVLTLVL---EEYPKANLEWCQSQDIQFM 140

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E  D   + +I      IL     P+LIHC  G  RTG        +     
Sbjct: 141 QFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTGCLIGCIRRLQ---- 196

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
              +   +   Y  F   K+  +D  F  +  + P
Sbjct: 197 -AWSLTSIFDEYRRFSAPKSRAVDQQFIDLFDIMP 230


>gi|58269578|ref|XP_571945.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57228181|gb|AAW44638.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 279

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 57/155 (36%), Gaps = 15/155 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YR   P     +++ +   +K++L L     E + K   +      IQ +
Sbjct: 84  NFALVSSG-VYRCGFPKKRNFKFM-ETLRLKTVLTLVL---EEYPKANLEWCQSQDIQFM 138

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E  D   + +I      IL     P+LIHC  G  RTG        +     
Sbjct: 139 QFGIPGNKEPFDNIPEDVICAALVAILDRRNHPILIHCNKGKHRTGCLIGCIRRLQ---- 194

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
              +   +   Y  F   K+  +D  F  +  + P
Sbjct: 195 -AWSLTSIFDEYRRFSAPKSRAVDQQFIDLFDIMP 228


>gi|300176786|emb|CBK25355.2| unnamed protein product [Blastocystis hominis]
          Length = 264

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 64/164 (39%), Gaps = 15/164 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  +    +YRSA P         K  GI+SIL L   +PE + ++  K      I+L
Sbjct: 26  TNFAVIEKG-LYRSAFPVKRNF-PFLKHLGIRSILVL---VPEDYPEDSLKFMKRFDIKL 80

Query: 102 INFPLSATRELNDEQIKQL-----ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             FPL   +E   E  +++       +L T   PLLIHC SG  RTG        I   +
Sbjct: 81  FKFPLEGNKEPFTEIPEEMVIQIMHIVLDTRNLPLLIHCNSGKHRTGSVVGCIRRI-QGW 139

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
                   +   Y  +   K   MD  + ++  +   N  +   
Sbjct: 140 S----LSSIFWEYRFYAEPKPRFMDQQYIELFDINKVNPDREYL 179


>gi|154315986|ref|XP_001557315.1| hypothetical protein BC1G_04565 [Botryotinia fuckeliana B05.10]
 gi|150846961|gb|EDN22154.1| hypothetical protein BC1G_04565 [Botryotinia fuckeliana B05.10]
          Length = 314

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 68/168 (40%), Gaps = 14/168 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  + P+ IYRS+ P     E      G+KSI+ L  K          +A    GI+  
Sbjct: 128 NFGVIAPNAIYRSSFPQQEDFE-YLGTLGLKSIVTLVKKDFPPEFLAFMEA---HGIRHY 183

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
              +  T+          + +   L     PLLIHC  G  RTG A+A+  + V+ +  +
Sbjct: 184 VIEMQGTKKVDIPEHIMNQIMRISLDKENHPLLIHCNHGKHRTGCAAAIIRH-VSGWNVQ 242

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
               +    Y  F   K   +D   + IT+   +++S  D  Q +  +
Sbjct: 243 SIVEE----YKTFAAPKARDVD--IKYITEYQVSSLSGLDRNQSVQPS 284


>gi|71019803|ref|XP_760132.1| hypothetical protein UM03985.1 [Ustilago maydis 521]
 gi|46099762|gb|EAK84995.1| hypothetical protein UM03985.1 [Ustilago maydis 521]
          Length = 569

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 58/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V  H +YRS+ P         +  G++S+L L     E + +      +  GI   
Sbjct: 366 NFAMVNSH-VYRSSFPKKKHF-PFLRTLGLRSVLTLIL---EEYPETNSTFLDQNGITFF 420

Query: 103 NFPLSATRE-----LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       D+    L++IL     P+LIHC  G  RTG        +     
Sbjct: 421 QFGIPGNKEPFVSIPTDKITSALVTILDRRNHPILIHCNKGKHRTGCLIGCLRKLQQ--- 477

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
              +   +   Y  F   K+ +MD  F ++
Sbjct: 478 --WSLTTIFDEYRRFSWPKSRSMDQEFIEL 505


>gi|290997373|ref|XP_002681256.1| predicted protein [Naegleria gruberi]
 gi|284094879|gb|EFC48512.1| predicted protein [Naegleria gruberi]
          Length = 321

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/171 (15%), Positives = 51/171 (29%), Gaps = 20/171 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSA------------ 56
                    I LG     +     Y         + + VVP +    +            
Sbjct: 136 DCCKGLVKGISLGFFKYNSFDAEEYLRLEKVENGDINWVVPGKFLAFSSPSSRRISSDGY 195

Query: 57  -QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       K++ + +I+ L           + K     GI   +         +++
Sbjct: 196 VHLTPEDYISPFKQWRVSAIVRLNRA------LYDRKKFISNGINHFDLYFPDGSTPSED 249

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
            I++ + I +     + +HCK+G  RTG   A+Y+     +   E    L 
Sbjct: 250 HIRKFLQIAEE-ESIIAVHCKAGLGRTGTMIALYMMKHYQFTATEVIGWLR 299


>gi|303316502|ref|XP_003068253.1| Putative tyrosine phosphatase family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240107934|gb|EER26108.1| Putative tyrosine phosphatase family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320038022|gb|EFW19958.1| tyrosine-protein phosphatase SIW14 [Coccidioides posadasii str.
           Silveira]
          Length = 274

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/147 (24%), Positives = 58/147 (39%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   IYRS+ P     E   K+  +K+I+ L   +     ++ +K   D GI   
Sbjct: 63  NFAEVVSG-IYRSSFPLPDHFES-IKKLNLKTIVTL---VENEHSRQFKKFIKDNGITSY 117

Query: 103 NFPLSATRELND-----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+ A ++          ++ L  +      P+L+HC  G  RTG   A +      + 
Sbjct: 118 VIPIIANKDPKVFTSQNTVLEVLRILFNLDNHPVLVHCNKGKHRTGCIIACFRRA-QGWS 176

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
              A  +    Y  +   KT  +D  F
Sbjct: 177 NTAAVAE----YIKYSAPKTRVLDRKF 199


>gi|15220383|ref|NP_171993.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|73921030|sp|Q9ZVN4|Y1500_ARATH RecName: Full=Probable tyrosine-protein phosphatase At1g05000
 gi|4056425|gb|AAC97999.1| ESTs gb|H36249, gb|AA59732 and gb|AA651219 come from this gene
           [Arabidopsis thaliana]
 gi|28950701|gb|AAO63274.1| At1g05000 [Arabidopsis thaliana]
 gi|110736114|dbj|BAF00029.1| hypothetical protein [Arabidopsis thaliana]
 gi|332189656|gb|AEE27777.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana]
          Length = 215

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 54/150 (36%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SI+ L    PE + +   +     GI+L 
Sbjct: 58  NFSMVDNG-IFRSGFPDSANF-SFLQTLGLRSIIYL---CPEPYPESNLQFLKSNGIRLF 112

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E             L  +L     P+LIHCK G  RTG        +   + 
Sbjct: 113 QFGIEGNKEPFVNIPDHKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 171

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K    D  F +I
Sbjct: 172 ----LTSIFDEYQRFAAAKARVSDQRFMEI 197


>gi|322496322|emb|CBZ31393.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 309

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 66/170 (38%), Gaps = 19/170 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + GI ++
Sbjct: 16  NFSMVCPG-VYRSGYPTKKNYSFLCA-LRLRSILYL---CPEDYAESNLKFCEEKGIHVL 70

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            FP    +E   +  + L+      I  T   PLLIHC  G  RTG   A   ++   + 
Sbjct: 71  RFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QGWS 129

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEK----ITQLYPNNVSKGDTEQP 203
                  +   Y  F   K    D  + +    I +L P  V+   T  P
Sbjct: 130 ----LVSIFEEYKRFASDKARVGDQQYVELYHPIVKLTPPFVASWVTVTP 175


>gi|146076301|ref|XP_001462893.1| tyrosine phosphatase [Leishmania infantum JPCM5]
 gi|134066974|emb|CAM65079.1| putative tyrosine phosphatase [Leishmania infantum JPCM5]
          Length = 309

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 66/170 (38%), Gaps = 19/170 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + GI ++
Sbjct: 16  NFSMVCPG-VYRSGYPTKKNYSFLCA-LRLRSILYL---CPEDYAESNLKFCEEKGIHVL 70

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            FP    +E   +  + L+      I  T   PLLIHC  G  RTG   A   ++   + 
Sbjct: 71  RFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QGWS 129

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEK----ITQLYPNNVSKGDTEQP 203
                  +   Y  F   K    D  + +    I +L P  V+   T  P
Sbjct: 130 ----LVSIFEEYKRFASDKARVGDQQYVELYHPIVKLTPPFVASWVTVTP 175


>gi|297843300|ref|XP_002889531.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297335373|gb|EFH65790.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 215

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/147 (23%), Positives = 54/147 (36%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SI+ L    PE + +   +     GI+L 
Sbjct: 58  NFSMVDNG-IFRSGFPDSANF-SFLQTLGLRSIIYL---CPEPYTESNLQFLKSNGIRLF 112

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      + +    L  +L     P+LIHCK G  RTG        +   + 
Sbjct: 113 QFGIEGNKEPFVNIPDRKIRMALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 171

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                  +   Y  F   K    D  F
Sbjct: 172 ----LTSIFDEYQRFAAAKARVSDQRF 194


>gi|269120643|ref|YP_003308820.1| protein tyrosine/serine phosphatase [Sebaldella termitidis ATCC
           33386]
 gi|268614521|gb|ACZ08889.1| protein tyrosine/serine phosphatase [Sebaldella termitidis ATCC
           33386]
          Length = 182

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 82/164 (50%), Gaps = 14/164 (8%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLTITTFTQ----NFHAVVPHEIYRSAQPNGTFIEYLKKE 69
           +    LL + ++ +V                  NF+ V    IYRSAQP+   +E +   
Sbjct: 4   YMKIFLLFLFLIQSVGYAEINAIEEEILADNIRNFYKVSDG-IYRSAQPDRKNMELM-DI 61

Query: 70  YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK 129
            G+K+++NLR       +  +   A +  ++L    ++  +  +++  + +++++K + K
Sbjct: 62  IGVKTVINLRR------YHSDMNEAKNTSLKLERVKMNPGKIKDEDIAE-ILTLIKNSDK 114

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHF 172
           P+LIHC  G+DRTG+  A+Y  +   + KEEA ++L    YGH 
Sbjct: 115 PVLIHCWHGSDRTGVVVAMYRIVFEGFSKEEAIKELREEKYGHH 158


>gi|225680208|gb|EEH18492.1| tyrosine-protein phosphatase SIW14 [Paracoccidioides brasiliensis
           Pb03]
 gi|226287848|gb|EEH43361.1| tyrosine phosphatase family protein [Paracoccidioides brasiliensis
           Pb18]
          Length = 256

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/145 (25%), Positives = 61/145 (42%), Gaps = 15/145 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   +YRS+ P    ++ + K   +K+I+ L   + E W  +  +     GI   
Sbjct: 48  NFAEVVKG-VYRSSFPLPVHLDSIAK-LHLKTIIIL---VDEEWSPDYGEFIRKNGITSY 102

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+ A +        +  ++ L  IL     PLLIHC  G  RTG   A +   V  + 
Sbjct: 103 IIPILANKVPQVSTPYETVVEVLKIILNPKNHPLLIHCNKGKHRTGCIVACFR-RVQGWS 161

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDI 182
              A ++    Y  + + K+  +D 
Sbjct: 162 IMAALQE----YQKYSIPKSRALDR 182


>gi|281204785|gb|EFA78980.1| putative protein tyrosine phosphatase [Polysphondylium pallidum
           PN500]
          Length = 178

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 62/153 (40%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN        K+ G+KSIL L    PE + +         GI+L+
Sbjct: 23  NFSMVSRG-VYRSGYPNKKN-HPFLKKLGLKSILYL---CPEEYSESNTNFIRKHGIKLL 77

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           ++ +   +E   +   +     L+ +L     P+LIHC  G  RTG        +   + 
Sbjct: 78  HYRIVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCLVGCLRKL-QKWS 136

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
               +  +   Y  F   K   +D  F ++ +L
Sbjct: 137 ----YTYIFDEYRRFAGSKVRVLDQQFIELFKL 165


>gi|298369990|ref|ZP_06981306.1| protein tyrosine/serine phosphatase [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281450|gb|EFI22939.1| protein tyrosine/serine phosphatase [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 183

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 41/161 (25%), Positives = 69/161 (42%), Gaps = 17/161 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + +   ++YRS QP         ++ GIKS++NLR           +    + G+ L+
Sbjct: 28  NLYRI-DDKLYRSEQPVADD-GDTIEKLGIKSVINLRYFDR----NNNDSHLKNRGLTLL 81

Query: 103 NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL + R   ++  + L  I  +     +LIHC  GADRTGL S +Y  I   +   +A
Sbjct: 82  NRPLRSWRIKPEDIAQTLYLIEKQQQQGAVLIHCYHGADRTGLISGMYRIIYQGWTVADA 141

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
             ++    YG+            ++ I  L+     K   +
Sbjct: 142 KEEMLHGPYGYHS---------IWKNIANLFTEKTVKQVRQ 173


>gi|76363712|ref|XP_888539.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|15027525|emb|CAC44917.1| putative tyrosine phosphatase [Leishmania major strain Friedlin]
          Length = 300

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 66/170 (38%), Gaps = 19/170 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P      +L     ++SIL L    PE + +   K   + GI ++
Sbjct: 16  NFSMVCPG-VYRSGYPTKKNYSFLCA-LRLRSILYL---CPEDYAESNLKFCEENGIHVL 70

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            FP    +E   +  + L+      I  T   PLLIHC  G  RTG   A   ++   + 
Sbjct: 71  RFPTEGNKEPFCDVSEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QGWS 129

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEK----ITQLYPNNVSKGDTEQP 203
                  +   Y  F   K    D  + +    I +L P  V+   T  P
Sbjct: 130 ----LVSIFEEYKRFASDKARVGDQQYVELYHPIVKLTPPFVALWVTVTP 175


>gi|154331856|ref|XP_001561745.1| tyrosine phosphatase [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134059065|emb|CAM41538.1| putative tyrosine phosphatase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 287

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P             ++SIL L    PE + +   K   + G+ ++
Sbjct: 16  NFSMVCPG-VYRSGYPTKKNF-SFLSALRLRSILYL---CPEDYAESNLKFCEENGVHVL 70

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            FP    +E   +  + L+      I  T   PLLIHC  G  RTG   A   ++   + 
Sbjct: 71  RFPTEGNKEPFCDISEPLMHRILSAICDTRNLPLLIHCNKGKHRTGTVVACLRHL-QGWS 129

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K    D  + ++
Sbjct: 130 ----LVSIFEEYKRFASDKARVGDQQYVEL 155


>gi|66808551|ref|XP_637998.1| hypothetical protein DDB_G0285909 [Dictyostelium discoideum AX4]
 gi|60466434|gb|EAL64489.1| hypothetical protein DDB_G0285909 [Dictyostelium discoideum AX4]
          Length = 181

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN        K+ G+KSIL L    PE + +         GI+L+
Sbjct: 24  NFSMVSRG-VYRSGYPNKKN-HPFLKKLGLKSILYL---CPEEYSESNTNFIRKHGIKLL 78

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           ++ +   +E   +   +     L+ +L     P+LIHC  G  RTG        +   + 
Sbjct: 79  HYRIVGNKEPFVDIPDEYIRDALVDLLDVRNHPILIHCNKGKHRTGCLVGCLRKL-QKWS 137

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
               +  +   Y  F   K   +D  F ++  L
Sbjct: 138 ----YTYIFDEYRRFAGSKVRVLDQQFIELFNL 166


>gi|328857605|gb|EGG06721.1| hypothetical protein MELLADRAFT_77769 [Melampsora larici-populina
           98AG31]
          Length = 329

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 44/156 (28%), Positives = 64/156 (41%), Gaps = 15/156 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P  IYRS+ PN    E   K  G+KS+L L   + E +  E  K  N  GI+ 
Sbjct: 166 PNFGLVAPG-IYRSSFPNHLHFE-FLKTLGLKSVLTL---VQEKYSPECLKFYNQEGIKF 220

Query: 102 INFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           + F +   +E      ++     LI +L     P+LIHC  G  RTG        +    
Sbjct: 221 MQFSIPGNKEPFVHIPEEKVRLALIHVLDVRNHPMLIHCNKGKHRTGCLVGCLRKLQH-- 278

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
               +   +   Y  +   K+  MD  F ++  L P
Sbjct: 279 ---WSSTSIFDEYRRYAFPKSRNMDQQFIELFDLAP 311


>gi|303326383|ref|ZP_07356826.1| protein tyrosine/serine phosphatase [Desulfovibrio sp. 3_1_syn3]
 gi|302864299|gb|EFL87230.1| protein tyrosine/serine phosphatase [Desulfovibrio sp. 3_1_syn3]
          Length = 185

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N + V   E+YRS QP G  +    +  GIK++L+LR    +              + L
Sbjct: 7   PNLYRVDS-EVYRSGQPEGEGLRS-AENLGIKTVLSLRSPNRDDALD------KSGDLLL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            N P+ +    +++ I   + I+  APKP+L+HC+ GADRTGL  A+Y  +   + KE+A
Sbjct: 59  RNVPMHSWNTHDEDII-SALRIIHDAPKPILVHCRHGADRTGLIMAMYRVVFQGWTKEQA 117

Query: 162 HRQL-SMLYGHFPVL 175
            +++    YG   V 
Sbjct: 118 KKEMLEGGYGFHAVW 132


>gi|71024209|ref|XP_762334.1| hypothetical protein UM06187.1 [Ustilago maydis 521]
 gi|46101858|gb|EAK87091.1| hypothetical protein UM06187.1 [Ustilago maydis 521]
          Length = 1090

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 40/240 (16%), Positives = 72/240 (30%), Gaps = 53/240 (22%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI 63
               +  L   +  I  G+L L   +L  Y         +++ + P+ I   A PN    
Sbjct: 235 NLSIQDILYGVHRAINSGLLDLTTFNLDEYEKYEQVSHGDWNWITPNFI-AFASPNDRNY 293

Query: 64  -----------------------------EYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
                                            K+ G+K ++ L           + +A 
Sbjct: 294 VEALRVGEGRLPASYSFRPPGEDKLFGKTIRYFKDRGVKLVVRLNNP------LYDREAF 347

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLY 151
            ++GI   +          DE +   I+           + +HCK+G  RTG+    YL 
Sbjct: 348 LNVGIDHSDMYFDDGSNPTDEILADFIAKADHVIAHDGVVAVHCKAGLGRTGVLIGAYLV 407

Query: 152 IVAHYPKEEAHRQL-------------SMLYGHFP-VLKTITMDITFEKITQLYPNNVSK 197
               +   EA   +               +Y +F   +K    D   ++  QL     +K
Sbjct: 408 WKHGFSAGEAIGFMRFMRPGCVVGPQQHFMYQNFAEWIKWGVRDHAMKEARQLIAEERTK 467


>gi|213962566|ref|ZP_03390828.1| protein tyrosine/serine phosphatase [Capnocytophaga sputigena
           Capno]
 gi|213954892|gb|EEB66212.1| protein tyrosine/serine phosphatase [Capnocytophaga sputigena
           Capno]
          Length = 182

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 81/190 (42%), Gaps = 17/190 (8%)

Query: 15  YIKILLGVLVLCAVSLG-LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIK 73
              +L+  ++   + L   +  T+     N + V    +YRS Q      + + K   IK
Sbjct: 2   KKTLLICFILFALLPLWSQHKATLIHADANLYKVDS-LLYRSEQLVTED-KAIIKNIPIK 59

Query: 74  SILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK-TAPKPLL 132
           SI+NLR         +++       I+LIN PL   R    E  + L  I +      +L
Sbjct: 60  SIVNLRYFTRSG---DKKIFNASDNIKLINHPLLTWRIKAPEIAQTLKIIREHQKQGAVL 116

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQLY 191
           IHC  GADRTG+  A+Y  I  ++  E+A +++ +  YG+            ++ +  L+
Sbjct: 117 IHCYHGADRTGIMVAMYRIIYHNWTIEQAKKEMLNGPYGYHS---------VWKNLEALF 167

Query: 192 PNNVSKGDTE 201
             +  K   +
Sbjct: 168 TESTVKEVRK 177


>gi|255587792|ref|XP_002534397.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
 gi|223525370|gb|EEF27985.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
          Length = 212

 Score =  104 bits (259), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 53/150 (35%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +   ++SI+ L    PE + +   +     GI L 
Sbjct: 55  NFSMVDNG-IFRSGFPDSANF-SFLQTLELRSIICL---CPEPYPELNTEFLKANGITLF 109

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      + +I      +L     P+L+HCK G  RTG        +     
Sbjct: 110 QFGIEGYKEPFVNIPEDMIREALKVVLDVRNHPVLVHCKRGKHRTGCVVGCLRKLQ---- 165

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K    D  F ++
Sbjct: 166 -RWCLTSIFDEYQRFAAAKARVSDQRFMEL 194


>gi|212274893|ref|NP_001130476.1| hypothetical protein LOC100191574 [Zea mays]
 gi|194689234|gb|ACF78701.1| unknown [Zea mays]
          Length = 235

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 61/150 (40%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P+ + +    +   ++S+L L    PE + +   +     GI+L 
Sbjct: 81  NFAMVDHG-VYRSGFPDASNL-PFLETLRLRSVLCL---CPEPYPEANLEFLRAHGIKLF 135

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +  ++E       D   + L  IL  +  P+LIHCK G  RTG     +  +     
Sbjct: 136 QFGIDGSKEPFVNIPEDRIREALEVILDASNHPVLIHCKRGKHRTGCVVGCFRKLQ---- 191

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   KT   D+ F ++
Sbjct: 192 -RWCLTSIFDEYQRFAAAKTRVSDLRFMEL 220


>gi|195628302|gb|ACG35981.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 235

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 61/150 (40%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P+ + +    +   ++S+L L    PE + +   +     GI+L 
Sbjct: 81  NFAMVDHG-VYRSGFPDASNL-PFLETLRLRSVLCL---CPEPYPEANLEFLRAHGIKLF 135

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +  ++E       D   + L  IL  +  P+LIHCK G  RTG     +  +     
Sbjct: 136 QFGIDGSKEPFVNIPEDRIREALEVILDASNHPVLIHCKRGKHRTGCVVGCFRKLQ---- 191

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   KT   D+ F ++
Sbjct: 192 -RWCLTSIFDEYQRFAAAKTRVSDLRFMEL 220


>gi|156059848|ref|XP_001595847.1| hypothetical protein SS1G_03937 [Sclerotinia sclerotiorum 1980]
 gi|154701723|gb|EDO01462.1| hypothetical protein SS1G_03937 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 303

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 67/168 (39%), Gaps = 14/168 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  + P+ IYRS+ P     E   +  G+KSI+ L  K          +A    GI+  
Sbjct: 117 NFGVIAPNAIYRSSFPQQEDFE-YLRSLGLKSIVTLVKKEYPPGFLAFIEA---QGIRHY 172

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
              +  T+          + +   L     PLLIHC  G  RTG A+A+  + V+ +  +
Sbjct: 173 VIEMQGTKKVDIPEHIMNQIMRISLDKENHPLLIHCNHGKHRTGCAAAIIRH-VSGWDVK 231

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
               +    Y  F   K   +D   + IT+   +++S     +    T
Sbjct: 232 SIVEE----YKSFAEPKARDVD--IKYITEYQVSSLSGLYHHKLDQPT 273


>gi|320103481|ref|YP_004179072.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319750763|gb|ADV62523.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 249

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 63/141 (44%), Gaps = 4/141 (2%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
               ++  V P  +YRS Q +   +E   + YG+K+++NL+   P      E + A  LG
Sbjct: 64  VDWDHWDVVKPGLLYRSGQLDPDQLEEAVRRYGLKTVINLQL--PSPTLARERQVARRLG 121

Query: 99  IQLINFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +     P+        +Q ++++ ++     +P+L+HC  G  RTG A A+  Y    + 
Sbjct: 122 LNYAVLPMPGDGLGRPDQFRRVLDMIDDPKSQPVLVHCARGTCRTGSAVALMRYERDGWT 181

Query: 158 KEEAHRQLSMLYGHFPVLKTI 178
            E+   +L   +G+       
Sbjct: 182 LEDVEAELK-RHGYRQRAIAG 201


>gi|293611065|ref|ZP_06693364.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826717|gb|EFF85083.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 192

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 76/168 (45%), Gaps = 16/168 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF+ +  +++YRS QP+   I    K++ I +I+NLR K              +  + 
Sbjct: 40  THNFYQI-SNDVYRSEQPDTAMI-SELKDHQIGTIINLRAKDA----DSLVFKNENFNLV 93

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            I     A    +  ++ Q I I K   + +L+HC  G+DRTG + A+Y  I  ++  ++
Sbjct: 94  HIPINTWAIDRQDLLEVMQQIKIAKQNDQRVLLHCYHGSDRTGASVAMYRIIFENWTIDD 153

Query: 161 AHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           A +++    YG+            ++ I +L+     +   +Q  N +
Sbjct: 154 AVKEMKQGGYGYHI---------IWKNIDRLFTPENVRWIQQQLSNPS 192


>gi|322816108|gb|EFZ24541.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 340

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 58/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P         +   +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNF-RFLRALRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F     +E   +  + L+      ++ T   P+LIHC  G  RTG   A    +   + 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVACLRLL-QGWS 142

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                ++    Y  F   K    D  + ++
Sbjct: 143 LVSIFQE----YRCFAGDKARMGDQQYVEL 168


>gi|71656659|ref|XP_816873.1| tyrosine phosphatase [Trypanosoma cruzi strain CL Brener]
 gi|70882030|gb|EAN95022.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 340

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 58/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P         +   +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNF-RFLRALRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F     +E   +  + L+      ++ T   P+LIHC  G  RTG   A    +   + 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVACLRLL-QGWS 142

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                ++    Y  F   K    D  + ++
Sbjct: 143 LVSIFQE----YRCFAGDKARMGDQQYVEL 168


>gi|297599968|ref|NP_001048257.2| Os02g0771400 [Oryza sativa Japonica Group]
 gi|218191654|gb|EEC74081.1| hypothetical protein OsI_09102 [Oryza sativa Indica Group]
 gi|255671274|dbj|BAF10171.2| Os02g0771400 [Oryza sativa Japonica Group]
          Length = 204

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 61/150 (40%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P      +L     ++SI+ L    PE + +E  +     GI+L 
Sbjct: 51  NFAEVNDG-IFRSGFPAADNFAFLLS-LKLRSIVYL---CPEPYPEENTRFLEQNGIKLH 105

Query: 103 NFPLSATRE-----LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +  ++E       ++  + L  IL    +P+LIHCK G  RTG        +   + 
Sbjct: 106 QFGIDGSKELLVNIPEEKIREALKVILDVRNQPVLIHCKRGKHRTGCVVGCLRKL-QKWC 164

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y HF   K  + D  F ++
Sbjct: 165 ----LTSVFDEYQHFAAAKARSTDQRFMEL 190


>gi|50313187|gb|AAT74541.1| dual-specificity phosphatase protein [Oryza sativa]
          Length = 225

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 59/153 (38%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P         K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 72  NFAMVDDG-IFRSGFPAAANF-RFLKSLNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 126

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +D+  + L  +L    +PLLIHCK G  RTG        +   + 
Sbjct: 127 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTGCVVGCLRKL-QKWC 185

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K  + D  F ++  +
Sbjct: 186 ----LSSVFDEYQRFAAAKARSTDQRFMELFDI 214


>gi|71419804|ref|XP_811280.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70875926|gb|EAN89429.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 340

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 58/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P         +   +++IL L    PE + +   K   +  I+++
Sbjct: 29  NFAMVCPG-VYRSGYPTRKNF-RFLRALRLRTILYL---CPEEYAESNVKFCEENDIRIL 83

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F     +E   +  + L+      ++ T   P+LIHC  G  RTG   A    +   + 
Sbjct: 84  RFATEGNKEPFMDISEPLMHRILSALVDTRTHPILIHCNKGKHRTGAVVACLRLL-QGWS 142

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                ++    Y  F   K    D  + ++
Sbjct: 143 LVSIFQE----YRCFAGDKARMGDQQYVEL 168


>gi|115467010|ref|NP_001057104.1| Os06g0208700 [Oryza sativa Japonica Group]
 gi|113595144|dbj|BAF19018.1| Os06g0208700 [Oryza sativa Japonica Group]
 gi|125554494|gb|EAZ00100.1| hypothetical protein OsI_22103 [Oryza sativa Indica Group]
          Length = 226

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 59/153 (38%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P         K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 73  NFAMVDDG-IFRSGFPAAANF-RFLKSLNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 127

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +D+  + L  +L    +PLLIHCK G  RTG        +   + 
Sbjct: 128 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTGCVVGCLRKL-QKWC 186

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K  + D  F ++  +
Sbjct: 187 ----LSSVFDEYQRFAAAKARSTDQRFMELFDI 215


>gi|225447153|ref|XP_002275443.1| PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
          Length = 210

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SI+ L    PE++ +   +     GI+L 
Sbjct: 53  NFAMVDNG-IFRSGFPDTANFA-FLQTLGLRSIIYL---CPETYPEANNEFLKSNGIKLF 107

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       D   + L  +L     PLLIHCK G  RTG        +   + 
Sbjct: 108 QFGIEGYKEPFVNIPEDTIREALKVVLDVRNHPLLIHCKRGKHRTGCVVGCLRKL-QKWC 166

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K    D  F ++
Sbjct: 167 ----LSSIFDEYQRFAAAKARVSDQRFMEL 192


>gi|315919344|ref|ZP_07915584.1| protein tyrosine/serine phosphatase [Bacteroides sp. D2]
 gi|313693219|gb|EFS30054.1| protein tyrosine/serine phosphatase [Bacteroides sp. D2]
          Length = 186

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/188 (23%), Positives = 82/188 (43%), Gaps = 10/188 (5%)

Query: 7   PRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYL 66
            +K + +  + I+L V +          +   +   N + +    +YRS QP+    +  
Sbjct: 1   MQKQIPLCLLAIVLSVSLFGQNLKADKIILSDSDLTNLYQIDSG-VYRSEQPSKEGFKA- 58

Query: 67  KKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
            ++YGI  +LNLR +  +         A    I+L      A   ++++Q+ Q + I+K 
Sbjct: 59  LEKYGIGEVLNLRNRHSDD------DEAKGTSIKLHRVKTKA-HSISEKQLIQALRIIKN 111

Query: 127 APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFE 185
              P++ HC  G+DRTG   A Y  I  +  KE+A  +++   YG   + K I   I   
Sbjct: 112 RKAPIVFHCHHGSDRTGAVCAFYRIIFQNVSKEDAIHEMTEGGYGFHRIYKNIIRRIKEA 171

Query: 186 KITQLYPN 193
            + Q+   
Sbjct: 172 NVEQIRKE 179


>gi|238014192|gb|ACR38131.1| unknown [Zea mays]
          Length = 213

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P         K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 60  NFAMVDDG-IFRSGFPETANF-RFLKSLNLRSIVYL---CPEPYPETNTEFLEKNGIRLH 114

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +D+  + L  +L    +PLLIHCK G  RTG        +     
Sbjct: 115 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTGCLVGCLRKLQ---- 170

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            +     +   Y  F   K    D  F ++
Sbjct: 171 -KWCLSSVFDEYHRFAAAKARITDQRFMEL 199


>gi|123445952|ref|XP_001311731.1| Dual specificity protein phosphatase CDC14A [Trichomonas vaginalis
           G3]
 gi|121893552|gb|EAX98801.1| Dual specificity protein phosphatase CDC14A, putative [Trichomonas
           vaginalis G3]
          Length = 354

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 61/210 (29%), Gaps = 24/210 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      I LG   +       +         + + ++P+++   A P          
Sbjct: 76  DCLRGLQHAIELGWFNIDTFDPETWARIEAIENGDMNWLIPNKLLAFASPYSTNILPGGF 135

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                  +    K  GI  ++ L       ++  EE      G +               
Sbjct: 136 RVATPATVIPEFKNLGITHVIRLNK----PFYDCEE--FKQAGFKHTELYFLDGSTPPQH 189

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            ++  + I +T    + +HCK+G  RTG  +  Y+     +   EA   + +   G    
Sbjct: 190 ILEDFLKIAETDEI-IALHCKAGLGRTGTLAGCYMIKNHGFTAREAIGWIRLCRAGSIIG 248

Query: 175 LKTITMDITFEKITQLYPNNVSKGDTEQPM 204
            +        +   ++           +P+
Sbjct: 249 PQQ---QYLLQYYNEMQRPQTDANQVHEPL 275


>gi|301156145|emb|CBW15616.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 205

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 75/171 (43%), Gaps = 8/171 (4%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
            ++ T+ +  +N + +   + YRS Q      E L  +  I +I+NLR         +++
Sbjct: 39  EHWATLISEQENLYQI-DDKFYRSEQLEA-QSEALLNKLNIHTIVNLRFFDR----NDDK 92

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYL 150
           +A     I LIN PL       DE    L  I        +L+HC  GADRTGL  A Y 
Sbjct: 93  QAFGHTKINLINTPLLTWSISPDEVADILWQIKQHQKNGAVLVHCYHGADRTGLIVASYR 152

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
            I  ++   EA R++    YG+  V K I    T E + ++      + +T
Sbjct: 153 VIYQNWDLNEAKREMQQGPYGYHSVWKNIDNFFTQENMAKIKAELDKRSNT 203


>gi|225024155|ref|ZP_03713347.1| hypothetical protein EIKCOROL_01023 [Eikenella corrodens ATCC
           23834]
 gi|224943180|gb|EEG24389.1| hypothetical protein EIKCOROL_01023 [Eikenella corrodens ATCC
           23834]
          Length = 203

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/150 (31%), Positives = 70/150 (46%), Gaps = 8/150 (5%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + V   ++YRS QP    +E L +   +KS++NLR          + K   D GI L 
Sbjct: 48  NLYRV-DDKLYRSEQPVEEDVE-LLQSLNVKSVVNLRYFNRSG----DRKVLADRGIALF 101

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL   R    +  + L  I  + A   +LIHC  GADRTGL + +Y  I   +  E+A
Sbjct: 102 NQPLLTWRITPKQVAETLYLIEQQQAEGTVLIHCYHGADRTGLIAGMYRIIYQGWTVEQA 161

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQL 190
             ++    YG   + + I    T E + Q+
Sbjct: 162 KNEMRHGPYGFHSIWRNIEDLFTEENVRQV 191


>gi|301093343|ref|XP_002997519.1| dual specificity protein phosphatase, putative [Phytophthora
           infestans T30-4]
 gi|262110597|gb|EEY68649.1| dual specificity protein phosphatase, putative [Phytophthora
           infestans T30-4]
          Length = 418

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 57/201 (28%), Gaps = 22/201 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      +    +      L  +         +   V P +    A P          
Sbjct: 139 DCLKGLERAMKSSYISTKTFDLHEFQHYERVENGDLTWVSP-KFIAFAGPHNVYQRTPQG 197

Query: 59  ----NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        K+  +  ++ L  K      + +EK     GI  I+           
Sbjct: 198 HVMLTPEHYIPYFKKRNVTLVVRLNDK------QYDEKKFLSAGIDHIDLIYPDGTNAPM 251

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             + + I   +  P  + +HCK+G  RTG     Y+     +   E    L +   G   
Sbjct: 252 PILMKFIEACEKTPGAVAVHCKAGLGRTGTCIGAYMMKHHLFSAHELIGWLRLCRPGSVI 311

Query: 174 VLKTITMDITFEKITQLYPNN 194
             +   M+    ++ QL P+ 
Sbjct: 312 GPQQQFMEAIESRMHQLNPSK 332


>gi|226499936|ref|NP_001151744.1| LOC100285379 [Zea mays]
 gi|195649459|gb|ACG44197.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 213

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P         K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 60  NFAMVDDG-IFRSGFPETANF-RFLKSLNLRSIVYL---CPEPYPETNTEFLEKNGIRLH 114

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +D+  + L  +L    +PLLIHCK G  RTG        +     
Sbjct: 115 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTGCLVGCLRKLQ---- 170

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            +     +   Y  F   K    D  F ++
Sbjct: 171 -KWCLSSVFDEYHRFAAAKARITDQRFMEL 199


>gi|224131688|ref|XP_002321153.1| predicted protein [Populus trichocarpa]
 gi|222861926|gb|EEE99468.1| predicted protein [Populus trichocarpa]
          Length = 214

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SI+ L    PE + +   +   D GI+L 
Sbjct: 57  NFAMVDNG-IFRSGFPDSANFA-FLQTLGLRSIICL---CPEPYPEATTEFLKDGGIRLY 111

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       D   + L  +L     P+LIHCK G  RTG        +   + 
Sbjct: 112 QFGIEGYKEPFVNIPEDTIREALKVVLDAKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 170

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K    D  F ++
Sbjct: 171 ----LSSIFDEYQRFAAAKARVSDQRFMEL 196


>gi|153807935|ref|ZP_01960603.1| hypothetical protein BACCAC_02221 [Bacteroides caccae ATCC 43185]
 gi|149129544|gb|EDM20758.1| hypothetical protein BACCAC_02221 [Bacteroides caccae ATCC 43185]
          Length = 188

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 83/187 (44%), Gaps = 10/187 (5%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           ++ LL     ++  + +              +   N + +    +YRS QP+ +  +   
Sbjct: 3   KRILLSLLWGVIFSLSLFSQNLKAEKITLPDSKLNNLYKIDSG-VYRSEQPSHSDFKA-L 60

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           ++YGI   LNLR +  ++        A    ++L    + A    ++EQ+   + I+K  
Sbjct: 61  EKYGIGESLNLRNRHSDN------DEATGTTVKLHRVKMKAHSV-DEEQLITALRIIKNR 113

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEK 186
             P++IHC  G+DRTG+  A+Y  I  +  KE+A R+++   +G   + K I   I    
Sbjct: 114 KSPIVIHCHHGSDRTGVVCALYRIIFQNVSKEDAIREMTDGGFGFHRIYKNIIRRIREAD 173

Query: 187 ITQLYPN 193
           I ++   
Sbjct: 174 IERIKRE 180


>gi|299768829|ref|YP_003730855.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter sp. DR1]
 gi|298698917|gb|ADI89482.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter sp. DR1]
          Length = 192

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/167 (23%), Positives = 75/167 (44%), Gaps = 16/167 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF+ +  ++++RS QP+   I    K + I +I+NLR K              +  +  
Sbjct: 41  HNFYQI-SNDVFRSEQPSAAMI-SELKNHQIGTIINLRAKDA----DTLVFKNENFNLVH 94

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           I     A    +  ++ Q I I K + + +L+HC  G+DRTG + A+Y  I  ++  ++A
Sbjct: 95  IPINTWAINRQDLLEVMQQIKIAKQSNQRVLLHCYHGSDRTGASVAMYRIIFENWAIDDA 154

Query: 162 HRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
            +++    YG+            ++ I +L+     K   +Q  N +
Sbjct: 155 VKEMKEGGYGYHI---------IWKNIDRLFTPENVKWIQQQLSNPS 192


>gi|326496196|dbj|BAJ90719.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 214

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 58/150 (38%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  P         K   ++SI+ L    PE + +   +  +  GI+L 
Sbjct: 61  NFAMVDDG-IYRSGFPAAANF-RFLKSLNLRSIVYL---CPEPYPETNTEFLDKNGIKLH 115

Query: 103 NFPLSATRELNDEQI-----KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E   E       + L  +L    +PLLIHCK G  RTG        +   + 
Sbjct: 116 QFGIEGRKEPFVEIPDEKIREALKVVLDVRNQPLLIHCKRGKHRTGCVVGCMRKL-QKWC 174

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K  + D+ F ++
Sbjct: 175 ----LSSVFDEYQRFAAAKVRSTDLRFMEL 200


>gi|320165898|gb|EFW42797.1| protein tyrosine phosphatase [Capsaspora owczarzaki ATCC 30864]
          Length = 232

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/147 (26%), Positives = 57/147 (38%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS  P          + G+KSIL L    PE +  +  +   D  + L+
Sbjct: 76  NFAIVAPG-VYRSGYPGKKNF-PFLNKLGLKSILYL---CPEPYVGDNAQFIGDQTLSLL 130

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +FP+   +E             L+++L +   PLLIHC  G  RTG        I   + 
Sbjct: 131 HFPIHGNKEPFTHIPAATLRAALVALLDSRNHPLLIHCNKGKHRTGCLVGCLRKI-QKWT 189

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                  +   Y  F   K   +D  F
Sbjct: 190 V----TSIFDEYQRFAGTKARILDQQF 212


>gi|320582458|gb|EFW96675.1| Tyrosine phosphatase [Pichia angusta DL-1]
          Length = 236

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 66/193 (34%), Gaps = 20/193 (10%)

Query: 22  VLVLCAVSLGLYFLTI-TTFTQ---NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILN 77
            +      +  Y   +         NF  V    IYRS+ P     E++ K   +KS+L 
Sbjct: 52  FVPTDPALIEQYKNKLHRISYTPPENFALVC-GSIYRSSFPRIENFEFMLK-LKLKSVLC 109

Query: 78  LRGKLPESWHKEEEKAANDLGIQLINFPLSATREL-----NDEQIKQLISILKTAPKPLL 132
           L   +PE +  E  +   +  IQ     LS  +E       D+  + L  I      P+L
Sbjct: 110 L---IPEEYPSENMEFLRENDIQFFQVGLSGNKEPFVKIKPDQVNEALKIIANPEHHPIL 166

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLY 191
           +HC  G  RTG        +   +        +   Y  F   K   +D  F E     +
Sbjct: 167 VHCNRGKHRTGCIVGCIRKL-QKWS----LSMIFDEYRRFAYPKERPLDQQFIEMFDDSH 221

Query: 192 PNNVSKGDTEQPM 204
               ++     P+
Sbjct: 222 IQQYAQDRNWLPL 234


>gi|255066578|ref|ZP_05318433.1| protein tyrosine/serine phosphatase [Neisseria sicca ATCC 29256]
 gi|255049162|gb|EET44626.1| protein tyrosine/serine phosphatase [Neisseria sicca ATCC 29256]
          Length = 176

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 73/159 (45%), Gaps = 8/159 (5%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           + T+     N + +   ++YRS QP       L +  GI+S++NLR         + E  
Sbjct: 13  WATLVKQDANLYRI-DDKLYRSEQPVAED-GELIEHLGIRSVINLRFFDR----NDNETH 66

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYI 152
                + L+N PL   +    +  + L  I K     P+L+HC  GADRTGL S +Y  I
Sbjct: 67  LKGRNLMLLNRPLLTWKIKPKDIAQTLFLIEKQQKYGPVLVHCYHGADRTGLISGMYRII 126

Query: 153 VAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQL 190
              +  EEA  ++    YG+  + K I    T EK+ ++
Sbjct: 127 YQGWSVEEARLEMQHGPYGYHSIWKNIENLFTEEKVQEV 165


>gi|19112377|ref|NP_595585.1| phosphoprotein phosphatase (predicted) [Schizosaccharomyces pombe
           972h-]
 gi|5679722|emb|CAB51762.1| phosphoprotein phosphatase (predicted) [Schizosaccharomyces pombe]
          Length = 263

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 69/174 (39%), Gaps = 28/174 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  IYRSA P  +      +   I++I++LR    E + +E+        I   
Sbjct: 61  NFGVVYPGIIYRSACPRASNF-NFLESLHIRTIISLRQ---EEYSEEDLHYFTKHHINYY 116

Query: 103 NFPLSATR----------------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           +  +  ++                +++D   K L  +L     P+L+HC  G  RTG+  
Sbjct: 117 HIAMPGSKHRKNDCISSSSNPDISDVDDLVRKTLQLLLNKENWPVLLHCSRGKHRTGIVI 176

Query: 147 AVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
                ++ ++P     ++    Y  F   K   +D   E+  Q + ++ S   +
Sbjct: 177 GCLRALM-NWPVGNRLQE----YISFSHPKEREVD---EEYIQNFSSDPSLKSS 222


>gi|125596441|gb|EAZ36221.1| hypothetical protein OsJ_20540 [Oryza sativa Japonica Group]
          Length = 226

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 59/153 (38%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P         K   ++SI+ L    PE + +   +     GI+L 
Sbjct: 73  NFAMVDDG-IFRSGFPAAANF-RFLKSLNLRSIVYL---CPEPYPETNAEFLAKNGIKLH 127

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +D+  + L  +L    +PLLIHCK G  RTG        +   + 
Sbjct: 128 QFGIEGRKEPFVNIPDDKIREALKVVLDVKNQPLLIHCKRGKHRTGCVVGCLRKL-QKWC 186

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K  + D  F ++  +
Sbjct: 187 ----LSSVFDEYQGFAAAKARSTDQRFMELFDI 215


>gi|78061402|ref|YP_371310.1| protein tyrosine/serine phosphatase [Burkholderia sp. 383]
 gi|77969287|gb|ABB10666.1| protein tyrosine/serine phosphatase [Burkholderia sp. 383]
          Length = 194

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/167 (23%), Positives = 77/167 (46%), Gaps = 20/167 (11%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N H + P  +YRSAQ + + +    ++ GI+ +++ R          ++       I++
Sbjct: 45  NNLHRITP-TLYRSAQLSRSDV-PELQKLGIRKVISFRS------FHADDTILAGTQIRM 96

Query: 102 INFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
               ++     +++ +  L ++       P+LIHC+ GADRTGL SA+Y  +   + +E+
Sbjct: 97  QRIRINTWDIRDEDMVAALKALRTADQDGPVLIHCQHGADRTGLVSALYRMVYQGWTREQ 156

Query: 161 AHRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
           A  +L    YG  P          ++ IT  Y  NV     ++ +N+
Sbjct: 157 ALDELQHGGYGFHP---------IWQNITN-YLKNVDVERLKREVNS 193


>gi|209879387|ref|XP_002141134.1| dual specificity protein phosphatase CDC14A [Cryptosporidium muris
           RN66]
 gi|209556740|gb|EEA06785.1| dual specificity protein phosphatase CDC14A, putative
           [Cryptosporidium muris RN66]
          Length = 455

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/195 (13%), Positives = 59/195 (30%), Gaps = 26/195 (13%)

Query: 10  NLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP----------- 58
            L   +  +LL         +  YF        +   ++PH+    + P           
Sbjct: 152 CLTGLHYAMLLKWFDFDCFKVDKYFAYEKVDDGDISWIIPHKFIAFSGPSATTVDNDGYS 211

Query: 59  --NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
                F   + +E G+  ++ L  K      + +    +  GI+  +         +   
Sbjct: 212 SLTPEFYIPIFRELGVTLVIRLNKK------QYDSSRFSKYGIRHEDLFFMDGSCPSKNI 265

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM----LYGHF 172
           I + + + +     + +HCK+G  RTG     Y     H+    A   +        G  
Sbjct: 266 INRFLELTENEKGIIAVHCKAGLGRTGTLLGCYAMKNFHFT---AAAWIGWNRIARPGSI 322

Query: 173 PVLKTITMDITFEKI 187
              +   +     ++
Sbjct: 323 LGPQQQFLHEIEMEL 337


>gi|56554689|pdb|1XRI|A Chain A, X-Ray Structure Of A Putative Phosphoprotein Phosphatase
           From Arabidopsis Thaliana Gene At1g05000
 gi|56554690|pdb|1XRI|B Chain B, X-Ray Structure Of A Putative Phosphoprotein Phosphatase
           From Arabidopsis Thaliana Gene At1g05000
 gi|150261477|pdb|2Q47|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of A
           Putative Phosphoprotein Phosphatase From Arabidopsis
           Thaliana Gene At1g05000
 gi|150261478|pdb|2Q47|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of A
           Putative Phosphoprotein Phosphatase From Arabidopsis
           Thaliana Gene At1g05000
          Length = 151

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 54/150 (36%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SI+ L    PE + +   +     GI+L 
Sbjct: 7   NFSXVDNG-IFRSGFPDSANF-SFLQTLGLRSIIYL---CPEPYPESNLQFLKSNGIRLF 61

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E             L  +L     P+LIHCK G  RTG        +     
Sbjct: 62  QFGIEGNKEPFVNIPDHKIRXALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLRKLQ---- 117

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            +     +   Y  F   K    D  F +I
Sbjct: 118 -KWCLTSIFDEYQRFAAAKARVSDQRFXEI 146


>gi|226506872|ref|NP_001149521.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|194689160|gb|ACF78664.1| unknown [Zea mays]
 gi|194695948|gb|ACF82058.1| unknown [Zea mays]
 gi|195627748|gb|ACG35704.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|224030357|gb|ACN34254.1| unknown [Zea mays]
          Length = 216

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 56/150 (37%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P         K   ++SI+ L    PE +     +     GI+L 
Sbjct: 63  NFAVVDDG-IFRSGFPGTANF-RFLKSLNLRSIVYL---CPEPYPGTNTEFLEKNGIRLH 117

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      +D+  + L  +L    +PLLIHCK G  RTG        +     
Sbjct: 118 QFGIEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTGCVVGCLRKLQ---- 173

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            E     +   Y  F   K    D  F ++
Sbjct: 174 -EWCLSSVLDEYHRFAAAKARITDQRFMEL 202


>gi|225469129|ref|XP_002273080.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 210

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 56/153 (36%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    ++RS  P+        +  G++SI+ L    PE + +   +     GI+L 
Sbjct: 50  NFAMV-DCGVFRSGFPDTANF-TFLQTLGLRSIIYL---CPEPYPEPNIEFLKCNGIRLF 104

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       D   + L  +L     PLLIHCK G  RTG        +     
Sbjct: 105 QFGIDGCKEPFVNIPEDTIREALKVVLDKRNHPLLIHCKRGKHRTGCLVGCLRKLQ---- 160

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K    D  F ++  +
Sbjct: 161 -RWCLSSIFDEYQRFAAAKARISDQRFMELFDI 192


>gi|294670992|ref|ZP_06735848.1| hypothetical protein NEIELOOT_02698 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307479|gb|EFE48722.1| hypothetical protein NEIELOOT_02698 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 197

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 48/150 (32%), Positives = 73/150 (48%), Gaps = 8/150 (5%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + +   ++YRS Q   +    ++   GIKS++NLR         +   A +  GI L 
Sbjct: 38  NLYRL-DDKLYRSEQLTRSDAAAVQ-GLGIKSVINLRFFDR----DDNATALSGSGIALF 91

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL   R       + L  I  +    P+LIHC  GADRTGL S +Y  I  ++P EEA
Sbjct: 92  NKPLLTWRIKPKHIAETLYLIEQQQKQGPVLIHCYHGADRTGLISGMYRVIYQNWPIEEA 151

Query: 162 HRQLSM-LYGHFPVLKTITMDITFEKITQL 190
            R++    YG+  + + I    T EK+ ++
Sbjct: 152 KREMQQGPYGYHSIWRNIANMFTEEKVAKV 181


>gi|166228733|sp|Q9UUF3|YNF3_SCHPO RecName: Full=Probable tyrosine-protein phosphatase C17A3.03c
 gi|2257529|dbj|BAA21423.1| HYPOTHETICAL 32.8KD PROTEIN IN NCE3-HHT2 INTERGENIC REGION
           [Schizosaccharomyces pombe]
          Length = 295

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/174 (21%), Positives = 69/174 (39%), Gaps = 28/174 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  IYRSA P  +      +   I++I++LR    E + +E+        I   
Sbjct: 93  NFGVVYPGIIYRSACPRASNF-NFLESLHIRTIISLRQ---EEYSEEDLHYFTKHHINYY 148

Query: 103 NFPLSATR----------------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLAS 146
           +  +  ++                +++D   K L  +L     P+L+HC  G  RTG+  
Sbjct: 149 HIAMPGSKHRKNDCISSSSNPDISDVDDLVRKTLQLLLNKENWPVLLHCSRGKHRTGIVI 208

Query: 147 AVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
                ++ ++P     ++    Y  F   K   +D   E+  Q + ++ S   +
Sbjct: 209 GCLRALM-NWPVGNRLQE----YISFSHPKEREVD---EEYIQNFSSDPSLKSS 254


>gi|169794794|ref|YP_001712587.1| putative phosphatase [Acinetobacter baumannii AYE]
 gi|184159433|ref|YP_001847772.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ACICU]
 gi|213157879|ref|YP_002320677.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           AB0057]
 gi|215482338|ref|YP_002324520.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB307-0294]
 gi|301346256|ref|ZP_07226997.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB056]
 gi|301512777|ref|ZP_07238014.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB058]
 gi|301597753|ref|ZP_07242761.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB059]
 gi|332852245|ref|ZP_08434050.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013150]
 gi|332870468|ref|ZP_08439232.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013113]
 gi|332876274|ref|ZP_08444049.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6014059]
 gi|169147721|emb|CAM85584.1| conserved hypothetical protein; putative phosphatase [Acinetobacter
           baumannii AYE]
 gi|183211027|gb|ACC58425.1| Protein tyrosine/serine phosphatase [Acinetobacter baumannii ACICU]
 gi|213057039|gb|ACJ41941.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           AB0057]
 gi|213985690|gb|ACJ55989.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB307-0294]
 gi|322509346|gb|ADX04800.1| putative phosphatase [Acinetobacter baumannii 1656-2]
 gi|323519371|gb|ADX93752.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332729375|gb|EGJ60715.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013150]
 gi|332732205|gb|EGJ63473.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6013113]
 gi|332735546|gb|EGJ66598.1| dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii 6014059]
          Length = 192

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/176 (23%), Positives = 81/176 (46%), Gaps = 16/176 (9%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
            + T+ + T NF+ +  ++++RS QP+   I    K + I +I+NLR K       +   
Sbjct: 32  DWGTLVSQTHNFYQI-SNDVFRSEQPDAAMI-PELKHHQIGTIINLRAK----ASDDLVF 85

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
              +  +  I     A    +  ++ Q I + K   + +L+HC  G+DRTG + A+Y  I
Sbjct: 86  KNENFNLVHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYRII 145

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             ++  ++A +++    YG+          I ++ I +L+     K   +Q  N +
Sbjct: 146 FENWAIDDAVKEMKQGGYGYH---------IIWKNIDRLFTPENVKWIQQQLSNPS 192


>gi|237722313|ref|ZP_04552794.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_2_4]
 gi|262407523|ref|ZP_06084071.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_1_22]
 gi|294646817|ref|ZP_06724438.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294808854|ref|ZP_06767583.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|298483703|ref|ZP_07001877.1| protein tyrosine/serine phosphatase [Bacteroides sp. D22]
 gi|229448123|gb|EEO53914.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_2_4]
 gi|262354331|gb|EEZ03423.1| protein tyrosine/serine phosphatase [Bacteroides sp. 2_1_22]
 gi|292637762|gb|EFF56159.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294443896|gb|EFG12634.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|295087592|emb|CBK69115.1| Protein tyrosine/serine phosphatase [Bacteroides xylanisolvens
           XB1A]
 gi|298270120|gb|EFI11707.1| protein tyrosine/serine phosphatase [Bacteroides sp. D22]
          Length = 187

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 43/187 (22%), Positives = 81/187 (43%), Gaps = 10/187 (5%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           ++ LL   + ++  + +              +   N + +    +YRS QP+    +   
Sbjct: 3   KRILLSLLLGVIFSISIFSQNLKVEKITLPDSELTNLYKIDSG-VYRSEQPSHEDFKA-L 60

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           ++YGI   LNLR +  +         A    ++L      A   +N+EQ+ + + I+K  
Sbjct: 61  EKYGIGEALNLRNRHSDD------DEAAGTNVKLHRVKTKA-HSINEEQLIEALRIIKNR 113

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEK 186
             P++IHC  G+DRTG   A+Y  +  +  KE+A  +++   +G   + K I   I    
Sbjct: 114 KAPIVIHCHHGSDRTGAVCALYRVVFQNVSKEDAIHEMTEGGFGFHRIYKNIIRRIKEAD 173

Query: 187 ITQLYPN 193
           I Q+   
Sbjct: 174 IEQIRRK 180


>gi|239501722|ref|ZP_04661032.1| Dual specificity phosphatase, catalytic domain protein
           [Acinetobacter baumannii AB900]
          Length = 192

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 79/172 (45%), Gaps = 16/172 (9%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           + + T NF+ +  ++++RS QP+   I    K + I +I+NLR K       +      D
Sbjct: 36  LISQTHNFYQI-SNDVFRSEQPDAAMI-PELKHHQIGTIINLRAK----ASDDLVFKNED 89

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             +  I     A    +  ++ Q I + K   + +L+HC  G+DRTG + A+Y  I  ++
Sbjct: 90  FNLVHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYRIIFENW 149

Query: 157 PKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             ++A +++    YG+          I ++ I +L+     K   +Q  N +
Sbjct: 150 AIDDAVKEMKQGGYGYH---------IIWKNIDRLFTPENVKWIQQQLSNPS 192


>gi|78221312|ref|YP_383059.1| protein tyrosine/serine phosphatase [Geobacter metallireducens
           GS-15]
 gi|78192567|gb|ABB30334.1| protein tyrosine/serine phosphatase [Geobacter metallireducens
           GS-15]
          Length = 202

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/158 (23%), Positives = 71/158 (44%), Gaps = 18/158 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N   V P  IYR AQP     E   ++ GI+++++LR        + E++     G++ I
Sbjct: 61  NGGRVAPG-IYRGAQPGPEGYE-TLRKMGIRTVIDLRTT------ESEQREVEAAGMKAI 112

Query: 103 NFPL-SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             P+  +   L ++  + ++ +   A +P+ +HC+ G DRTG+  A Y   V  +   +A
Sbjct: 113 AIPIAMSRDGLREKVDRVVVLMADPANQPVFVHCRHGQDRTGIVVAAYRMKVEGWSLADA 172

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
             ++ S  +    +         F+K  + Y   + K 
Sbjct: 173 EAEMQSFGFNDVWIN--------FKKFIKSYGEQLPKR 202


>gi|325578243|ref|ZP_08148378.1| protein tyrosine/serine phosphatase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159979|gb|EGC72108.1| protein tyrosine/serine phosphatase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 205

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 49/171 (28%), Positives = 76/171 (44%), Gaps = 8/171 (4%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
            ++ T+ +  +N + +  ++ YRS Q      E L  +  I +I+NLR         +++
Sbjct: 39  EHWATLISEQENLYQI-DNKFYRSEQLEA-QSEALLNKLNIHTIVNLRFFDR----NDDK 92

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYL 150
           +A     I LIN PL       DE    L  I        +L+HC  GADRTGL  A Y 
Sbjct: 93  QAFGHTKINLINTPLLTWSISPDEVADILWQIKQHQKNGAVLVHCYHGADRTGLIVASYR 152

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
            I  H+   EA R++    YG+  V K I    T E + ++      + +T
Sbjct: 153 VIYQHWDLNEAKREMQQGPYGYHSVWKNIDNFFTQENMAKIKAELDKRSNT 203


>gi|262281114|ref|ZP_06058896.1| protein tyrosine/serine phosphatase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257345|gb|EEY76081.1| protein tyrosine/serine phosphatase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 193

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 80/177 (45%), Gaps = 16/177 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEE 91
             + T+ + + NF+ +    ++RS QP+ T +    K + I +I+NLR +       +  
Sbjct: 31  QDWGTLVSQSHNFYQI-SDTVFRSEQPDATMV-PELKRHQISTIINLRAR----ASDDLV 84

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
               +  +  I     A    +  ++ Q I I K   + +L+HC  G+DRTG + A+Y  
Sbjct: 85  FKNENFNLAHIPINTWAIDRQDLLEVMQQIKIAKQNNQRVLLHCYHGSDRTGASVAMYRI 144

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           I  ++  ++A +++    YG+            ++ I +L+     K   +Q  N++
Sbjct: 145 IFENWAIDDAVKEMKQGGYGYHI---------IWKNIDRLFTPKNVKWTQQQLSNSS 192


>gi|2702271|gb|AAB91974.1| unknown protein [Arabidopsis thaliana]
          Length = 218

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 56/149 (37%), Gaps = 17/149 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        K  G++SI++L    PE + +   +     GI L 
Sbjct: 59  NFSMVDNG-IFRSGFPDSANF-SFIKTLGLRSIISL---CPEPYPENNMQFLKSNGISLF 113

Query: 103 NFPLSATR-------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
            F +  ++        L+ +  + L  +L     PLLIHCK G  RTG        +   
Sbjct: 114 QFGIEGSKSKEPFVDILDQKIREALKVLLDEKNHPLLIHCKRGKHRTGCLVGCMRKL-QK 172

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           +       +    Y  F   K    D  F
Sbjct: 173 WCITSILDE----YKRFAAAKARVSDQRF 197


>gi|260557159|ref|ZP_05829375.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           19606]
 gi|260409265|gb|EEX02567.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           19606]
          Length = 192

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/176 (23%), Positives = 81/176 (46%), Gaps = 16/176 (9%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
            + T+ + T NF+ +  ++++RS QP+   I    K Y I +++NLR K       +   
Sbjct: 32  DWGTLVSQTHNFYQI-SNDVFRSEQPDAAMI-PELKHYQIGTVINLRAK----ASDDLVF 85

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
              +  +  I     A    +  ++ Q I + K   + +L+HC  G+DRTG + A+Y  I
Sbjct: 86  KNENFNLVHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYRII 145

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             ++  ++A +++    YG+          I ++ I +L+     K   +Q  N +
Sbjct: 146 FENWAIDDAVKEMKQGGYGYH---------IIWKNIDRLFTPENVKWIQQQLSNPS 192


>gi|193078301|gb|ABO13271.2| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           17978]
          Length = 192

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 77/168 (45%), Gaps = 16/168 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF+ +  ++++RS QP+   I    K + I +++NLR K       +      +  + 
Sbjct: 40  THNFYQI-SNDVFRSEQPDAAMI-PELKHHQIGTVINLRAK----ASDDLVFKNENFNLV 93

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            I     A    +  ++ Q I + K   + +L+HC  G+DRTG + A+Y  I  ++  ++
Sbjct: 94  HIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYRIIFENWAIDD 153

Query: 161 AHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           A +++    YG+          I ++ I +L+     K   +Q  N +
Sbjct: 154 AVKEMKQGGYGYH---------IIWKNIDRLFTPKNVKWIQQQLSNPS 192


>gi|169603942|ref|XP_001795392.1| hypothetical protein SNOG_04979 [Phaeosphaeria nodorum SN15]
 gi|111066250|gb|EAT87370.1| hypothetical protein SNOG_04979 [Phaeosphaeria nodorum SN15]
          Length = 278

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 46/165 (27%), Positives = 65/165 (39%), Gaps = 16/165 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+ AV+P  IYRS+ P     E   K+  IKSIL L   +PE    E +   +  GIQ  
Sbjct: 97  NYGAVLPGLIYRSSYPEQKNYE-FIKDLKIKSILTL---VPEPISAEYQDFMDKSGIQHF 152

Query: 103 NFPLSATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
              + A +      + E  + L  I+     P+LIHC  G  RTG   A +  I+     
Sbjct: 153 QVHIKANKGEVRVESCEMSRALRLIMDRTNHPILIHCNKGKHRTGCTVACFRRII-GADF 211

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
                +    Y  +  LK   MD   E   + +  N       Q 
Sbjct: 212 TTIVDE----YHTYAGLKARLMD---EVFFENFDLNNVMWFARQE 249


>gi|320039112|gb|EFW21047.1| protein-tyrosine phosphatase [Coccidioides posadasii str. Silveira]
          Length = 600

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 66/235 (28%), Gaps = 41/235 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPH----------------- 50
           +  +   +      +  L   SL  Y         +F+ + PH                 
Sbjct: 170 QDIVYGVWKAKEETLCGLKEFSLEEYEKYERVDMGDFNWITPHFLAFASPQYEPVAPIPQ 229

Query: 51  -------------EIYRSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                        E+Y S  P     +        I  ++ L  +L    +         
Sbjct: 230 NSPEFAALPSTISEVYASQLPVPFKNVLTHFASRNIGLVVRLNSELYSPSY------FTA 283

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           LGI  I+             +++ I +   + +  K + +HCK+G  RTG     YL   
Sbjct: 284 LGINHIDMIFEDGTCPPLPLVRRFIKLAHDMVSKNKGIAVHCKAGLGRTGCLIGAYLIYR 343

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             +   E    +     G     +   + +      + +  +  K      M AT
Sbjct: 344 HGFTANEVISFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDTLKEKLILSMPAT 398


>gi|119175631|ref|XP_001240007.1| hypothetical protein CIMG_09628 [Coccidioides immitis RS]
          Length = 600

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 66/235 (28%), Gaps = 41/235 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPH----------------- 50
           +  +   +      +  L   SL  Y         +F+ + PH                 
Sbjct: 170 QDIVYGVWKAKEETLCGLKEFSLEEYEKYERVDMGDFNWITPHFLAFASPQYEPVAPIPQ 229

Query: 51  -------------EIYRSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                        E+Y S  P     +        I  ++ L  +L    +         
Sbjct: 230 NSPEFAALPSTISEVYASQLPVPFKNVLTHFASRNIGLVVRLNSELYSPSY------FTA 283

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           LGI  I+             +++ I +   + +  K + +HCK+G  RTG     YL   
Sbjct: 284 LGINHIDMIFEDGTCPPLPLVRRFIKLAHDMISKNKGIAVHCKAGLGRTGCLIGAYLIYR 343

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             +   E    +     G     +   + +      + +  +  K      M AT
Sbjct: 344 HGFTANEVISFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDTLKEKLMLSMPAT 398


>gi|294950425|ref|XP_002786623.1| CDC14 phosphatase,, putative [Perkinsus marinus ATCC 50983]
 gi|239900915|gb|EER18419.1| CDC14 phosphatase,, putative [Perkinsus marinus ATCC 50983]
          Length = 315

 Score =  100 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/184 (14%), Positives = 59/184 (32%), Gaps = 22/184 (11%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKE--- 69
            F   +  G   L       +         + + +VP  I   A P+ T ++   +E   
Sbjct: 101 GFEFAVREGWFDLETFDRKAWEHYQQLPNGDMNWIVPARILAFAGPSDTLVDEQGQEVCH 160

Query: 70  ------------YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
                       +G+ +++ L  +                GI+  +         +DE +
Sbjct: 161 PDLYVKTFSTPDFGVSTVVRLNERRYSP------DFFTQHGIRHYDLNFEDGSCPSDEVV 214

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLK 176
           K+  +I+ ++   + +HCK+G  RTG    ++          +      +   G     +
Sbjct: 215 KRFFAIVDSSEGAVAVHCKAGLGRTGTLIGLWAMREYGLTAPQFIGWCRLCRPGSILGPQ 274

Query: 177 TITM 180
              +
Sbjct: 275 QAYL 278


>gi|33413875|gb|AAP38170.1| cell cycle protein cdc14 [Phytophthora infestans]
          Length = 423

 Score =  100 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 56/201 (27%), Gaps = 22/201 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      +    +      L  +         +   V P +    A P          
Sbjct: 144 DCLKGLERAMKSSYISTKTFDLHEFQHYERVENGDLTWVSP-KFIAFAGPHNVYQRTPQG 202

Query: 59  ----NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        K+     ++ L  K      + +EK     GI  I+           
Sbjct: 203 HVMLTPEHYIPYFKKRNGTLVVRLNDK------QYDEKKFLSAGIDHIDLIYPDGTNAPM 256

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             + + I   +  P  + +HCK+G  RTG     Y+     +   E    L +   G   
Sbjct: 257 PILMKFIEACEKTPGAVAVHCKAGLGRTGTCIGAYMMKHHLFSAHELIGWLRLCRPGSVI 316

Query: 174 VLKTITMDITFEKITQLYPNN 194
             +   M+    ++ QL P+ 
Sbjct: 317 GPQQQFMEAIESRMHQLNPSK 337


>gi|303318407|ref|XP_003069203.1| Dual specificity phosphatase, catalytic domain containing protein
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240108889|gb|EER27058.1| Dual specificity phosphatase, catalytic domain containing protein
           [Coccidioides posadasii C735 delta SOWgp]
          Length = 600

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 66/235 (28%), Gaps = 41/235 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPH----------------- 50
           +  +   +      +  L   SL  Y         +F+ + PH                 
Sbjct: 170 QDIVYGVWKAKEETLCGLKEFSLEEYEKYERVDMGDFNWITPHFLAFASPQYEPVAPIPQ 229

Query: 51  -------------EIYRSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                        E+Y S  P     +        I  ++ L  +L    +         
Sbjct: 230 NSPEFAALPSTISEVYASQLPVPFKNVLTHFASRNIGLVVRLNSELYSPSY------FTA 283

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           LGI  I+             +++ I +   + +  K + +HCK+G  RTG     YL   
Sbjct: 284 LGINHIDMIFEDGTCPPLPLVRRFIKLAHDMISKDKGIAVHCKAGLGRTGCLIGAYLIYR 343

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             +   E    +     G     +   + +      + +  +  K      M AT
Sbjct: 344 HGFTANEVISFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDTLKEKLILSMPAT 398


>gi|123433328|ref|XP_001308594.1| Dual specificity protein phosphatase CDC14A [Trichomonas vaginalis
           G3]
 gi|121890282|gb|EAX95664.1| Dual specificity protein phosphatase CDC14A, putative [Trichomonas
           vaginalis G3]
          Length = 403

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/196 (13%), Positives = 61/196 (31%), Gaps = 24/196 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             +   Y  + +G           +         + + ++P+++   A P          
Sbjct: 138 SCIKGLYHAMQIGWYNPDNFDAQDWKKYEQVENGDMNWLIPNKLLAFASPYATNCIRGGW 197

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                  +  +  E  I  ++ L     + ++ EE         +              E
Sbjct: 198 RVATPQDLVPVFAEKKITRVVRLC----QKFYDEE--IFKRASFEHTELYFLDGSTPPPE 251

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            + Q + I++ +   + +HCK+G  RTG  +A Y+     +   EA   + +   G    
Sbjct: 252 ILTQWLKIIEGSDI-VALHCKAGLGRTGTLAACYMIKDFGFTGHEAIGWIRLCRPGSIIG 310

Query: 175 LKTITMDITFEKITQL 190
            +    D   +    +
Sbjct: 311 DQQ---DYVLKYYENI 323


>gi|224014724|ref|XP_002297024.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220968404|gb|EED86752.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 326

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/201 (13%), Positives = 60/201 (29%), Gaps = 29/201 (14%)

Query: 9   KNLLIFYIKILLGVLV--LCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP-------- 58
             L         G         ++  Y         + + ++ ++I   A P        
Sbjct: 133 DCLRGLDKARKFGFFNRNPDTFNVEEYEYFEQVENGDLNWIIQNKILAFAGPQNQKLITP 192

Query: 59  ------NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
                           +  +K ++ L  K        EE+   + GI  +          
Sbjct: 193 EGFCMLTPADYIPYFLKKNVKLVVRLNKKC------YEEREFENAGINHVEHYYLDGSCP 246

Query: 113 NDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LY 169
           + + ++ +++ +++    + + IHCK+G  RTG     Y+         E    + +   
Sbjct: 247 DMKILRAVLADMESIAPDEAMAIHCKAGLGRTGTCIGAYMMKHYRMTAREVIGWMRICRP 306

Query: 170 GHFPVLKTITMDITFEKITQL 190
           G     +        E I QL
Sbjct: 307 GMVIGPQQ----HFLEDIEQL 323


>gi|302907190|ref|XP_003049591.1| hypothetical protein NECHADRAFT_30066 [Nectria haematococca mpVI
           77-13-4]
 gi|256730527|gb|EEU43878.1| hypothetical protein NECHADRAFT_30066 [Nectria haematococca mpVI
           77-13-4]
          Length = 299

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 66/170 (38%), Gaps = 16/170 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VVP  +YRS+ P     +   K   +K+I++L  K     H  E   A + GI+ 
Sbjct: 104 HNFGVVVPG-VYRSSFPKSHDFD-YIKGLKLKTIVSLVKKEEFD-HDLEMFVAQE-GIRQ 159

Query: 102 INFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           + F +  T+            L  +L     PLLIHC  G  RTG    V    VA +  
Sbjct: 160 VVFNMKGTKKEAIPLKTMKSILSIVLNKENYPLLIHCNHGKHRTGCVVGVVR-KVAGWDV 218

Query: 159 EEAHRQLSMLYGHFPVLKTITMD----ITFEKITQLYPNNVSKGDTEQPM 204
           +    +    Y  +   K+   D     +F+  T   PN +    T   M
Sbjct: 219 DNVVAE----YKSYAEPKSRECDIEYLSSFQTSTLCAPNALGPKYTRSQM 264


>gi|294658690|ref|XP_461028.2| DEHA2F15356p [Debaryomyces hansenii CBS767]
 gi|202953314|emb|CAG89398.2| DEHA2F15356p [Debaryomyces hansenii]
          Length = 574

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/185 (16%), Positives = 60/185 (32%), Gaps = 13/185 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIY--------RSAQPN 59
           +  +   +     G+L L + +L  Y         +F+ V    I         R  +P 
Sbjct: 142 QDIVYGMWRAKERGMLDLTSFNLEEYEQYERVDQGDFNVVSKDFIAFASPQQSMRGGKPG 201

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
               E  KK      + N++  +  + H  +       GIQ I+           E +++
Sbjct: 202 SLN-EPFKKVLNYFMLNNVQLVVRLNSHLYDASEFTKRGIQHIDMIFDDGTCPTLEYVQK 260

Query: 120 LISILK---TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVL 175
            I   +        + +HCK+G  RTG     +L     +   E    + +   G     
Sbjct: 261 FIGAAECVINKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECISYMRLVRPGMVVGP 320

Query: 176 KTITM 180
           +   +
Sbjct: 321 QQHWL 325


>gi|262371459|ref|ZP_06064775.1| protein tyrosine/serine phosphatase [Acinetobacter johnsonii SH046]
 gi|262313598|gb|EEY94649.1| protein tyrosine/serine phosphatase [Acinetobacter johnsonii SH046]
          Length = 191

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 76/169 (44%), Gaps = 20/169 (11%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF+ +    ++RS QP+   +    K   I  I+NLR +  +       K  ++ G +L
Sbjct: 40  HNFYQISE-TVFRSEQPDQ-NLVQSLKAQKIDVIINLRSRNQD------LKKLSNQGFEL 91

Query: 102 INFPLSATRELNDEQIKQL--ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           ++ P+       ++ +K +  I + +   + +L+HC  G+DRTG + A+Y  I  ++   
Sbjct: 92  VHIPIHTWAIDREDLLKVMQQIQLAEQNQQKVLLHCYHGSDRTGASVAMYRIIFQNWSTT 151

Query: 160 EAHRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           +A  ++    YG  P          ++ I  L+     K   +Q +N +
Sbjct: 152 DALAEMKHGGYGFHP---------IWQNIEPLFSPENIKWIQQQLLNPS 191


>gi|323456820|gb|EGB12686.1| hypothetical protein AURANDRAFT_19103 [Aureococcus anophagefferens]
          Length = 304

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/197 (12%), Positives = 55/197 (27%), Gaps = 22/197 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L   +           A  L  Y         + + +V  + +  A P+         
Sbjct: 108 HCLKGLHKARRFNFFNFDAFDLAEYEHFEAVENGDLNWIVEGKFFAFAGPHDRNRSSNLD 167

Query: 60  ------GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELN 113
                         +   +  I+ L       ++   +     +G   I+          
Sbjct: 168 GYQTLAPEDYGAYFQRKNVGLIVRLNK----PYY--NKSKFIQMGADHIDLYYLDGSNPP 221

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
              +K+ +++ + A   + +HCK+G  RTG     Y      +   E    + +   G  
Sbjct: 222 MRILKKFLAVAEQATGAIGVHCKAGLGRTGTCIGCYCMKHYKFTAAEIIGWMRVCRPGSV 281

Query: 173 PVLKTITMDITFEKITQ 189
              +   M    + + Q
Sbjct: 282 IGPQQHFMQEMEQTLWQ 298


>gi|260548832|ref|ZP_05823054.1| protein tyrosine/serine phosphatase [Acinetobacter sp. RUH2624]
 gi|260408000|gb|EEX01471.1| protein tyrosine/serine phosphatase [Acinetobacter sp. RUH2624]
          Length = 192

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 79/176 (44%), Gaps = 16/176 (9%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
            + T+ + T NF+ V  ++++RS QPN   I    K + I +I+NLR K       E   
Sbjct: 32  DWGTLVSQTHNFYQV-SNDVFRSEQPNAAMI-PELKHHQIGTIINLRAKDS----DELVF 85

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
              +  +  I     A    +  ++ Q I I K   + +L+HC  G+DRTG + A+Y  I
Sbjct: 86  KNENFNLVHIPIDTWAINRQDLLEVMQQIKIAKQNHQRVLLHCYHGSDRTGASVAMYRII 145

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
              +  ++A +++    YG+          I ++ I  L+     K   +Q  N +
Sbjct: 146 FEDWTIDDAVKEMKQGGYGYH---------IIWKNIDLLFTPENVKWIQQQLSNPS 192


>gi|164658257|ref|XP_001730254.1| hypothetical protein MGL_2636 [Malassezia globosa CBS 7966]
 gi|159104149|gb|EDP43040.1| hypothetical protein MGL_2636 [Malassezia globosa CBS 7966]
          Length = 287

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 65/168 (38%), Gaps = 22/168 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS+ P         K  G++S+L L     E + ++  +  ++ GI+  
Sbjct: 96  NFAMVNS-WVYRSSFPKKKHF-QFLKTLGLRSVLTLIL---EDYPEQNIQFLDENGIRFF 150

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            + +   +E      ++     L +IL     P+LIHC  G  RTG        +     
Sbjct: 151 QYGIPGNKEPFVQIPSETITAALATILDRRNHPMLIHCNKGKHRTGCLIGCLRKLQQ--- 207

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI-------TQLYPNNVSKG 198
              +   +   Y  F   K+ +MD  F ++        Q+ P  + K 
Sbjct: 208 --WSLTTIFDEYRRFSFPKSRSMDQEFIELYSEQAVWPQIQPEWLPKW 253


>gi|254576957|ref|XP_002494465.1| ZYRO0A02134p [Zygosaccharomyces rouxii]
 gi|238937354|emb|CAR25532.1| ZYRO0A02134p [Zygosaccharomyces rouxii]
          Length = 170

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/169 (26%), Positives = 68/169 (40%), Gaps = 15/169 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  EIYRS+ P      +LK    +KS+L L   +PE    E E+   + GIQL 
Sbjct: 10  NFSHVV-GEIYRSSFPRVENFYFLKHRLKLKSVLVL---IPEELPPENEEFLQEAGIQLF 65

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E       DE  + +  +L    +P+LIHC  G  RTG        +  ++ 
Sbjct: 66  QVGMSGNKEPFVNIPGDELTRAMEIVLNPQHQPILIHCNRGKHRTGCLIGCIRKL-QNWS 124

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF-EKITQLYPNNVSKGDTEQPMN 205
                  +   Y  F   K   +D  F E         ++  +   P+ 
Sbjct: 125 ----LTMIFDEYRRFAFPKARALDQQFIEMYNDSDIKRIASANNWLPIQ 169


>gi|325123389|gb|ADY82912.1| conserved hypothetical tyrosine/serine phosphatase [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 174

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 76/168 (45%), Gaps = 16/168 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF+ +  +++YRS QP+   I    K + I +I+NLR K              +  + 
Sbjct: 22  THNFYQI-SNDVYRSEQPDTAMI-SELKNHQIGTIINLRAKDA----DSLVFKNENFNLV 75

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            I     A    +  ++ Q I I K   + +L+HC  G+DRTG + A+Y  I  ++  ++
Sbjct: 76  HIPINTWAIDRQDLLEVMQQIKIAKQNDQRVLLHCYHGSDRTGASVAMYRIIFENWAIDD 135

Query: 161 AHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           A +++    YG+          I ++ I +L+     K   +Q  N +
Sbjct: 136 AVKEMKQGGYGYH---------IIWKNIDRLFTPENVKWIQQQLSNPS 174


>gi|294955490|ref|XP_002788531.1| dual specificity protein phosphatase CDC14B, putative [Perkinsus
           marinus ATCC 50983]
 gi|239904072|gb|EER20327.1| dual specificity protein phosphatase CDC14B, putative [Perkinsus
           marinus ATCC 50983]
          Length = 523

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 52/175 (29%), Gaps = 23/175 (13%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L       LLG    C   +  Y    +    + + ++P +I   + P          
Sbjct: 276 DCLCGLQYAYLLGWYDPCRFDINEYNYYASLQNGDLNWIIPGKILAFSSPQNERRDNRGF 335

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     + K  G++ I+ L  K        +       G   ++         +  
Sbjct: 336 PAHIPEDFHAVFKSMGVELIVRLNDK------LYDRNRFTSAGFAHMDLYFPDGTCPSQS 389

Query: 116 QIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY 169
            +    + +++ P   + +HCK+G  RTG    +Y      +    A   +    
Sbjct: 390 IMSYFFNAVESIPSGVIAVHCKAGLGRTGCLIGLYAMKRYGF---RARAWIGWNR 441


>gi|258572620|ref|XP_002545072.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237905342|gb|EEP79743.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 569

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 64/239 (26%), Gaps = 41/239 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVP-------------- 49
           I   +  +   +      +  L   SL  Y         +F+ V P              
Sbjct: 166 ILTIQDVVYGVWKAKEEALCGLKEFSLEEYEKYERVDMGDFNWVTPQFLAFASPQYEPIA 225

Query: 50  ----------------HEIYRSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                            E+Y S  P     +        I  ++ L  +L    +     
Sbjct: 226 PVPQNSPEFAALPSSISEVYASKLPVPFKNVLTHFASRNIGLVVRLNSELYSPSY----- 280

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVY 149
               LGI  I+             +++ I +   +    K + +HCK+G  RTG     Y
Sbjct: 281 -FTALGIHHIDMIFEDGTCPPLPLVRRFIKLAHDMIARNKGIAVHCKAGLGRTGCLIGAY 339

Query: 150 LYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           L     +   E    +     G     +   + +      + +  +  K      +  T
Sbjct: 340 LIYRYGFTANEVIAFMRFMRPGMVVGPQQHWLHMNQNSFREWWFEDTIKEKLMASVPVT 398


>gi|301111440|ref|XP_002904799.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
 gi|262095129|gb|EEY53181.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
          Length = 172

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 53/150 (35%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN        ++ G+KS+L L     +    E      +  I++ 
Sbjct: 13  NFSMVASG-VYRSGFPNRKNHA-FLQQLGLKSVLYL---CHQGHQPENVAFFEENNIEVF 67

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+   +E       D     L  +L     P+L+HC  G  RTG        +  ++ 
Sbjct: 68  QCPIDGNKEPFISINPDAMADALRHLLDVRNHPILVHCTKGTHRTGCVIGCMRKM-ENWS 126

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                 +    Y  F   +   +D  F + 
Sbjct: 127 LTSIIDE----YCRFAGPRMRLLDQQFIEF 152


>gi|70733565|ref|YP_257204.1| hypothetical protein PFL_0052 [Pseudomonas fluorescens Pf-5]
 gi|68347864|gb|AAY95470.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 223

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/167 (25%), Positives = 73/167 (43%), Gaps = 12/167 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA P+      L ++  + +++N   +   SW           GI  +
Sbjct: 49  NLYQMSP-TLYRSALPD-KGAVPLLQQLKVATVINFLPESDASWLSA-------PGINQV 99

Query: 103 NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             P       + + +K L +I    A  P+L+HCK G+DRTGL SA+Y  ++  + KEEA
Sbjct: 100 QLPYRTNHVDDADVLKALRAIQSAEAQGPVLMHCKHGSDRTGLMSAMYRVVIQGWSKEEA 159

Query: 162 HRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             +++   YG     K        +         ++ GD    + AT
Sbjct: 160 LNEMTQGGYGDSSHFKDGIR-YMMQADVDKLRTALANGDCSTSVFAT 205


>gi|242066678|ref|XP_002454628.1| hypothetical protein SORBIDRAFT_04g034500 [Sorghum bicolor]
 gi|241934459|gb|EES07604.1| hypothetical protein SORBIDRAFT_04g034500 [Sorghum bicolor]
          Length = 223

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/162 (23%), Positives = 60/162 (37%), Gaps = 27/162 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+     +L     ++SI+ L    PE + +E  +     GIQL 
Sbjct: 58  NFAMVDDG-IFRSGLPDAANFRFLLS-LNLRSIVYL---CPEPYPEENVQFLQQNGIQLH 112

Query: 103 NFPLSATR-----------------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLA 145
            F +  ++                    +   + L  IL    +P+LIHCK G  RTG  
Sbjct: 113 QFGIEGSKSGPTVPDTMLAQEPFVYIPEETIREALKVILDVRNQPVLIHCKRGKHRTGCV 172

Query: 146 SAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                 +   +        +   Y HF   K  + D  F ++
Sbjct: 173 VGCLRKL-QKWC----LSSVFDEYLHFAAAKARSTDQRFMEL 209


>gi|298709639|emb|CBJ31448.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 762

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/182 (13%), Positives = 59/182 (32%), Gaps = 27/182 (14%)

Query: 21  GVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP--------------NGTFIEYL 66
           G   L   +   Y         + + ++P +    + P                     +
Sbjct: 194 GHFDLGTFNADQYAFYDKIENGDLNWIIPGKFAAFSGPLATRREVEPGKWTLLAEDYIPI 253

Query: 67  KKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
            ++ GI  ++    K        + +   + GI+ ++         ++E +++ + I +T
Sbjct: 254 FRKLGITCVVRFNKKC------YDRRRFTEGGIRHVDLFYVDGGNPSEEILQRFLKICET 307

Query: 127 AP------KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTIT 179
                     + +HCK+G  RTG   A+Y+     Y   E+     +   G     +   
Sbjct: 308 TKASDAAYGAIAVHCKAGLGRTGTNIALYMMKHYGYTAAESIALCRICRPGSIVGPQQQF 367

Query: 180 MD 181
           + 
Sbjct: 368 LH 369


>gi|297470462|ref|XP_002683965.1| PREDICTED: LKHP9428-like [Bos taurus]
 gi|296491789|gb|DAA33822.1| LKHP9428-like [Bos taurus]
          Length = 174

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 80/176 (45%), Gaps = 16/176 (9%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
            + T+ + T NF+ V  ++++RS QPN   I    K + I +I+NLR K       E   
Sbjct: 14  DWGTLVSQTHNFYQV-SNDVFRSEQPNAAMI-PELKRHEIGTIINLRAKNS----DELVF 67

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
              +  +  I     A    +  ++ Q I I K   + +L+HC  G+DRTG + A+Y  I
Sbjct: 68  KNENFNLVHIPIDTWAINRQDLLEVMQQIKIAKQNNQRVLLHCYHGSDRTGASVAMYRII 127

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             H+  ++A +++    YG+            ++ I +L+     K   +Q  N +
Sbjct: 128 FEHWAIDDAVKEMKQGGYGYHI---------IWKNIDRLFTPENVKWIQQQLSNPS 174


>gi|126642889|ref|YP_001085873.1| protein tyrosine/serine phosphatase [Acinetobacter baumannii ATCC
           17978]
          Length = 174

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 76/168 (45%), Gaps = 16/168 (9%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T NF+ +  ++++RS QP+   I    K + I +++NLR K       +      +  + 
Sbjct: 22  THNFYQI-SNDVFRSEQPDAAMI-PELKHHQIGTVINLRAK----ASDDLVFKNENFNLV 75

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            I     A    +  ++ Q I + K   + +L+HC  G+DRTG + A+Y  I  ++  ++
Sbjct: 76  HIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVAMYRIIFENWAIDD 135

Query: 161 AHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           A +++    YG+            ++ I +L+     K   +Q  N +
Sbjct: 136 AVKEMKQGGYGYHI---------IWKNIDRLFTPKNVKWIQQQLSNPS 174


>gi|85111022|ref|XP_963738.1| tyrosine-protein phosphatase CDC14 [Neurospora crassa OR74A]
 gi|28925461|gb|EAA34502.1| tyrosine-protein phosphatase CDC14 [Neurospora crassa OR74A]
          Length = 631

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/233 (13%), Positives = 62/233 (26%), Gaps = 42/233 (18%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G  VL    L  Y         +F+ + P+ + + S Q         
Sbjct: 150 QDVVYGVWKAKEEGCCVLETFDLDEYEKFERVEHGDFNWITPNFLAFASPQHTPVAPTPE 209

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +     E  I  ++ L  +L    +        
Sbjct: 210 GTEQWSLLPKTLAAVDAHPTLPQPFKNVLRHFSERDIGLVVRLNSQLYNPSY------FE 263

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKT---APKPLLIHCKSGADRTGLASAVYLYI 152
            LGI  I+             +++ I +        K + +HCK+G  RTG     YL  
Sbjct: 264 ALGINHIDMIFEDGTCPTLSTVRKFIRMAHETISRKKGIAVHCKAGLGRTGCLIGAYLIY 323

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPM 204
              +   E    +     G     +   + +      + +     +    + M
Sbjct: 324 RHGFTANEVIAYMRFMRPGMVVGPQQHWLHLNQGIFREWWIEERVERRLRKEM 376


>gi|296424468|ref|XP_002841770.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638018|emb|CAZ85961.1| unnamed protein product [Tuber melanosporum]
          Length = 618

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/217 (14%), Positives = 61/217 (28%), Gaps = 37/217 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPH------------- 50
           +   +  +   +     G++ L    L  Y         +F+ + P+             
Sbjct: 181 VLNVQDVVYGVWKAKEKGIVNLREFGLDEYEKFERVDMGDFNWISPNFLAFASPQFTLPP 240

Query: 51  -------------EIYRSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                        EI  S  P     +        I  ++ L        H    +    
Sbjct: 241 PNRPQPHLPTNQEEILASGLPVPFRNVLEHFHTRDIGLVVRLNS------HLYPAEYFTA 294

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIV 153
           LGI  I+             +++ I++        K + +HCK+G  RTG     YL   
Sbjct: 295 LGITHIDMVFDDGTCPPLNLVRKFINLAHQTIAQGKNIAVHCKAGLGRTGCLIGAYLVYR 354

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQ 189
             +   E    +     G     +   + +  ++  Q
Sbjct: 355 YGFTANEVIAFMRFMRPGMVVGPQQHWLHLNQDEFRQ 391


>gi|222053184|ref|YP_002535546.1| protein tyrosine/serine phosphatase [Geobacter sp. FRC-32]
 gi|221562473|gb|ACM18445.1| protein tyrosine/serine phosphatase [Geobacter sp. FRC-32]
          Length = 200

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 9/125 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N   + P  IYR AQP         K+ GIK++++LR        + E+      G++ 
Sbjct: 59  TNVGHIAPG-IYRGAQPGADGYA-TLKKMGIKTVIDLRTS------ESEKAQVEAAGMRA 110

Query: 102 INFPL-SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           I  P+  +   L ++    +  +   A +P+ +HC+ G DRTG+  A Y   V  +   E
Sbjct: 111 IAVPIAMSRDGLKEKVDGVVALLADPANQPIFVHCRHGQDRTGIVVAAYRMKVDKWSLAE 170

Query: 161 AHRQL 165
           A +++
Sbjct: 171 AEKEM 175


>gi|224064882|ref|XP_002301598.1| predicted protein [Populus trichocarpa]
 gi|222843324|gb|EEE80871.1| predicted protein [Populus trichocarpa]
          Length = 208

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 59/150 (39%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SI+ L    PE + +   +   D GI+L 
Sbjct: 51  NFAMVDNG-IFRSGFPDSVNF-SFLQTLGLRSIICL---CPEPYTEATTEFLKDGGIRLY 105

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F + + +E       D   + L  +L     P+LIHCK G  RTG        +   + 
Sbjct: 106 QFGIESYKEPFVNIPQDTIREALQVVLDVKNHPILIHCKRGKHRTGCLVGCLRKL-QKWC 164

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F V K    D  F ++
Sbjct: 165 ----LSSIFDEYQRFAVAKARISDQRFMEL 190


>gi|300693572|ref|YP_003749545.1| tyrosine phosphatase protein [Ralstonia solanacearum PSI07]
 gi|299075609|emb|CBJ34902.1| putative tyrosine phosphatase protein [Ralstonia solanacearum
           PSI07]
          Length = 230

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/144 (28%), Positives = 60/144 (41%), Gaps = 13/144 (9%)

Query: 43  NFHAVV--PHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEEKAANDLGI 99
           NFH V     +++R  QP       L    GIK+I+ L R        + E+  A   G+
Sbjct: 57  NFHEVEGTSGKLFRGGQPLDESEWNLLANNGIKTIIKLNRYSGSTDTDETEKMNAAKHGM 116

Query: 100 QLINFPLSA-------TRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLASAVYL 150
            +I   +          R  +D Q  + ++ +   T+     +HC  G DRTGL  A+Y 
Sbjct: 117 MIIPIYMPPEDNSLAFWRAPDDSQTDKALTAISESTSHGATYVHCSHGKDRTGLVIALYQ 176

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPV 174
             V H  K  A + L   YGH P 
Sbjct: 177 MRVQHKCKAAAMKDL-WDYGHSPW 199


>gi|67537774|ref|XP_662661.1| hypothetical protein AN5057.2 [Aspergillus nidulans FGSC A4]
 gi|40740861|gb|EAA60051.1| hypothetical protein AN5057.2 [Aspergillus nidulans FGSC A4]
 gi|259482063|tpe|CBF76183.1| TPA: protein-tyrosine phosphatase, putative (AFU_orthologue;
           AFUA_3G12250) [Aspergillus nidulans FGSC A4]
          Length = 595

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/246 (16%), Positives = 70/246 (28%), Gaps = 55/246 (22%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG-- 60
           I   +  +   +     GV  L   SL  Y         +F+ + PH + + S Q     
Sbjct: 162 ILNIQDVVYGVWKAKEQGVCGLRDFSLEEYEKFERVDMGDFNWISPHFLAFASPQHQPVA 221

Query: 61  ----------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                                         +       G+  ++ L  +L    +     
Sbjct: 222 PIPRDSPEYAALPSTVSEVRSSRLPLPFKNVLEHFATRGVGLVVRLNSELYSPSY----- 276

Query: 93  AANDLGIQLINFPLSATRELN----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAV 148
               LGI  I+               + I+    ++    K + +HCK+G  RTG     
Sbjct: 277 -FTALGISHIDMIFEDGTCPPLPLVKKFIRMAHEMINVKHKAIAVHCKAGLGRTGCLIGA 335

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM-------------DITFEKITQLYPNN 194
           YL     +   E    +     G     +   +             D   EK+ Q+ PN 
Sbjct: 336 YLIYRYGFTANEVIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDCMKEKLAQMQPNP 395

Query: 195 VSKGDT 200
           V+ G +
Sbjct: 396 VTPGRS 401


>gi|302780857|ref|XP_002972203.1| hypothetical protein SELMODRAFT_412771 [Selaginella moellendorffii]
 gi|302791497|ref|XP_002977515.1| hypothetical protein SELMODRAFT_107045 [Selaginella moellendorffii]
 gi|300154885|gb|EFJ21519.1| hypothetical protein SELMODRAFT_107045 [Selaginella moellendorffii]
 gi|300160502|gb|EFJ27120.1| hypothetical protein SELMODRAFT_412771 [Selaginella moellendorffii]
          Length = 223

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/148 (25%), Positives = 55/148 (37%), Gaps = 17/148 (11%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    IYRS+ P    +    K+  ++SI+ L    PE +   E     +  I+L
Sbjct: 31  PNFGMVDWG-IYRSSYPTAENL-PFLKKLRLRSIVYL---CPEPYLNHE--FVAENKIKL 83

Query: 102 INFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F +    E   E  + +I      +L     PLLIHC  G  RTG+    Y   V  +
Sbjct: 84  FQFGIEGKCEPAVEIPEGVIRDALRVVLDVENYPLLIHCNRGKHRTGVLVGCYR-KVHKW 142

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITF 184
                  +    Y  +   K    D  F
Sbjct: 143 SLASILDE----YDRYAGAKARLRDKQF 166


>gi|294463032|gb|ADE77054.1| unknown [Picea sitchensis]
          Length = 194

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 56/150 (37%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N+  V    +YRS  P+        +   ++SI+ L    PE + +   +      IQL 
Sbjct: 26  NYAMVHKG-VYRSGFPSAVNF-PYLETLRLRSIIYL---CPEPYPEANTEFLRAHNIQLF 80

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       D   + L  +L     P+LIHCK G  RTG        I  ++ 
Sbjct: 81  QFGIEGHKEPFVNIPEDTIREALKVLLDPRNHPVLIHCKRGKHRTGCLVGCLRKI-QNWC 139

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y HF   K    D  F ++
Sbjct: 140 ----LSSVFAEYQHFAAAKARVSDQRFIEL 165


>gi|325182811|emb|CCA17266.1| dual specificity protein phosphatase putative [Albugo laibachii
           Nc14]
          Length = 409

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 62/213 (29%), Gaps = 24/213 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L      I    +      L  Y         +   V P +    A P          
Sbjct: 138 DCLQGLEKAIQRRYVSTQTFQLREYQHYEQVENGDLTWVSP-KFIAFAGPHQQYSRTPQG 196

Query: 59  ----NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                        K   +  ++ L  K      + +E    D GI+ ++           
Sbjct: 197 HVMLTPEQYIPYFKAKNVTLVVRLNEK------QYDENRFIDAGIEHLDLIYPDGTNAPI 250

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
             + + I   +     + +HCK+G  RTG     Y+     +   +    L +   G   
Sbjct: 251 PILLKFIEACEKTSGAVAVHCKAGLGRTGTCIGAYMMKHDLFTAHQLIGWLRLCRPGSVI 310

Query: 174 VLKTITMDITFEKITQLYPNN--VSKGDTEQPM 204
             +   ++     +   YP++  ++ G++ + M
Sbjct: 311 GPQQQFLESIQSVMWASYPSSWPIAPGNSTRLM 343


>gi|29345614|ref|NP_809117.1| hypothetical protein BT_0204 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29337506|gb|AAO75311.1| protein tyrosine/serine phosphatase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 169

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 70/162 (43%), Gaps = 10/162 (6%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +   V              +   N + +    +YRS QP+    +   ++YGI+ +LNLR
Sbjct: 1   MSFSVYGQNINAEKITVPDSKLTNLYQIDSG-VYRSEQPSDADFKA-LEKYGIREVLNLR 58

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGA 139
            +  +         A    I+L    + A    +++Q+   + I+K    P++ HC  G+
Sbjct: 59  NRHSDD------DEAAGTKIKLYRLKMKAHSV-SEDQLINALRIIKNRKGPIVFHCHHGS 111

Query: 140 DRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
           DRTG   A+Y  +     K++A ++++   +G   + K I  
Sbjct: 112 DRTGAVCAMYRIVFQGVSKQKAIQEMTEGGFGFHRIYKNIIR 153


>gi|312218798|emb|CBX98743.1| hypothetical protein [Leptosphaeria maculans]
          Length = 801

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 69/240 (28%), Gaps = 42/240 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIY---------- 53
           +   +  +   +     G+  L   SL  Y         +F+ V P  +           
Sbjct: 350 VLNIQDVIYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWVTPQFLAFASPQQQPTH 409

Query: 54  --------------------RSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                               RSA P     +        I  ++ L  +L  S +     
Sbjct: 410 EIPPSSPLYATLPSNVAEIQRSALPGPFKNVLSHFTTRNIGLVVRLNSELYSSSY----- 464

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
               LGIQ +N             +++ I++         K + +HCK+G  RTG     
Sbjct: 465 -FTKLGIQHLNMIFDDGTCPPMSLVRKFINLAHEMITVHKKGIAVHCKAGLGRTGCLIGA 523

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           YL     +   E    +     G     +   + +      + +  +  K    Q M +T
Sbjct: 524 YLIYKHGFTANEIIAYMRFMRPGMVVGPQQHWLHLNQSTFREWWHEDTMKAKYAQMMPST 583


>gi|118384317|ref|XP_001025309.1| Protein-tyrosine phosphatase containing protein [Tetrahymena
           thermophila]
 gi|89307076|gb|EAS05064.1| Protein-tyrosine phosphatase containing protein [Tetrahymena
           thermophila SB210]
          Length = 535

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/186 (12%), Positives = 55/186 (29%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
                      LG        +  Y         NF+ + P +      P          
Sbjct: 150 DCWKGLKKANSLGWYNPDTFDVKYYNHHSKPENGNFNIIAPSKFVAFNGPYFTRIDLRGY 209

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +  G+ +I+ L  K        +EK     G + +++          +
Sbjct: 210 RRNVVEDYIEPFRSLGVTTIVRLNSK------DYDEKKFISKGFRHLDYFFPDGTAPRKD 263

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            I++ ++ +++    + +HC +G  RT      Y+     +  +E    + +   G    
Sbjct: 264 LIQKFLNQIESIDGVIAVHCHAGLGRTATMIGAYVIKHHKFTADEFIAWVRICRPGSVHG 323

Query: 175 LKTITM 180
            + + +
Sbjct: 324 PQQLLL 329


>gi|319796308|ref|YP_004157948.1| protein tyrosine/serine phosphatase [Variovorax paradoxus EPS]
 gi|315598771|gb|ADU39837.1| protein tyrosine/serine phosphatase [Variovorax paradoxus EPS]
          Length = 180

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/166 (27%), Positives = 78/166 (46%), Gaps = 15/166 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P  +YRSAQP    +    +  GI++I++LR         ++ K     GI+L+
Sbjct: 25  NLHRITP-TLYRSAQPRRANVAA-LQSLGIRTIVSLRS------FNDDRKVFAGSGIRLV 76

Query: 103 NFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             P++     + + ++ L++I +     P+LIHC  GADRTG+ +AVY   V  + KE A
Sbjct: 77  RVPINTWSIDDAKVLRALVAIREAEKQGPVLIHCMHGADRTGVVAAVYRMAVQGWDKESA 136

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
             ++    YG+  + +          I +L P  +       P+  
Sbjct: 137 RHEMLRGGYGYHTLWRN-----IPRYIERLDPLKMGHALAHAPVIP 177


>gi|304322339|ref|YP_003855982.1| protein tyrosine/serine phosphatase [Parvularcula bermudensis
           HTCC2503]
 gi|303301241|gb|ADM10840.1| protein tyrosine/serine phosphatase [Parvularcula bermudensis
           HTCC2503]
          Length = 210

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 64/136 (47%), Gaps = 10/136 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N   V    + RS QP    +  L+  YG++ ++NL          +E   A  LG+  +
Sbjct: 16  NLQIVDDGALLRSGQPTPLGLAELRDRYGVRMVINL----DRGTSDDEMVVALALGLDYL 71

Query: 103 NFPLSATRELNDEQIKQLISILKTAPK----PLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             P +    L  E +  L++ L+ A +    P+L+HC+SG DRTG A AV+  I   +  
Sbjct: 72  AIPTATYG-LERENLVTLLAALRQAERDGRTPVLVHCRSGQDRTGAAVAVFRTIEEDWSA 130

Query: 159 EEAHRQLSMLYGHFPV 174
           E+A  ++   Y H+  
Sbjct: 131 EDAEAEMQ-RYRHWTH 145


>gi|47212289|emb|CAF92860.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 362

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/223 (11%), Positives = 59/223 (26%), Gaps = 62/223 (27%)

Query: 14  FYIKILLGVLVLCAVSLGLYFLTI------------------------------------ 37
            +  +  G       S+  Y                                        
Sbjct: 145 LFQALQHGFFDFETFSVDEYEHYEVRSSRRLYRAADAPVCVRACVCVCVCVSLCVCACVC 204

Query: 38  ------TTFTQNFHAVVPHEIYRSAQPNG-------------TFIEYLKKEYGIKSILNL 78
                      + + +VP ++   + P+                     +++ + +++ L
Sbjct: 205 PPLSSQRVENGDLNWIVPRKLLAFSGPHPRSKVENGYPLHAPEAYFPYFRKHNVGAVVRL 264

Query: 79  RGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSG 138
             K+       + K   D G    +         +D   ++ + I ++    + +HCK+G
Sbjct: 265 NKKI------YDSKRFTDAGFHHHDLFFLDGSTPSDIITQRFLHICESTEGAVAVHCKAG 318

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
             RTG     YL     +   EA   + +   G     +   +
Sbjct: 319 LGRTGTLIGCYLMKQYCFTAAEAIGWIRICRPGSVIGPQQNYL 361


>gi|115398235|ref|XP_001214709.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114192900|gb|EAU34600.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 236

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 60/165 (36%), Gaps = 18/165 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-KEEEKAANDLGIQ 100
            NF  VV   +YRS  P+   +    K   ++S+L L   + E +          D GI 
Sbjct: 51  PNFGEVVRG-VYRSGFPSVWHL-PSLKTLNLRSVLTL---VEEPYTIPNYTNILRDNGIN 105

Query: 101 LINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
                +   ++           + L  IL  A  P+L+HC  G  RTG   A +  +   
Sbjct: 106 HFCIKVLPNKDPAIKTSQQTMNEILEIILNKANHPILVHCNKGKHRTGCVIACFRKL-QG 164

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDT 200
           +  ++   +    Y  +   K+  +D   E I     + ++    
Sbjct: 165 WKHDDVINE----YLKYACPKSRVLD--LEYIDAFDASKLAHRAL 203


>gi|315053457|ref|XP_003176102.1| tyrosine-protein phosphatase CDC14 [Arthroderma gypseum CBS 118893]
 gi|311337948|gb|EFQ97150.1| tyrosine-protein phosphatase CDC14 [Arthroderma gypseum CBS 118893]
          Length = 606

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 63/236 (26%), Gaps = 42/236 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + P  + + S Q +       
Sbjct: 174 QDVVYGVWKAKEEGLCGLKDFSLEEYEKYERVDMGDFNWITPSFLAFASPQHSPIAVVPQ 233

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        +  ++ L  +L    +         
Sbjct: 234 NTPEFAALPSTIDQVQDSELPVPFKNVLTHFSSRNVGLVVRLNSELYSPSY------FTA 287

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLYI 152
           LGI  I+             +K+ I +         K + IHCK+G  RTG     YL  
Sbjct: 288 LGINHIDMIFEDGTCPPLPLVKRFIKMAHEMITIKEKGIAIHCKAGLGRTGCLIGAYLIY 347

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
              +   E    +     G     +   + +      + +  +  K     P   T
Sbjct: 348 RYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWLEDQLKEKLSLPTPTT 403


>gi|296814354|ref|XP_002847514.1| tyrosine-protein phosphatase CDC14 [Arthroderma otae CBS 113480]
 gi|238840539|gb|EEQ30201.1| tyrosine-protein phosphatase CDC14 [Arthroderma otae CBS 113480]
          Length = 607

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/236 (13%), Positives = 63/236 (26%), Gaps = 42/236 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + P+ + + S Q +       
Sbjct: 175 QDVVYGVWKAKEEGLCGLKDFSLEEYEKYERVDMGDFNWITPNFLAFASPQHSPTAVIPQ 234

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        +  ++ L  +L    +         
Sbjct: 235 NTAEFAALPSTINQVQDSDLPVPFKNVLTHFSTRNVGLVVRLNSELYSPSY------FTA 288

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLYI 152
           L I  I+             +K+ I +         K + IHCK+G  RTG     YL  
Sbjct: 289 LNINHIDMIFEDGTCPPLPLVKRFIKMAHEMITIKEKGIAIHCKAGLGRTGCLIGAYLIY 348

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
              +   E    +     G     +   + +      + +  +  K     P   T
Sbjct: 349 RYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDQLKEKLSLPTPTT 404


>gi|158523189|ref|YP_001531059.1| protein tyrosine/serine phosphatase [Desulfococcus oleovorans Hxd3]
 gi|158512015|gb|ABW68982.1| protein tyrosine/serine phosphatase [Desulfococcus oleovorans Hxd3]
          Length = 192

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/160 (28%), Positives = 71/160 (44%), Gaps = 19/160 (11%)

Query: 16  IKILLGVLVLCAVSLGLYFLTIT-------TFTQ---NFHAVVPHEIYRSAQPNGTFIEY 65
             + L V +L A +L      +               N+H V   ++YRSAQPN   +  
Sbjct: 6   KTLTLLVFLLSAATLYAEEPRVRPDTWARPIINTDLKNWHRV-DDKVYRSAQPNAEEM-N 63

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK 125
             + +GI+ +LNLR          ++  A   G+ L   P SA R +  EQ+ + + I+ 
Sbjct: 64  AVESFGIEEVLNLRN------LFSDDDEAEGTGLVLHRIPSSAGR-MTREQVTEALKIIN 116

Query: 126 TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            A  P+L+HC  GADRTG   A +      +  E A  ++
Sbjct: 117 DAKGPILVHCWHGADRTGAVVAAWRMAAHGWSAEAAIDEM 156


>gi|115478090|ref|NP_001062640.1| Os09g0135700 [Oryza sativa Japonica Group]
 gi|47848431|dbj|BAD22288.1| putative tyrosine specific protein phosphatase protein [Oryza
           sativa Japonica Group]
 gi|113630873|dbj|BAF24554.1| Os09g0135700 [Oryza sativa Japonica Group]
 gi|215768452|dbj|BAH00681.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218201709|gb|EEC84136.1| hypothetical protein OsI_30482 [Oryza sativa Indica Group]
 gi|222641097|gb|EEE69229.1| hypothetical protein OsJ_28466 [Oryza sativa Japonica Group]
          Length = 222

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 61/153 (39%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P+ + +    +   ++S+L L    PE + +  ++     GI+L 
Sbjct: 68  NFAMVDHG-VYRSGFPDISNL-PFVESLRLRSVLCL---CPEPYPEANQEFLRAHGIRLF 122

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +  ++E       D   + L  +L  A  P+LIHCK G  RTG        +     
Sbjct: 123 QFGIDGSKEPFVNIPEDRIREALKVVLDVANHPVLIHCKRGKHRTGCVVGCLRKLQ---- 178

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K    D+ F ++  +
Sbjct: 179 -RWCLTSIFDEYQRFAAAKARVSDLRFMELFDI 210


>gi|327309334|ref|XP_003239358.1| protein-tyrosine phosphatase [Trichophyton rubrum CBS 118892]
 gi|326459614|gb|EGD85067.1| protein-tyrosine phosphatase [Trichophyton rubrum CBS 118892]
          Length = 607

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 63/236 (26%), Gaps = 42/236 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + P  + + S Q +       
Sbjct: 174 QDVVYGVWKAKEEGLCGLKDFSLEEYEKYERVDMGDFNWITPSFLAFASPQHSPTAVVPQ 233

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        +  ++ L  +L    +         
Sbjct: 234 NTPEFAALPSTIEQIQDSELPVPFKNVLTHFSTRNVGLVVRLNSELYSPSY------FTA 287

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLYI 152
           LGI  I+             +K+ I +         K + IHCK+G  RTG     YL  
Sbjct: 288 LGINHIDMIFEDGTCPPLPLVKRFIKMAHEMITIKEKGIAIHCKAGLGRTGCLIGAYLIY 347

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
              +   E    +     G     +   + +      + +  +  K     P   T
Sbjct: 348 RYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDQLKEKLSLPTPTT 403


>gi|169632471|ref|YP_001706207.1| putative phosphatase [Acinetobacter baumannii SDF]
 gi|169151263|emb|CAO99956.1| conserved hypothetical protein; putative phosphatase [Acinetobacter
           baumannii]
          Length = 192

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 80/173 (46%), Gaps = 16/173 (9%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           T+ + T NF+ +  ++++RS QP+   I    K + I +I+NLR K       +      
Sbjct: 35  TLVSQTHNFYQI-SNDVFRSEQPDAAMI-PELKHHQIGTIINLRAK----ASDDLVFKNE 88

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           +  +  I     A    +  ++ Q I + K   + +L+HC  G+DRTG + ++Y  I  +
Sbjct: 89  NFNLIHIPINTWAIDRQDLLEVMQQIQLAKQNNQRVLLHCYHGSDRTGASVSMYRIIFEN 148

Query: 156 YPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           +  ++A +++    YG+          I ++ I +L+     K   +Q  N +
Sbjct: 149 WVIDDAVKEMKQGGYGYH---------IIWKNIDRLFTPENVKWIQQQLSNPS 192


>gi|302413737|ref|XP_003004701.1| tyrosine-protein phosphatase SIW14 [Verticillium albo-atrum
           VaMs.102]
 gi|261357277|gb|EEY19705.1| tyrosine-protein phosphatase SIW14 [Verticillium albo-atrum
           VaMs.102]
          Length = 362

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 59/168 (35%), Gaps = 20/168 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEEKAANDLGIQL 101
           NF  VVP  +YRS+ P         K  G+++I+ L R   P+ ++           I+ 
Sbjct: 126 NFGIVVPG-VYRSSYPKPEDF-GFVKNLGLRTIVTLGRRDEPDEFYAN---FLASNSIRH 180

Query: 102 INFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +  T+            L  +L     PL+IHC  G  RTG   AV   +   +  
Sbjct: 181 HIIEMKGTKKQSIPLMTMRDILRIVLDKQQYPLMIHCNHGKHRTGCVVAVVRKLS-GWDV 239

Query: 159 EEAHRQLSMLYGHFPVLK------TITMDITFEKITQLYPNNVSKGDT 200
                +    Y  F   K          +   + ++ L+ + VS    
Sbjct: 240 SNVLDE----YRSFAEPKVRDCDIAYITNFAVDDLSNLHVHAVSMRYR 283


>gi|125536422|gb|EAY82910.1| hypothetical protein OsI_38124 [Oryza sativa Indica Group]
          Length = 196

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/147 (23%), Positives = 59/147 (40%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P+        +  G++S++ L    PE + +   +     GI+L 
Sbjct: 25  NFGMVDTG-VYRSGFPDPASF-GFLRGLGLRSVVYL---CPEPYMETNAEFLKAEGIRLF 79

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   ++ N     D  +  L  IL     P+LIHCK G  RTG     +  +  ++ 
Sbjct: 80  QFGIEGNKDPNVSIPVDAIMGALRVILDVRNHPVLIHCKRGKHRTGCLVGCFRKL-QNWC 138

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                  +   Y  +   K+   D+ F
Sbjct: 139 ----LSSVFEEYHRYAAGKSRLSDLKF 161


>gi|325192716|emb|CCA27129.1| tyrosine phosphatase putative [Albugo laibachii Nc14]
          Length = 154

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 56/150 (37%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN        ++ G++SIL L     +    +      + GIQ+ 
Sbjct: 13  NFSMVDAG-VYRSGYPNKKN-HSFLRQLGLRSILYL---CHQPLRADNLLFFQENGIQIF 67

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           + P+   +E       +     L  +L  +  P+L+HC  G  RTG     Y  I   + 
Sbjct: 68  HCPIDGNKEPFIGIDPEAMAGALRHLLDPSNHPILVHCTKGTHRTGCVIGCYRKIQY-WS 126

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                 +    Y  F   +   +D  F + 
Sbjct: 127 LTSIIDE----YCRFAGPRMRLLDQQFIEF 152


>gi|257468724|ref|ZP_05632818.1| hypothetical protein FulcA4_05240 [Fusobacterium ulcerans ATCC
           49185]
          Length = 204

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 74/139 (53%), Gaps = 13/139 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF+ V    ++RS QP    ++ ++  +GI ++++LR +  +       + A +  + LI
Sbjct: 52  NFYKVSE-TLFRSEQPTEDGMKNIEA-FGIGTVISLRSRQKD------VELAKNTELNLI 103

Query: 103 NFPLSATRELNDEQIKQLISIL----KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +  + A     ++ +K +  +     +T  KP+LIHC  GADRTG+  A+Y  +  ++ +
Sbjct: 104 HVSMRAWNPKYEDAVKVMYFLNPNNPETNKKPILIHCYHGADRTGMMVALYRMVYQNWER 163

Query: 159 EEAHRQL-SMLYGHFPVLK 176
           EEA  ++ +  YG+  + K
Sbjct: 164 EEALNEMLNGGYGYHSMWK 182


>gi|226493145|ref|NP_001150333.1| tyrosine specific protein phosphatase family protein [Zea mays]
 gi|195638458|gb|ACG38697.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 222

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/162 (22%), Positives = 60/162 (37%), Gaps = 27/162 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+     +L     ++S++ L    PE + +E  +     GIQL 
Sbjct: 57  NFAMVDDG-IFRSGLPDAGSFRFLLS-LNLRSVVYL---CPEPYPEENARFLQQNGIQLH 111

Query: 103 NFPLSATR-----------------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLA 145
            F +  ++                    +   + L  IL    +P+LIHCK G  RTG  
Sbjct: 112 QFGIEGSKSGSTVPDAMVVQEPFVYIPEETIREALKVILDARNQPVLIHCKRGKHRTGCV 171

Query: 146 SAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                 +   +        +   Y HF   K  + D  F ++
Sbjct: 172 VGCLRKL-QKWC----LSSVFDEYLHFAAAKARSTDQRFMEL 208


>gi|190345908|gb|EDK37876.2| hypothetical protein PGUG_01974 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 296

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 61/150 (40%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+ + IYRS+ P         +   +KSIL L   +PE + +  +    + GI+L 
Sbjct: 131 NFAPVI-NNIYRSSFPQIHSF-SFLRTLKLKSILCL---IPEEYPQMHKDFFEEEGIKLF 185

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E       D   + +  +L    +P+LIHC  G  RTG    V   +   + 
Sbjct: 186 QMGMSGNKEPFVKIPPDLVTEAVKVVLDPRNQPILIHCNRGKHRTGCLVGVIRRL-QRWS 244

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   MD  F ++
Sbjct: 245 LTI----IFDEYRKFAAPKERPMDQQFIEL 270


>gi|326469236|gb|EGD93245.1| protein-tyrosine phosphatase [Trichophyton tonsurans CBS 112818]
 gi|326483484|gb|EGE07494.1| protein-tyrosine phosphatase [Trichophyton equinum CBS 127.97]
          Length = 607

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 63/236 (26%), Gaps = 42/236 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + P  + + S Q +       
Sbjct: 174 QDVVYGVWKAKEEGLCGLKDFSLEEYEKYERVDMGDFNWITPSFLAFASPQHSPTAVVPQ 233

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        +  ++ L  +L    +         
Sbjct: 234 NTPEFAALPSTIEQIQDSELPVPFKNVLTHFSTRNVGLVVRLNSELYSPSY------FTA 287

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLYI 152
           LGI  I+             +K+ I +         K + IHCK+G  RTG     YL  
Sbjct: 288 LGINHIDMIFEDGTCPPLPLVKRFIKMAHEMITIKEKGIAIHCKAGLGRTGCLIGAYLIY 347

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
              +   E    +     G     +   + +      + +  +  K     P   T
Sbjct: 348 RYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDQLKEKLSLPTPTT 403


>gi|329119556|ref|ZP_08248240.1| protein tyrosine/serine phosphatase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464343|gb|EGF10644.1| protein tyrosine/serine phosphatase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 192

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 46/150 (30%), Positives = 72/150 (48%), Gaps = 8/150 (5%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + +   ++YRS Q          K  GIKS++NLR         +   A    G +L 
Sbjct: 38  NLYRI-DDKLYRSEQLTRAD-APHIKALGIKSVVNLRYFDR----NDNHTALAQSGAELF 91

Query: 103 NFPLSATRELNDEQIKQLISILKTA-PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL   R    +  + L  I +     P+LIHC  GADRTGL +A+Y  +  ++P EEA
Sbjct: 92  NQPLLTWRITPKQIAQTLHLIEQRRRHGPVLIHCYHGADRTGLIAAMYRIVYQNWPIEEA 151

Query: 162 HRQLSM-LYGHFPVLKTITMDITFEKITQL 190
            R++    YG+  + + +    T +K+ Q+
Sbjct: 152 RREMQQGPYGYHSIWRNLGKLFTADKVRQV 181


>gi|302500069|ref|XP_003012029.1| hypothetical protein ARB_01785 [Arthroderma benhamiae CBS 112371]
 gi|291175584|gb|EFE31389.1| hypothetical protein ARB_01785 [Arthroderma benhamiae CBS 112371]
          Length = 607

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 63/236 (26%), Gaps = 42/236 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + P  + + S Q +       
Sbjct: 174 QDVVYGVWKAKEEGLCGLKDFSLEEYEKYERVDMGDFNWITPSFLAFASPQHSPTAVVPQ 233

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        +  ++ L  +L    +         
Sbjct: 234 NTPEFAALPSTIEQVQDSELPVPFKNVLTHFSTRNVGLVVRLNSELYSPSY------FTA 287

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLYI 152
           LGI  I+             +K+ I +         K + IHCK+G  RTG     YL  
Sbjct: 288 LGINHIDMIFEDGTCPPLPLVKRFIKMAHEMITIKEKGIAIHCKAGLGRTGCLIGAYLIY 347

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
              +   E    +     G     +   + +      + +  +  K     P   T
Sbjct: 348 RYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDQLKEKLSLPTPTT 403


>gi|302411448|ref|XP_003003557.1| tyrosine-protein phosphatase CDC14 [Verticillium albo-atrum
           VaMs.102]
 gi|261357462|gb|EEY19890.1| tyrosine-protein phosphatase CDC14 [Verticillium albo-atrum
           VaMs.102]
          Length = 642

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 62/237 (26%), Gaps = 43/237 (18%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G   L    L  Y         +F+ + P  + + S Q         
Sbjct: 200 QDVVYGVWKAKEEGCCALDNFDLDEYEKYERVEHGDFNWISPSFLAFASPQQTPIAKIPE 259

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +     E  I  ++ L  +L    +        
Sbjct: 260 GTPEWDKLPTTIAEVDAHATLPVPFKNVLKHFSERDIGLVVRLNSQLYCPSY------FE 313

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            LGIQ ++             +++ I +         K + +HCK+G  RTG     YL 
Sbjct: 314 ALGIQHLDMIFDDGTCPTMPTVRKFIRLAHEMITVKKKGIAVHCKAGLGRTGCLIGAYLI 373

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
               +   E    +     G     +   + I      + +     +    + M A 
Sbjct: 374 YRHGFTANEVIAFMRFMRPGMVVGPQQHWLHIHQGTFREWWIEERVERKLRKEMAAA 430


>gi|302665836|ref|XP_003024525.1| hypothetical protein TRV_01356 [Trichophyton verrucosum HKI 0517]
 gi|291188582|gb|EFE43914.1| hypothetical protein TRV_01356 [Trichophyton verrucosum HKI 0517]
          Length = 607

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/236 (13%), Positives = 63/236 (26%), Gaps = 42/236 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + P  + + S Q +       
Sbjct: 174 QDVVYGVWKAKEEGLCGLKDFSLEEYEKYERVDMGDFNWITPSFLAFASPQHSPTAVVPQ 233

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        +  ++ L  +L    +         
Sbjct: 234 NTPEFAALPSTIEQVQDSELPVPFKNVLTHFSTRNVGLVVRLNSELYSPSY------FTA 287

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLYI 152
           LGI  I+             +K+ I +         K + IHCK+G  RTG     YL  
Sbjct: 288 LGINHIDMIFEDGTCPPLPLVKRFIKMAHEMITIKEKGIAIHCKAGLGRTGCLIGAYLIY 347

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
              +   E    +     G     +   + +      + +  +  K     P   T
Sbjct: 348 RYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDQLKEKLSLPTPTT 403


>gi|317062979|ref|ZP_07927464.1| protein tyrosine/serine phosphatase [Fusobacterium ulcerans ATCC
           49185]
 gi|313688655|gb|EFS25490.1| protein tyrosine/serine phosphatase [Fusobacterium ulcerans ATCC
           49185]
          Length = 193

 Score = 98.3 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 74/139 (53%), Gaps = 13/139 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF+ V    ++RS QP    ++ ++  +GI ++++LR +  +       + A +  + LI
Sbjct: 41  NFYKVSE-TLFRSEQPTEDGMKNIEA-FGIGTVISLRSRQKD------VELAKNTELNLI 92

Query: 103 NFPLSATRELNDEQIKQLISIL----KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +  + A     ++ +K +  +     +T  KP+LIHC  GADRTG+  A+Y  +  ++ +
Sbjct: 93  HVSMRAWNPKYEDAVKVMYFLNPNNPETNKKPILIHCYHGADRTGMMVALYRMVYQNWER 152

Query: 159 EEAHRQL-SMLYGHFPVLK 176
           EEA  ++ +  YG+  + K
Sbjct: 153 EEALNEMLNGGYGYHSMWK 171


>gi|18412419|ref|NP_567261.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|17981661|gb|AAL51114.1|AF458342_1 AT4g03960/T24M8_4 [Arabidopsis thaliana]
 gi|15810022|gb|AAL06938.1| AT4g03960/T24M8_4 [Arabidopsis thaliana]
 gi|21555065|gb|AAM63767.1| contains similarity to C3HC4-type zinc fingers [Arabidopsis
           thaliana]
 gi|26452426|dbj|BAC43298.1| unknown protein [Arabidopsis thaliana]
 gi|332656961|gb|AEE82361.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
          Length = 198

 Score = 98.3 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 58/153 (37%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P         +   +KSI+ L    PE++ +   + A   GIQ+ 
Sbjct: 34  NFAMVDNG-IFRSGFPEPVSF-SFLQSLRLKSIIYL---CPEAYPEVNREFAKSNGIQVF 88

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       ++I      +L T   P+LIHCKSG  RTG        I     
Sbjct: 89  QFGIERCKEPFVNIPDEVIREALQVLLDTENHPVLIHCKSGKHRTGCLVGCVRKIQ---- 144

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K    D  F ++  +
Sbjct: 145 -RWCLSSIFDEYQRFAAAKARISDQRFMELFDI 176


>gi|294940020|ref|XP_002782638.1| dual specificity protein phosphatase, putative [Perkinsus marinus
           ATCC 50983]
 gi|239894490|gb|EER14433.1| dual specificity protein phosphatase, putative [Perkinsus marinus
           ATCC 50983]
          Length = 288

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/175 (14%), Positives = 52/175 (29%), Gaps = 23/175 (13%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L       LLG    C   +  Y    +    + + ++P +I   + P          
Sbjct: 41  DCLCGLQYAYLLGWYDPCRFDINEYNYYASLQNGDLNWIIPRKILAFSSPQNERRDNRGF 100

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                     + K  G++ I+ L  K        +       G   ++         +  
Sbjct: 101 PAHIPEDFHAVFKSMGVELIVRLNDK------LYDRNRFTSAGFAHMDLYFPDGTCPSPS 154

Query: 116 QIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY 169
            +    + +++ P   + +HCK+G  RTG    +Y      +    A   +    
Sbjct: 155 IMSHFFNAVESIPSGVIAVHCKAGLGRTGCLIGLYAMKRYGF---RARAWIGWNR 206


>gi|169615226|ref|XP_001801029.1| hypothetical protein SNOG_10769 [Phaeosphaeria nodorum SN15]
 gi|160702912|gb|EAT82163.2| hypothetical protein SNOG_10769 [Phaeosphaeria nodorum SN15]
          Length = 618

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/240 (14%), Positives = 68/240 (28%), Gaps = 42/240 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIY---------- 53
           +   +  +   +     G+  L   SL  Y         +F+ V P  +           
Sbjct: 166 VLNIQDVIYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWVTPQFLAFASPQQQPTH 225

Query: 54  --------------------RSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                               RS  P     +        I  ++ L  +L  S +     
Sbjct: 226 EIPTSSPMYATLPSNIAEVQRSGLPGPFKNVLSHFSARNIGLVVRLNSELYSSSY----- 280

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
               +GIQ +N             +++ I++         K + +HCK+G  RTG     
Sbjct: 281 -FTKMGIQHLNMIFDDGTCPPLSLVRKFINLAHEMITVHKKGIAVHCKAGLGRTGCLIGA 339

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           YL     +   E    +     G     +   + +      + +  +  K    + M +T
Sbjct: 340 YLIYKHGFTANEIIAYMRFMRPGMVVGPQQHWLHLNQATFREWWHEDTMKAKYAEMMPST 399


>gi|150866081|ref|XP_001385557.2| tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
 gi|149387337|gb|ABN67528.2| tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
          Length = 242

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 64/165 (38%), Gaps = 18/165 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  ++ ++IYRS+ P         ++  +KS+L L   +PE + +   +      I+L 
Sbjct: 82  NFAPII-NKIYRSSFPQPNNF-TFLRKLKLKSVLCL---IPEEYPQLHLEFLEHENIKLF 136

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E      +D   +    +L    +P+LIHC  G  RTG    V   +   + 
Sbjct: 137 QLGMSGNKEPFVKISSDLITEAAKIVLNPENQPILIHCNRGKHRTGCLVGVLRRL-QKWS 195

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
                  +   Y  F   K   MD  F    +LY         E+
Sbjct: 196 LTI----IFDEYRKFAAPKERPMDQQF---IELYDETPIIRYAEE 233


>gi|195642742|gb|ACG40839.1| tyrosine specific protein phosphatase family protein [Zea mays]
          Length = 220

 Score = 97.9 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/162 (22%), Positives = 60/162 (37%), Gaps = 27/162 (16%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+     +L     ++SI+ L    PE + +E  +     GI+L 
Sbjct: 54  NFAMVDDG-IFRSGLPDAANFRFLLS-LNLRSIVYL---CPEPYPEENARFLRTNGIRLH 108

Query: 103 NFPLSATR-----------------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLA 145
            F +  ++                    +   + L  +L    +P+LIHCK G  RTG  
Sbjct: 109 QFAVEGSKSGPTVLDTMSAQEPFVHIPEETIREALKVVLDVRNQPVLIHCKRGKHRTGCV 168

Query: 146 SAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                 +   +        +   Y HF   K  T D  F ++
Sbjct: 169 VGCLRKL-QKWC----LSSVFDEYLHFAAAKARTTDQRFMEL 205


>gi|149236043|ref|XP_001523899.1| tyrosine-protein phosphatase CDC14 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452275|gb|EDK46531.1| tyrosine-protein phosphatase CDC14 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 521

 Score = 97.9 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 63/190 (33%), Gaps = 9/190 (4%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--- 63
           +  +   +     G++ L   +L  Y         +F+ +    I + S   +   +   
Sbjct: 41  QDIVYAMWRAKERGMVNLTTFNLEEYEQYERVDQGDFNVISKDFIAFASPIQSKRTLKLS 100

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
           E  +K     +  N++  +  + H  + +     GIQ I+           E +++ I  
Sbjct: 101 EPFQKVLNYFTKNNVQLVVRLNSHLYDAREFTKRGIQHIDMIFDDGTCPTLEYVQKFIGA 160

Query: 124 LK---TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTIT 179
            +        + +HCK+G  RTG     +L     +   E    +  +  G     +   
Sbjct: 161 AECVINKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHW 220

Query: 180 MDITFEKITQ 189
           +    +   +
Sbjct: 221 L-YLNQNYFR 229


>gi|255942513|ref|XP_002562025.1| Pc18g01810 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586758|emb|CAP94405.1| Pc18g01810 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 606

 Score = 97.9 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/240 (12%), Positives = 64/240 (26%), Gaps = 42/240 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG-- 60
           I   +  +   +      +  L   +L  Y         +F+ V P  + + S Q     
Sbjct: 166 ILNIQDVVYGVWKAKEQSLCGLRDFNLEEYEKFERVDMGDFNWVTPDFLAFASPQHQPVE 225

Query: 61  ----------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                                         +     +  +  ++ L  +L    +     
Sbjct: 226 PIPVNTPEYNALPTTISEISSSKLPMPFKNVLAHFHQRNVGLVVRLNSELYCPSY----- 280

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
               +GI  I+           + +++ I +         K + +HCK+G  RTG     
Sbjct: 281 -FTAMGIAHIDMIFEDGTCPPLQLVRRFIKMAHEMITIKKKGIAVHCKAGLGRTGCLIGA 339

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           YL     +   E    +     G     +   + +      + +  +  +    Q    T
Sbjct: 340 YLIYKYGFTANEVIAFMRFMRPGMVVGPQQHWLHLNQGAFREWWFEDSMREKLAQSTPVT 399


>gi|115391673|ref|XP_001213341.1| hypothetical protein ATEG_04163 [Aspergillus terreus NIH2624]
 gi|114194265|gb|EAU35965.1| hypothetical protein ATEG_04163 [Aspergillus terreus NIH2624]
          Length = 611

 Score = 97.9 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/240 (12%), Positives = 63/240 (26%), Gaps = 42/240 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG-- 60
           I   +  +   +      +  L   SL  Y         +F+ + P  I + S Q     
Sbjct: 167 ILNIQDVVYGVWKAKEQSLCGLRDFSLEDYEKFERVDMGDFNWITPDFIAFASPQHEPIA 226

Query: 61  ----------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                                         +        +  ++ L  +L    +     
Sbjct: 227 PIPQNTPEYDALPATVSEVLSSRLPLPFKNVLAHFSSRKVGLVVRLNSELYSPSY----- 281

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
               LGI  ++             +++ I +         + + +HCK+G  RTG     
Sbjct: 282 -FTALGINHVDMIFEDGTCPPLPLVRRFIKMAHEMITVKRRGIAVHCKAGLGRTGCLIGA 340

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           YL     +   E    +     G     +   + +      + +  +  K      M AT
Sbjct: 341 YLIYRYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDTMKEKLAAQMQAT 400


>gi|229587628|ref|YP_002869747.1| hypothetical protein PFLU0050 [Pseudomonas fluorescens SBW25]
 gi|229359494|emb|CAY46335.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 221

 Score = 97.9 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 63/126 (50%), Gaps = 10/126 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P  +YRSA P+G     L ++  I +++N   +    W K          I+ +
Sbjct: 48  NLHQMTP-TLYRSALPDG-NAAPLLEKLKIGTVINFLPESDADWLKS-------PNIRQV 98

Query: 103 NFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
                     + + +  L +I +  A  P+L+HCK G+DRTGL +A+Y  ++  + KE+A
Sbjct: 99  QLSYRTNHVDDSDVLAALRAIREAEANGPVLMHCKHGSDRTGLMAAMYRVVIQGWSKEDA 158

Query: 162 HRQLSM 167
             ++S+
Sbjct: 159 LNEMSL 164


>gi|320591564|gb|EFX04003.1| protein-tyrosine phosphatase [Grosmannia clavigera kw1407]
          Length = 674

 Score = 97.9 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/213 (13%), Positives = 58/213 (27%), Gaps = 45/213 (21%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G  VL +  L  Y         +F+ + P+ + + S Q +       
Sbjct: 163 QDIVYGVWKAKEEGCCVLDSFDLAEYETFERVEHGDFNWITPNFLAFASPQHDPVTRITE 222

Query: 61  ---------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
                                        +     E  +  ++ L   L    +      
Sbjct: 223 TSEPELYESLPRTLDAVDAHPTLPQPFKNVLRHFSERNVGLVVRLNSALYSPSY------ 276

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQL----ISILKTAPKPLLIHCKSGADRTGLASAVY 149
              LGIQ ++             +++       ++    K + +HCK+G  RTG     Y
Sbjct: 277 FEALGIQHLDMIFDDGTCPPMSTVRKFVRLAHEMINVRKKNIAVHCKAGLGRTGCLIGAY 336

Query: 150 LYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
           L     +   E    +     G     +   + 
Sbjct: 337 LIYRHGFTANEIISYMRFMRPGMVVGPQQHWLH 369



 Score = 36.6 bits (83), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/129 (10%), Positives = 37/129 (28%), Gaps = 7/129 (5%)

Query: 42  QNFHAVV---PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
            N   ++   P  +Y ++  +    + L                 E ++   + +     
Sbjct: 8   PNLGQIIEYLPDRLYLASYLSPPDADTLFPFGNTAKTSRRHRSGREPFYFTVDDSLLYNA 67

Query: 99  IQLINFPLSATRE-LNDEQIKQLISILKTAPKPLLIHCKSGADR---TGLASAVYLYIVA 154
                 PL             ++++  +   +P++   K+            A Y+ ++ 
Sbjct: 68  FHHDFGPLHVGHLYRFALHFHEILAATENQQRPVVFWSKADPRSRANASCLLACYMVLIQ 127

Query: 155 HYPKEEAHR 163
            +P   A  
Sbjct: 128 SWPPHLALA 136


>gi|225430987|ref|XP_002278743.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147766881|emb|CAN67527.1| hypothetical protein VITISV_002127 [Vitis vinifera]
 gi|297735279|emb|CBI17641.3| unnamed protein product [Vitis vinifera]
          Length = 202

 Score = 97.9 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 57/154 (37%), Gaps = 16/154 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V  + I+RS  P+        +   ++SI+ L    PE + +E  K      I+L 
Sbjct: 20  NFSMVEEN-IFRSGLPSPINF-PFLETLNLRSIIYL---CPEPYPEENCKFLQSQNIRLF 74

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       D   + L  ++     P+LIHCK G  RTG        +  ++ 
Sbjct: 75  QFGIEGKKEPPVAMSTDTISEALKVLMDVRNHPILIHCKRGKHRTGCLVGCLRKL-QNWC 133

Query: 158 KEEAHRQLSMLYGHFPVLKTITMD-ITFEKITQL 190
                 +    Y  F   K+   D    E    L
Sbjct: 134 LSSVVEE----YQRFAGAKSRINDLKFIETYDIL 163


>gi|225683721|gb|EEH22005.1| tyrosine-protein phosphatase CDC14 [Paracoccidioides brasiliensis
           Pb03]
          Length = 612

 Score = 97.9 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 58/213 (27%), Gaps = 41/213 (19%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG-- 60
           I   +  +   +     G+  L   SL  Y         +F+ + PH + + S Q     
Sbjct: 168 ILTIQDIVYGVWKAREEGLCGLKDFSLEEYEKYERVDMGDFNWITPHYLAFASPQHQPVE 227

Query: 61  ----------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                                         +        I  ++ L  +L    +     
Sbjct: 228 PIPQNTAEYAALPSTISEVLSSDLPVPFKNVLSHFSSRNIGLVVRLNSELYSPSY----- 282

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVY 149
               +GI  ++             +++ I I   +    K + +HCK+G  RTG     Y
Sbjct: 283 -FTAMGISHMDMIFEDGTCPPLPLVRRFIKIAHEMIHKKKGIAVHCKAGLGRTGCLIGAY 341

Query: 150 LYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
           L     +   E    +     G     +   + 
Sbjct: 342 LIYRYGFTANEVIAFMRFMRPGMVVGPQQHWLH 374


>gi|328699251|ref|XP_001942696.2| PREDICTED: dual specificity protein phosphatase CDC14A-like
           [Acyrthosiphon pisum]
          Length = 618

 Score = 97.5 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 31/235 (13%), Positives = 63/235 (26%), Gaps = 53/235 (22%)

Query: 10  NLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP----------- 58
            +   Y     G   +    L  Y    T    + + +VP  +   + P           
Sbjct: 169 CVNALYKAKWYGFFDMSDFDLDEYEKYETVKYGDINWIVPATLLAFSSPHSRDYIDKSGY 228

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
              +  +     KE  +K ++ L  K     +  +        IQ  +   +     +D 
Sbjct: 229 QIHSPAYYYPYFKENNVKHVVRLNSK---KTYDAKRTFVTVANIQHTDLIFTDGTPPSDA 285

Query: 116 QIKQLISILKT-----------------------------------APKPLLIHCKSGAD 140
            +K  + + +                                        + +HCK+G  
Sbjct: 286 ILKYFLRLCEQYIDDNCEVERTNNEKSELNEITPNIITNSEANVAKYAGAVAVHCKAGLG 345

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNN 194
           RTG   A Y+     +   EA     +   G    ++   +    + +T L    
Sbjct: 346 RTGCLVASYIVKHWSFTAVEAIAWTRICRPGSVIGVQQQWLINKEDYLTTLGKQW 400


>gi|167584148|ref|ZP_02376536.1| protein tyrosine/serine phosphatase [Burkholderia ubonensis Bu]
          Length = 201

 Score = 97.5 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 72/164 (43%), Gaps = 20/164 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P  +YRSA  +   +    ++ GI+ +++ R          +E+      I + 
Sbjct: 46  NLHRITP-SLYRSALLSREDV-PELQKLGIRKVISFR------AFHSDERILAGTQITMQ 97

Query: 103 NFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P++     +++ +  L ++       P+LIHC+ GADRTGL SA+Y  +   + +E+A
Sbjct: 98  SIPINTWYIRDEDMVAALRALRDADRDGPVLIHCQHGADRTGLVSALYRMVYQGWTREQA 157

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPM 204
             +L    YG             ++ I   Y  +V      + +
Sbjct: 158 LDELQHGGYGFHA---------IWQNIA-YYLKHVDVERLRRQV 191


>gi|297739217|emb|CBI28868.3| unnamed protein product [Vitis vinifera]
          Length = 155

 Score = 97.5 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 57/146 (39%), Gaps = 14/146 (9%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V + I+RS  P+        +  G++SI+ L    PE++ +   +     GI+L  F +
Sbjct: 1   MVDNGIFRSGFPDTANFA-FLQTLGLRSIIYL---CPETYPEANNEFLKSNGIKLFQFGI 56

Query: 107 SATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
              +E       D   + L  +L     PLLIHCK G  RTG        +   +     
Sbjct: 57  EGYKEPFVNIPEDTIREALKVVLDVRNHPLLIHCKRGKHRTGCVVGCLRKL-QKWC---- 111

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKI 187
              +   Y  F   K    D  F ++
Sbjct: 112 LSSIFDEYQRFAAAKARVSDQRFMEL 137


>gi|226293085|gb|EEH48505.1| tyrosine-protein phosphatase CDC14 [Paracoccidioides brasiliensis
           Pb18]
          Length = 612

 Score = 97.5 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 57/209 (27%), Gaps = 41/209 (19%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + PH + + S Q         
Sbjct: 172 QDIVYGVWKAREEGLCGLKDFSLEEYEKYERVDMGDFNWITPHYLAFASPQHQPVEPIPQ 231

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        I  ++ L  +L    +         
Sbjct: 232 NTAEYAALPSTISEVLSSDLPVPFKNVLSHFSSRNIGLVVRLNSELYSPSY------FTA 285

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +GI  ++             +++ I I   +    K + +HCK+G  RTG     YL   
Sbjct: 286 MGISHMDMIFEDGTCPPLPLVRRFIKIAHEMIHKKKGIAVHCKAGLGRTGCLIGAYLIYR 345

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
             +   E    +     G     +   + 
Sbjct: 346 YGFTANEVIAFMRFMRPGMVVGPQQHWLH 374


>gi|296120715|ref|YP_003628493.1| hypothetical protein Plim_0444 [Planctomyces limnophilus DSM 3776]
 gi|296013055|gb|ADG66294.1| hypothetical protein Plim_0444 [Planctomyces limnophilus DSM 3776]
          Length = 242

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 71/181 (39%), Gaps = 7/181 (3%)

Query: 7   PRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYL 66
           P  + L F   ++L  +V        Y        ++     P ++ R A      +  L
Sbjct: 14  PAASRLRFRWILILATIVAMGAGGWAYRQNHR--YKHVAIHDPGKVIRCAWVEADVMAEL 71

Query: 67  KKEYGIKSILNLRGKLPESWHKE--EEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
            +++ +K++LNL         +   E  A    G +LI   L    + +   I   I++L
Sbjct: 72  VQKHQVKTVLNLCRPGEMGPDRARQERMAVEAAGAKLIELSLPDIDDPSSPLIAPHIAVL 131

Query: 125 -KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM--LYGHFPVLKTITMD 181
              A  PL++HC+ G +RTG    +Y  +      EEA  ++ +   + + P+      +
Sbjct: 132 KDPANYPLIVHCQHGFNRTGRVLTMYDVMFRGKTGEEALSKMPLFGRHDYAPLEHAFARN 191

Query: 182 I 182
            
Sbjct: 192 F 192


>gi|295665919|ref|XP_002793510.1| tyrosine-protein phosphatase CDC14 [Paracoccidioides brasiliensis
           Pb01]
 gi|226277804|gb|EEH33370.1| tyrosine-protein phosphatase CDC14 [Paracoccidioides brasiliensis
           Pb01]
          Length = 612

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 57/209 (27%), Gaps = 41/209 (19%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + PH + + S Q         
Sbjct: 172 QDIVYGVWKAREEGLCGLKDFSLEEYEKYERVDMGDFNWITPHYLAFASPQHQPVEPIPQ 231

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        I  ++ L  +L    +         
Sbjct: 232 NTAEYAALPSTISEVLSSDLPVPFKNVLSHFSSRNIGLVVRLNSELYSPSY------FTA 285

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +GI  ++             +++ I I   +    K + +HCK+G  RTG     YL   
Sbjct: 286 MGISHMDMIFEDGTCPPLPLVRRFIKIAHEMIHKKKGIAVHCKAGLGRTGCLIGAYLIYR 345

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
             +   E    +     G     +   + 
Sbjct: 346 YGFTANEVIAFMRFMRPGMVVGPQQHWLH 374


>gi|224118160|ref|XP_002331572.1| predicted protein [Populus trichocarpa]
 gi|222873796|gb|EEF10927.1| predicted protein [Populus trichocarpa]
          Length = 207

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 57/153 (37%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SIL L    PE + +   +   D GI++ 
Sbjct: 46  NFAMVDNG-IFRSGFPDSANF-SFLQSLGLRSILYL---CPEPYPEANYEFLKDNGIRIF 100

Query: 103 NFPLSATRE-----LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       +   + L  IL     P+L+HCK G  RTG        +     
Sbjct: 101 QFGIEMCKESFANIPEETIREALKVILDVKNHPVLVHCKRGKHRTGCLVGCLRKLQ---- 156

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  +   K    D  F ++  +
Sbjct: 157 -RWCLSSIFDEYQRYAAAKARVSDQRFMELFDI 188


>gi|145602959|ref|XP_362192.2| hypothetical protein MGG_04637 [Magnaporthe oryzae 70-15]
 gi|145011305|gb|EDJ95961.1| hypothetical protein MGG_04637 [Magnaporthe oryzae 70-15]
          Length = 641

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/212 (13%), Positives = 60/212 (28%), Gaps = 44/212 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G ++L +  LG Y         +F+ + PH + + S           
Sbjct: 175 QDVVYGVWKAKEEGCVMLDSFDLGEYEKYERVENGDFNWITPHFLAFASPMHYPVDRVTE 234

Query: 61  --------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
                                       +     E  I  ++ L  +L    +       
Sbjct: 235 TMGEAYKLLPKTIADVNKHPDLPDPFKNVLCHFSEKNIGLVVRLNSQLYSPSY------F 288

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILKT----APKPLLIHCKSGADRTGLASAVYL 150
             LGI+ ++             +++ I +         + + +HCK+G  RTG     YL
Sbjct: 289 ESLGIRHLDMIFEDGTCPPLSLVRKFIRLAHETITIRKRGIAVHCKAGLGRTGCLIGAYL 348

Query: 151 YIVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
                +  +E    +     G     +   + 
Sbjct: 349 IYRHGFTADEVISYMRFMRPGMVVGPQQHWLH 380


>gi|134056873|emb|CAK37777.1| unnamed protein product [Aspergillus niger]
          Length = 628

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/234 (12%), Positives = 61/234 (26%), Gaps = 41/234 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG-- 60
           I   +  +   +      +  L   SL  Y         +F+ + P  + + S Q     
Sbjct: 187 ILNIQDVVYGVWKAKEQSLCSLRDFSLEEYEKFERVDMGDFNWITPQFLAFASPQHQPIA 246

Query: 61  ----------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                                         +        I  ++ L  +L    +     
Sbjct: 247 PIPQNTPEFAALPSTVSEVLSSKLPLPFKNVLAHFSSRNIGLVVRLNSELYSPSY----- 301

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVY 149
               LGI  ++             +++ I +        K + +HCK+G  RTG     Y
Sbjct: 302 -FTALGITHVDMIFEDGTCPPLPLVRRFIKMAHETISKKKGIAVHCKAGLGRTGCLIGAY 360

Query: 150 LYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
           L     +   E    +     G     +   + +      + +  +  K    Q
Sbjct: 361 LIYRYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWYEDSMKEKLAQ 414


>gi|302838013|ref|XP_002950565.1| hypothetical protein VOLCADRAFT_60622 [Volvox carteri f.
           nagariensis]
 gi|300264114|gb|EFJ48311.1| hypothetical protein VOLCADRAFT_60622 [Volvox carteri f.
           nagariensis]
          Length = 313

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 53/157 (33%), Gaps = 20/157 (12%)

Query: 38  TTFTQNFHAVVPHEIYRSAQP-------------NGTFIEYLKKEYGIKSILNLRGKLPE 84
                + + +VP +    + P                      +  G+ +++ L  K+  
Sbjct: 141 QVENGDLNWIVPGKFVAFSGPAARSNEVAGYRLHTPEDYWDYFRRKGVTTVIRLNKKV-- 198

Query: 85  SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
                + K   D G +             +  I++ +  ++T P  + +HCK+G  RTGL
Sbjct: 199 ----YDRKRFLDGGFKHHELYFPDGSCPTEPIIQRFLDTVETEPGAIAVHCKAGLGRTGL 254

Query: 145 ASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
              +Y+     +  EE    + +   G     +   +
Sbjct: 255 LICLYIMKHYRFTAEEVIGYIRVCRPGSVIGPQQNFL 291


>gi|237715910|ref|ZP_04546391.1| protein tyrosine/serine phosphatase [Bacteroides sp. D1]
 gi|229443557|gb|EEO49348.1| protein tyrosine/serine phosphatase [Bacteroides sp. D1]
          Length = 181

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 78/183 (42%), Gaps = 10/183 (5%)

Query: 12  LIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYG 71
           +   + ++  + +              +   N + +    +YRS QP+    +   ++YG
Sbjct: 1   MSLLLGVIFSISIFSQNLKVEKITLPDSELTNLYKIDSG-VYRSEQPSHEDFKA-LEKYG 58

Query: 72  IKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPL 131
           I   LNLR +  +         A    ++L      A   +N+EQ+ + + I+K    P+
Sbjct: 59  IGEALNLRNRHSDD------DEAAGTNVKLHRVKTKA-HSINEEQLIEALRIIKNRKAPI 111

Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQL 190
           +IHC  G+DRTG   A+Y  +  +  KE+A  +++   +G   + K I   I    I Q+
Sbjct: 112 VIHCHHGSDRTGAVCALYRVVFQNVSKEDAIHEMTEGGFGFHRIYKNIIRRIKEADIEQI 171

Query: 191 YPN 193
              
Sbjct: 172 RRK 174


>gi|290973482|ref|XP_002669477.1| predicted protein [Naegleria gruberi]
 gi|284083025|gb|EFC36733.1| predicted protein [Naegleria gruberi]
          Length = 142

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/151 (23%), Positives = 56/151 (37%), Gaps = 17/151 (11%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           ++RS  PN        K+ G+KSI  L    PE +     +    +GI++  F +   +E
Sbjct: 4   VFRSGYPNKKNF-PFLKKIGLKSICYL---CPEQYAHNNMEFCRKVGIRIFQFGIEGNKE 59

Query: 112 LNDEQIKQLI-----SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
                 +  I      +L     P+LIHC  G  RTG+             +  +   + 
Sbjct: 60  PFVHIPEDAIRKAITELLNPKNHPILIHCNKGKHRTGVLVGCLRK-----TQNWSLTSIF 114

Query: 167 MLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
             Y  F   K   +D  F    +LY N  S 
Sbjct: 115 DEYRRFAGSKVRMLDQQF---IELYSNITSN 142


>gi|145606989|ref|XP_001407418.1| hypothetical protein MGG_12093 [Magnaporthe oryzae 70-15]
 gi|145014610|gb|EDJ99178.1| hypothetical protein MGG_12093 [Magnaporthe oryzae 70-15]
          Length = 326

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 63/167 (37%), Gaps = 13/167 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +VP  +YRS  P      ++ K+  +K+++ L  K P       +       I+  
Sbjct: 138 NFGMIVPG-VYRSGYPQQEHHAFM-KDLKLKTVVTLVEKEPPEGF---KPFLTSNNIKHH 192

Query: 103 NFPLSATRELNDEQIKQ---LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
              +  T++ +         L  +L     PLL+HC  G  RTG  + V    V  +  +
Sbjct: 193 IIAMKGTKKESISLGTMQSILNVVLNPKNHPLLVHCNHGKHRTGCVAGVVR-KVTGWETD 251

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
               +    Y  F   K    DI +  +  +    +S     +P+ A
Sbjct: 252 AIIDE----YRKFADPKERECDIDYITMFDIADAKLSSMFARKPLYA 294


>gi|298705570|emb|CBJ28821.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 194

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 55/156 (35%), Gaps = 14/156 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS+ P         ++ G+++IL L     E             GI+L 
Sbjct: 31  NFSMVDAG-IYRSSFPMKKHF-PFLRKLGLRTILTLVI---EELPPANLDFVQAHGIRLE 85

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
            F         +E    +  +   +  P+L+HC  G  RTG     +      +    A 
Sbjct: 86  PFKY----IPLEEVKFAVREMSDASNHPMLVHCNKGKHRTGCLIGCFRRT-QGW----AV 136

Query: 163 RQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
             +   Y HF   K   +D  + ++ +    N +  
Sbjct: 137 SSIFEEYSHFASPKARLVDQRYIELFEPEDENAASK 172


>gi|289618023|emb|CBI55600.1| unnamed protein product [Sordaria macrospora]
          Length = 484

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/233 (13%), Positives = 62/233 (26%), Gaps = 42/233 (18%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G  VL    L  Y         +F+ + P+ + + S Q         
Sbjct: 173 QDVVYGVWKAKEEGCCVLETFDLDEYEKFERVEHGDFNWITPNFLAFASPQHTPVAPTPE 232

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +     E  I  ++ L  +L    +        
Sbjct: 233 GTEQWSLLPKTLSAVDAHPTLPQPFKNVLRHFSERNIGLVVRLNSQLYNPSY------FE 286

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKT---APKPLLIHCKSGADRTGLASAVYLYI 152
            LGI  I+             +++ I +        K + +HCK+G  RTG     YL  
Sbjct: 287 ALGINHIDMIFEDGTCPTLSTVRKFIRMAHETISRKKGIAVHCKAGLGRTGCLIGAYLIY 346

Query: 153 VAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPM 204
              +   E    +     G     +   + +      + +     +    + M
Sbjct: 347 RHGFTANEVIAYMRFMRPGMVVGPQQHWLHLNQGVFREWWIEERVERRLRKEM 399


>gi|330924069|ref|XP_003300500.1| hypothetical protein PTT_11748 [Pyrenophora teres f. teres 0-1]
 gi|311325337|gb|EFQ91385.1| hypothetical protein PTT_11748 [Pyrenophora teres f. teres 0-1]
          Length = 628

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/240 (13%), Positives = 69/240 (28%), Gaps = 42/240 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIY---------- 53
           +   +  +   +     G+  L   SL  Y         +F+ V P+ +           
Sbjct: 180 VLNIQDVIYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWVTPNFLAFASPQQQPTN 239

Query: 54  --------------------RSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                               RS  P     +        +  ++ L  +L  S +     
Sbjct: 240 EIPTSSPMYATLPSNIAEIQRSGLPGPFKNVLSHFVARNVGLVVRLNSELYSSSY----- 294

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
               LGIQ +N             +++ +++         + + +HCK+G  RTG     
Sbjct: 295 -FTKLGIQHLNMIFDDGTCPPLSLVRKFVNLAHEMITVQKRGIAVHCKAGLGRTGCLIGA 353

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           YL     +   E    +     G     +   + +      + +  +  K    Q + +T
Sbjct: 354 YLIYKHGFTANEIIAYMRFMRPGMVVGPQQHWLHLNQGTFREWWYEDTMKAKYAQMVPST 413


>gi|189207847|ref|XP_001940257.1| tyrosine-protein phosphatase CDC14 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187976350|gb|EDU42976.1| tyrosine-protein phosphatase CDC14 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 618

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/240 (13%), Positives = 69/240 (28%), Gaps = 42/240 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIY---------- 53
           +   +  +   +     G+  L   SL  Y         +F+ V P+ +           
Sbjct: 170 VLNIQDVIYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWVTPNFLAFASPQQQPTH 229

Query: 54  --------------------RSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                               RS  P     +        +  ++ L  +L  S +     
Sbjct: 230 EIPTSSPMYATLPSNIAEIQRSGLPGPFKNVLSHFVARNVGLVVRLNSELYSSSY----- 284

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
               LGIQ +N             +++ +++         + + +HCK+G  RTG     
Sbjct: 285 -FTKLGIQHLNMIFDDGTCPPLSLVRKFVNLAHEMITVQKRGIAVHCKAGLGRTGCLIGA 343

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           YL     +   E    +     G     +   + +      + +  +  K    Q + +T
Sbjct: 344 YLIYKHGFTANEIIAYMRFMRPGMVVGPQQHWLHLNQGTFREWWYEDTMKAKYAQMVPST 403


>gi|190347438|gb|EDK39703.2| hypothetical protein PGUG_03801 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 453

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 59/178 (33%), Gaps = 5/178 (2%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFIEYL 66
           +  +   +     G++ L   +L  Y         +F+ +    I + S Q      E  
Sbjct: 41  QDIVYAMWRAKERGMVDLTTFNLEEYEQYERVDQGDFNVISKDFIAFASPQSRKGLNEPF 100

Query: 67  KKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           KK        +++  +  + H  +       GIQ I+           E +++ I   +T
Sbjct: 101 KKVLNFFLANDVQLVVRLNSHLYDAAEFTRRGIQHIDMIFDDGTCPTLEYVQKFIGAAET 160

Query: 127 ---APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITM 180
                  + +HCK+G  RTG     +L     +   E    +  +  G     +   +
Sbjct: 161 VIHNGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHWL 218


>gi|297809583|ref|XP_002872675.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297318512|gb|EFH48934.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 198

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 58/153 (37%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P         +   ++SI+ L    PE++ +   + A   GIQ+ 
Sbjct: 34  NFAMVDNG-IFRSGFPEPVSF-SFLQSLRLRSIIYL---CPEAYPEVNREFAKSNGIQVF 88

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       ++I      +L T   P+LIHCKSG  RTG        I     
Sbjct: 89  QFGIERCKEPFVNIPDEVIREALQVLLDTKNHPVLIHCKSGKHRTGCLVGCVRKIQ---- 144

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K    D  F ++  +
Sbjct: 145 -RWCLSSIFDEYQRFAAAKARISDQRFMELFDI 176


>gi|317027015|ref|XP_001399947.2| protein-tyrosine phosphatase [Aspergillus niger CBS 513.88]
          Length = 607

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/234 (12%), Positives = 61/234 (26%), Gaps = 41/234 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG-- 60
           I   +  +   +      +  L   SL  Y         +F+ + P  + + S Q     
Sbjct: 166 ILNIQDVVYGVWKAKEQSLCSLRDFSLEEYEKFERVDMGDFNWITPQFLAFASPQHQPIA 225

Query: 61  ----------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                                         +        I  ++ L  +L    +     
Sbjct: 226 PIPQNTPEFAALPSTVSEVLSSKLPLPFKNVLAHFSSRNIGLVVRLNSELYSPSY----- 280

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVY 149
               LGI  ++             +++ I +        K + +HCK+G  RTG     Y
Sbjct: 281 -FTALGITHVDMIFEDGTCPPLPLVRRFIKMAHETISKKKGIAVHCKAGLGRTGCLIGAY 339

Query: 150 LYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
           L     +   E    +     G     +   + +      + +  +  K    Q
Sbjct: 340 LIYRYGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWYEDSMKEKLAQ 393


>gi|146420698|ref|XP_001486303.1| hypothetical protein PGUG_01974 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 296

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 60/150 (40%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+ + IYRS+ P         +   +KSIL L   +PE + +  +    + GI+L 
Sbjct: 131 NFAPVI-NNIYRSSFPQIHSF-SFLRTLKLKSILCL---IPEEYPQMHKDFFEEEGIKLF 185

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E       D   + +  +L    +P+LIHC  G  RTG    V   +     
Sbjct: 186 QMGMSGNKEPFVKIPPDLVTEAVKVVLDPRNQPILIHCNRGKHRTGCLVGVIRRLQ---- 241

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   MD  F ++
Sbjct: 242 -RWLLTIIFDEYRKFAAPKERPMDQQFIEL 270


>gi|300123943|emb|CBK25214.2| unnamed protein product [Blastocystis hominis]
          Length = 590

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 59/202 (29%), Gaps = 20/202 (9%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP--------- 58
           +  L    I I   +          Y         + + ++ + +   + P         
Sbjct: 139 QHCLEGLSIAISKHIFEWSLFDSSQYEFFDRVENGDMNWIIINRLLAFSGPHDIPEVIND 198

Query: 59  ----NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                      L  + G+  ++ L           ++   +  GI   +           
Sbjct: 199 VRTFTPEDYLPLFAQLGVGVVVRLNKP------AYDKTRFSSRGIAFFDLYFPDGGLPQF 252

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
            Q+ + I+ILKT    + +HCK+G  RTG     YL        E+A     +   G   
Sbjct: 253 NQMLKFIAILKTHDCGVAVHCKAGLGRTGTLICAYLIYEYGMTAEQAIGYCRICRPGSVV 312

Query: 174 VLKTITMDITFEKITQLYPNNV 195
             +   +     K+      +V
Sbjct: 313 GCQQHFLKRVEAKLRACTDQDV 334


>gi|146416901|ref|XP_001484420.1| hypothetical protein PGUG_03801 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 453

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 59/178 (33%), Gaps = 5/178 (2%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFIEYL 66
           +  +   +     G++ L   +L  Y         +F+ +    I + S Q      E  
Sbjct: 41  QDIVYAMWRAKERGMVDLTTFNLEEYEQYERVDQGDFNVISKDFIAFASPQSRKGLNEPF 100

Query: 67  KKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           KK        +++  +  + H  +       GIQ I+           E +++ I   +T
Sbjct: 101 KKVLNFFLANDVQLVVRLNSHLYDAAEFTRRGIQHIDMIFDDGTCPTLEYVQKFIGAAET 160

Query: 127 ---APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITM 180
                  + +HCK+G  RTG     +L     +   E    +  +  G     +   +
Sbjct: 161 VIHNGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHWL 218


>gi|242815818|ref|XP_002486645.1| protein-tyrosine phosphatase, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218714984|gb|EED14407.1| protein-tyrosine phosphatase, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 607

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/214 (13%), Positives = 56/214 (26%), Gaps = 42/214 (19%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG-- 60
           +   +  +   +      +  L   SL  Y         +F+ V P+ I + S Q     
Sbjct: 169 VLNIQDVVYGVWKAKEESLCGLKDFSLEEYERYERVDMGDFNWVTPNFIAFASPQQQPVA 228

Query: 61  ----------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                                         +        +  ++ L  +L    +     
Sbjct: 229 PIPANTPEYAALPSTIPQVLSSKLPVPFKNVLTHFSSRNVGLVVRLNSELYCPSY----- 283

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
               LGI  I+             +++ I +         K + +HCK+G  RTG     
Sbjct: 284 -FTALGINHIDMIFEDGTCPPLPLVRRFIKMAHEMITVQNKSIAVHCKAGLGRTGCLIGA 342

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
           YL     +   E    +     G     +   + 
Sbjct: 343 YLIYRHGFTANEIIAFMRFMRPGMVVGPQQHWLH 376


>gi|77456315|ref|YP_345820.1| protein tyrosine/serine phosphatase [Pseudomonas fluorescens Pf0-1]
 gi|77380318|gb|ABA71831.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 214

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 18/170 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N   + P  +YRSA P+      L     + +++N   +   +W K         GI  +
Sbjct: 45  NLFQMSP-TLYRSALPD-DGAVPLLNNLKVVTVINFLPEADSNWLKA-------PGIHQV 95

Query: 103 NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             P       + + +K L +I    A  P+L+HCK G+DRTGL +A+Y  +V  + KE+A
Sbjct: 96  QLPYRTNHVDDSDVLKTLRAIQSAEAEGPVLMHCKHGSDRTGLMAAMYRIVVQGWSKEDA 155

Query: 162 HRQLSM----LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             +++       GHF       M    +K+       ++ GD      AT
Sbjct: 156 LNEMTQGGFGESGHFRDSVRYVMQADVDKLR----TALANGDCSTSAFAT 201


>gi|68489762|ref|XP_711268.1| hypothetical protein CaO19.11669 [Candida albicans SC5314]
 gi|68489809|ref|XP_711244.1| hypothetical protein CaO19.4192 [Candida albicans SC5314]
 gi|46432532|gb|EAK92009.1| hypothetical protein CaO19.4192 [Candida albicans SC5314]
 gi|46432557|gb|EAK92033.1| hypothetical protein CaO19.11669 [Candida albicans SC5314]
          Length = 494

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 66/209 (31%), Gaps = 24/209 (11%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--E 64
           +  +   +     G++ L    L  Y         +F+ +    I + S Q +      E
Sbjct: 94  QDVVYAMWRAKERGMIDLAKFDLDEYEQYERVDQGDFNVISKDFIAFASPQQSKRGGLNE 153

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI--- 121
             +K        N++  +  + H  + K      I+ I+           E +++ I   
Sbjct: 154 PFQKVLEYFVENNVQLVVRLNSHLYDAKEFTKRNIKHIDMIFDDGTCPTLEYVQKFIGAA 213

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR-------------QLSML 168
             +      + +HCK+G  RTG     +L     +   E                Q   L
Sbjct: 214 ECIINKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHWL 273

Query: 169 YGHF----PVLKTITMDITFE-KITQLYP 192
           Y H         T+ +D   +  I  L+P
Sbjct: 274 YLHHDDFRSWRHTMIVDNRPDPLIGNLFP 302


>gi|224116022|ref|XP_002317187.1| predicted protein [Populus trichocarpa]
 gi|222860252|gb|EEE97799.1| predicted protein [Populus trichocarpa]
          Length = 211

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 55/153 (35%), Gaps = 15/153 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +   ++SIL L    PE + +       D G+QL 
Sbjct: 54  NFAMVDNG-IFRSGFPDIANF-TFLQSLSLRSILYL---CPEPYPEANSDFLKDNGVQLF 108

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      ++ I      +L     P+LIHCK G  RTG        +     
Sbjct: 109 QFGMEMCKEPFVNIPEETIREALKVLLDVRNHPILIHCKRGKHRTGCLVGCLRKLQ---- 164

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                  +   Y  F   K    D  F ++  +
Sbjct: 165 -RWCLSSIFDEYQRFAAAKARVSDQRFMELFDI 196


>gi|212545484|ref|XP_002152896.1| protein-tyrosine phosphatase, putative [Penicillium marneffei ATCC
           18224]
 gi|210065865|gb|EEA19959.1| protein-tyrosine phosphatase, putative [Penicillium marneffei ATCC
           18224]
          Length = 605

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/240 (13%), Positives = 64/240 (26%), Gaps = 42/240 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQ----- 57
           I   +  +   +      +  L   SL  Y         +F+ V P+ I + S Q     
Sbjct: 169 ILNIQDVVYGVWKAKEESLCGLKDFSLEEYERYERVDMGDFNWVTPNFIAFASPQQRPVA 228

Query: 58  ------------------------PNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
                                   P     +        +  ++ L  +L    +     
Sbjct: 229 PIPTNTPEYAALPSTVSEVLSSKLPVPFKNVLTHFSSRDVGLVVRLNSELYCPSY----- 283

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAV 148
               LGI  I+             +++ I +         K + +HCK+G  RTG     
Sbjct: 284 -FTALGINHIDMIFEDGTCPPLPLVRRFIKMAHEMIAVQKKNIAVHCKAGLGRTGCLIGA 342

Query: 149 YLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
           YL     +   E    +     G     +   + +      + +  +  +      +  T
Sbjct: 343 YLIYRHGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGAFREWWFEDTMREKLALTVPVT 402


>gi|116182494|ref|XP_001221096.1| hypothetical protein CHGG_01875 [Chaetomium globosum CBS 148.51]
 gi|88186172|gb|EAQ93640.1| hypothetical protein CHGG_01875 [Chaetomium globosum CBS 148.51]
          Length = 655

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 61/211 (28%), Gaps = 43/211 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQ--PNGTFIE 64
           +  +   +     G  VL    L  Y         +F+ + PH + + S Q  P+   IE
Sbjct: 176 QDIVYGVWKAKEEGCCVLETFDLDEYERFERVEQGDFNWITPHFLAFASPQSNPSARTIE 235

Query: 65  -----------------------------YLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                            E  I  ++ L   L +S +        
Sbjct: 236 GTEAWKALPKTLAAVDAHPTLPQPFKNVLAHFTERNIGLVVRLNSVLYDSSY------FE 289

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            LGIQ ++             +++ I +         K + +HCK+G  RTG     YL 
Sbjct: 290 ALGIQHLDMIFEDGTCPPLSMVRKFIRMAHDMITVKKKGIAVHCKAGLGRTGCLIGAYLI 349

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
               +   E    +     G     +   + 
Sbjct: 350 YRHGFTANEIISYMRFMRPGMVVGPQQHWLH 380


>gi|123409707|ref|XP_001303489.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121884873|gb|EAX90559.1| conserved hypothetical protein [Trichomonas vaginalis G3]
          Length = 179

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 58/168 (34%), Gaps = 15/168 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYR + PN        +  G+K+IL L    PE + +  ++  +   I+LI
Sbjct: 19  NFSLVAKG-IYRGSYPNQRNF-SFLRHLGLKTILFL---CPEDYSQSNQEFLDANNIKLI 73

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             P+   +E       +   + +  +      P+ IHC  G  RTG        I     
Sbjct: 74  RVPMEGNKEPFKIIPTELMNEAMCHLADRRSHPIYIHCNKGKHRTGSVVGCLRKIQQ--- 130

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMN 205
                  +   Y  F   K   +D  F ++       +      + + 
Sbjct: 131 --WTLTSIFEEYRRFTGTKARQIDEQFIELYNPPVQKLPHEYLPECLA 176


>gi|156839718|ref|XP_001643547.1| hypothetical protein Kpol_1008p28 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114162|gb|EDO15689.1| hypothetical protein Kpol_1008p28 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 514

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 61/190 (32%), Gaps = 17/190 (8%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--- 63
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +   I   
Sbjct: 142 QDVIYGVWRAKEKGLIDLQSFNLETYERYERVENGDFNVLTPDFIAFASPQESNRSIGVT 201

Query: 64  ---------EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                    +  +      S  N++  +  + H   ++   DL IQ I+         + 
Sbjct: 202 SSPGKSHLNQPFRSVLKYFSKNNVQLVVRLNSHLYNKQHFEDLSIQHIDMIFEDGTCPDM 261

Query: 115 EQIKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYG 170
             +K        +      + +HCK+G  RTG     +L     +   E    +     G
Sbjct: 262 SIVKNFVGAAETIINKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIGFMRFIRPG 321

Query: 171 HFPVLKTITM 180
                +   +
Sbjct: 322 MVVGPQQHWL 331


>gi|255647936|gb|ACU24425.1| unknown [Glycine max]
          Length = 200

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 59/148 (39%), Gaps = 15/148 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    ++RS+ P  +      +   ++SI+ L    PE + +   +      I+L
Sbjct: 20  PNFAMV-EDCVFRSSFPTPSNF-PFLQTLNLRSIIYL---CPEPYPEGNLEFLRSQNIRL 74

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F +    +++     D  +  L  ++     P+L+HCK G  RTG        +  ++
Sbjct: 75  FQFGIEGKTDVSIPVLKDSIMDALKVLIDVRNHPILVHCKRGKHRTGCLVGCLRKL-QNW 133

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITF 184
                   +   Y  F   K+ T D+TF
Sbjct: 134 C----LSSVFEEYQRFAGAKSRTTDLTF 157


>gi|87162589|gb|ABD28384.1| Tyrosine specific protein phosphatase and dual specificity protein
           phosphatase; Putative tyrosine phosphatase [Medicago
           truncatula]
          Length = 202

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 63/148 (42%), Gaps = 15/148 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    IYRS+ P  +      +   ++SI+ L    PE + +E      +  I+L
Sbjct: 21  PNFSMV-EDCIYRSSLPKPSSF-PFLQTLNLRSIIYL---CPEPYPEENLDFLKEQNIRL 75

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F +    E++     D  ++ L  ++     P+L+HCK G  RTG     +  +  ++
Sbjct: 76  FQFGIEGKTEVSLPALRDSIMEALKVLVDVRNHPILVHCKQGKHRTGCLVGCFRKL-QNW 134

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITF 184
               A  +    Y  F  +K+   D+TF
Sbjct: 135 CLSSAFEE----YQRFAGVKSRAADLTF 158


>gi|255645646|gb|ACU23317.1| unknown [Glycine max]
          Length = 203

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 59/148 (39%), Gaps = 15/148 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    I+RS  PN +      +   ++SI+ L    PE + +E         I+L
Sbjct: 23  PNFSMV-EDCIFRSGLPNPSNF-PFLQTLNLRSIIYL---CPEPYPEENLDFLRSQNIRL 77

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F +    +++     D  +  L  ++     P+LIHCK G  RTG        +  ++
Sbjct: 78  FQFGIEGKTDISMPILKDSIMDALEVLIDVRNHPVLIHCKRGKHRTGCLVGCLRKL-QNW 136

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITF 184
                   +   Y  F   K+ TMD+ F
Sbjct: 137 C----LSSVFEEYQRFAGAKSRTMDLAF 160


>gi|123483529|ref|XP_001324046.1| tyrosine phosphatase [Trichomonas vaginalis G3]
 gi|121906922|gb|EAY11823.1| tyrosine phosphatase, putative [Trichomonas vaginalis G3]
          Length = 418

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 65/212 (30%), Gaps = 21/212 (9%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L   +  + L  L +       +         +   ++P  +   A P          
Sbjct: 141 DVLCGLFKAVSLKWLNINDFDSVEFQRMKEISEGDMSWIIPKRLIACATPYSHSPISGGI 200

Query: 59  ---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       ++ G+  I+ L  +    ++    +   D G                 
Sbjct: 201 NVVTPETAIPKFEQLGVHRIIRLNKQ----FYDS--QIFKDAGFIHNELYFDDGTVPPKN 254

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            I++   ++    + + +HCK+G  RTG  +A YL     +   EA   + +   G    
Sbjct: 255 IIEKFFDLMSDDSEIVALHCKAGLGRTGTLAACYLIRKFDFTPREAIAWIRICRQGSIVG 314

Query: 175 LKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
            +   +   F++   + P   S   +  P N+
Sbjct: 315 PQQEFLLK-FDQQKIVPPKPPSTPRSRNPRNS 345


>gi|189423129|ref|YP_001950306.1| protein tyrosine/serine phosphatase [Geobacter lovleyi SZ]
 gi|189419388|gb|ACD93786.1| protein tyrosine/serine phosphatase [Geobacter lovleyi SZ]
          Length = 204

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 9/125 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N   V P  +YR  QP         K  GIK++++LR        + E+      G++ 
Sbjct: 55  GNVGRVAPG-VYRGEQPGAAGYA-TLKRLGIKTVIDLRTS------ESEKTQVEAAGMKA 106

Query: 102 INFPLS-ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           I  P+    + L  +  + +  +   A +P+ +HC+ G DRTG+  A Y     ++  ++
Sbjct: 107 IAVPIEMTRKGLRQKVDQVVALMADPANQPVYVHCRHGQDRTGIVVAAYRMTQDNWSLKD 166

Query: 161 AHRQL 165
              ++
Sbjct: 167 VEAEM 171


>gi|239614786|gb|EEQ91773.1| protein-tyrosine phosphatase [Ajellomyces dermatitidis ER-3]
          Length = 615

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/209 (14%), Positives = 55/209 (26%), Gaps = 41/209 (19%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + P  + + S Q         
Sbjct: 172 QDVVYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWITPDFLAFASPQHQPIAPIPQ 231

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     I        I  ++ L  +L              
Sbjct: 232 NTPEFAALPSTITEVLVSDLPEPFKNILSHFSSRNIGLVVRLNSELYSPS------NFTA 285

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +GI  I+             +++ I I   +    K + +HCK+G  RTG     YL   
Sbjct: 286 MGISHIDMIFEDGTCPPLTLVRRFIKIAHDMIHKKKGIAVHCKAGLGRTGCLIGAYLIYR 345

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
             +   E    +     G     +   + 
Sbjct: 346 HGFTANEVIAFMRFMRPGMVVGPQQHWLH 374


>gi|60459387|gb|AAX20039.1| tyrosine specific protein phosphatase family protein [Capsicum
           annuum]
          Length = 225

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 55/150 (36%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SI+ L    PE + +   +      I+L 
Sbjct: 68  NFSMVDNG-IFRSGFPDVANF-SFLQTLGLRSIIYL---CPELYPESNMEFLKANDIRLF 122

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E      ++ I      ++     P+LIHCK G  RTG        +   + 
Sbjct: 123 QFGIKNCKEPFVNIPEEKIREALGVLIDVRNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC 181

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K    D  F ++
Sbjct: 182 ----LTSVFDEYQRFAAAKARVSDQRFMEL 207


>gi|241956280|ref|XP_002420860.1| protein phosphatase required for mitotic exit, putative;
           tyrosine-protein phosphatase CDC14, putative [Candida
           dubliniensis CD36]
 gi|223644203|emb|CAX41013.1| protein phosphatase required for mitotic exit, putative [Candida
           dubliniensis CD36]
          Length = 543

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 66/209 (31%), Gaps = 24/209 (11%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--E 64
           +  +   +     G++ L    L  Y         +F+ +    I + S Q +      E
Sbjct: 142 QDVVYAMWRAKERGMIDLAKFDLDEYEQYERVDQGDFNVISKDFIAFASPQQSKRGGLNE 201

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI--- 121
             +K        N++  +  + H  + K      I+ I+           E +++ I   
Sbjct: 202 PFQKVLEYFVENNVQLVVRLNSHLYDAKEFTKRSIKHIDMIFDDGTCPTLEYVQKFIGAA 261

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR-------------QLSML 168
             +      + +HCK+G  RTG     +L     +   E                Q   L
Sbjct: 262 ECIINKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHWL 321

Query: 169 YGHF----PVLKTITMDITFE-KITQLYP 192
           Y H         T+ +D   +  I  LYP
Sbjct: 322 YLHHDDFRSWRHTMIVDNRPDPLIGNLYP 350


>gi|156035966|ref|XP_001586094.1| hypothetical protein SS1G_12669 [Sclerotinia sclerotiorum 1980]
 gi|154698077|gb|EDN97815.1| hypothetical protein SS1G_12669 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 611

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/211 (12%), Positives = 56/211 (26%), Gaps = 43/211 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G   L    L  Y         +F+ + P  + + S Q N       
Sbjct: 172 QDVVYGVWRAKEQGFCALPQFDLEEYERFERVDQGDFNWLTPDFLAFASPQHNPVQPILP 231

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +        I  ++ L  +L    +        
Sbjct: 232 SSPLYATLPTTLEDVDTHPTLPTPFKNVLKHFTSRNIGLVVRLNSELYSPSY------FT 285

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            LGI+ ++             +++ I++         + + +HCK+G  RTG     YL 
Sbjct: 286 ALGIEHLDMIFDDGTCPPLSIVRKFITLAHEMITVQERGIAVHCKAGLGRTGCLIGAYLI 345

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
               +   E    +     G     +   + 
Sbjct: 346 YRYGFTANEIIAYMRFMRPGMVVGPQQHWLH 376


>gi|320584002|gb|EFW98214.1| protein-tyrosine phosphatase, putative [Pichia angusta DL-1]
          Length = 543

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 63/181 (34%), Gaps = 8/181 (4%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRS---AQPNGTFI 63
           +  +   +     G+L + + +L  Y         +F+ +    I + S   ++P     
Sbjct: 141 QDVVYGVWRAKERGMLDITSFNLEEYEQYERVDQGDFNVISKDFIAFASPKQSRPGAPLN 200

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
           E  +K        N++  +  + H  ++      GI+ I+           E +++ I  
Sbjct: 201 EPFRKVLEYFVNNNVQLVVRLNSHLYDKNEFEKRGIKHIDMIFEDGTCPTMEYVQKFIGA 260

Query: 124 LKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTIT 179
            +T       + +HCK+G  RTG     +L     +   E    +  +  G     +   
Sbjct: 261 AETVIQKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHW 320

Query: 180 M 180
           +
Sbjct: 321 L 321


>gi|7413671|emb|CAB85704.1| protein phosphatase [Candida albicans]
          Length = 542

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 61/197 (30%), Gaps = 23/197 (11%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--E 64
           +  +   +     G++ L    L  Y         +F+ +    I + S Q +      E
Sbjct: 142 QDVVYAMWRAKERGMIDLAKFDLDEYEQYERVDQGDFNVISKDFIAFASPQQSKRGGLNE 201

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI--- 121
             +K        N++  +  + H  + K      I+ I+           E +++ I   
Sbjct: 202 PFQKVLEYFVENNVQLVVRLNSHLYDAKEFTKRNIKHIDMIFDDGTCPTLEYVQKFIGAA 261

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR-------------QLSML 168
             +      + +HCK+G  RTG     +L     +   E                Q   L
Sbjct: 262 ECIINKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHWL 321

Query: 169 YGHF----PVLKTITMD 181
           Y H         T+ +D
Sbjct: 322 YLHHDDFRSWRHTMIVD 338


>gi|169770919|ref|XP_001819929.1| protein-tyrosine phosphatase [Aspergillus oryzae RIB40]
 gi|83767788|dbj|BAE57927.1| unnamed protein product [Aspergillus oryzae]
          Length = 609

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/230 (13%), Positives = 62/230 (26%), Gaps = 41/230 (17%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +      +  L   SL  Y         +F+ + P  + + S Q         
Sbjct: 172 QDVVYGVWKAKEQSLCGLREFSLEEYEKYERVDMGDFNWITPQFLAFASPQHEPIAPIPP 231

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        I  ++ L  +L    +         
Sbjct: 232 NTPEYAALPSTISQVQASKLPLPFKNVLAHFASRDIGLVVRLNSELYSPSY------FTA 285

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           LGI  I+             +++ I +   + T  K + +HCK+G  RTG     YL   
Sbjct: 286 LGITHIDMIFEDGTCPPLPLVRRFIKMAHDMITKKKGIAVHCKAGLGRTGCLIGAYLIYR 345

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
             +   E    +     G     +   + +      + +  +  K    Q
Sbjct: 346 YGFTANEIIAFMRFMRPGMVVGPQQHWLHLNQGAFREWWFEDSMKEKLAQ 395


>gi|310793880|gb|EFQ29341.1| dual specificity phosphatase [Glomerella graminicola M1.001]
          Length = 662

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/237 (13%), Positives = 60/237 (25%), Gaps = 43/237 (18%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G   L    L  Y         +F+ + PH + + S Q         
Sbjct: 210 QDVVYGVWKAKEEGCCALDNFDLDEYEKFERVEHGDFNWITPHFLAFASPQHTPVAKVLE 269

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +     E  I  ++ L   L             
Sbjct: 270 GTEEFDALPRSLGQLDANKTLPQPFKNVLKHFTERNIGLVVRLNSPLYSPSF------FE 323

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            +GI  ++             +++ I +         K + +HCK+G  RTG     YL 
Sbjct: 324 AMGISHLDMIFDDGTCPPLTTVRKFIRLAHETITVKKKGIAVHCKAGLGRTGCLIGAYLI 383

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
               +   E    +     G     +   + I      + +     +    + M A 
Sbjct: 384 YRHGFTANEIIAFMRFMRPGMVVGPQQHWLHINQGIFREWWIEERIERKLRKEMAAN 440


>gi|261190528|ref|XP_002621673.1| protein-tyrosine phosphatase [Ajellomyces dermatitidis SLH14081]
 gi|239591096|gb|EEQ73677.1| protein-tyrosine phosphatase [Ajellomyces dermatitidis SLH14081]
 gi|327352218|gb|EGE81075.1| protein-tyrosine phosphatase [Ajellomyces dermatitidis ATCC 18188]
          Length = 615

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 55/209 (26%), Gaps = 41/209 (19%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G+  L   SL  Y         +F+ + P  + + S Q         
Sbjct: 172 QDVVYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWITPDFLAFASPQHQPIAPIPQ 231

Query: 61  ------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                                     +        I  ++ L  +L              
Sbjct: 232 NTPEFAALPSTITEVLVSDLPEPFKNVLSHFSSRNIGLVVRLNSELYSPS------NFTA 285

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +GI  I+             +++ I I   +    K + +HCK+G  RTG     YL   
Sbjct: 286 MGISHIDMIFEDGTCPPLTLVRRFIKIAHDMIHKKKGIAVHCKAGLGRTGCLIGAYLIYR 345

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
             +   E    +     G     +   + 
Sbjct: 346 HGFTANEVIAFMRFMRPGMVVGPQQHWLH 374


>gi|168042230|ref|XP_001773592.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162675131|gb|EDQ61630.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 586

 Score = 94.8 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/188 (13%), Positives = 56/188 (29%), Gaps = 24/188 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKK 68
             +        +G + +   +L  Y      +            YR+             
Sbjct: 128 DCIRAVLKANQVGWIDVNNFNLEEYEYFEQIY-----------GYRT--LVPEDYIEYFH 174

Query: 69  EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAP 128
             GI  ++ L  K        + +   + G+   +          D  +++ + I++   
Sbjct: 175 RVGITGVVRLNRK------AYDRRRFTEHGLSHHDLYFPDGSCPPDRILRRFLEIVEETS 228

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM----DIT 183
             L +HCK+G  RTG     Y+     +   E    L +   G     +   +       
Sbjct: 229 GALAVHCKAGLGRTGALMGCYIMKHFRFTCNETLGYLRIVRPGSVIGPQQHYLKEMQYRM 288

Query: 184 FEKITQLY 191
           ++ +  L+
Sbjct: 289 WKAVGTLH 296


>gi|296090655|emb|CBI41055.3| unnamed protein product [Vitis vinifera]
          Length = 158

 Score = 94.8 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 55/149 (36%), Gaps = 14/149 (9%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V   ++RS  P+        +  G++SI+ L    PE + +   +     GI+L  F +
Sbjct: 1   MVDCGVFRSGFPDIANF-TFLQTLGLRSIIYL---CPEPYPEPNIEFLKCNGIRLFQFGI 56

Query: 107 SATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
              +E       D   + L  +L     PLLIHCK G  RTG        +         
Sbjct: 57  DGCKEPFVNIPEDTIREALKVVLDKRNHPLLIHCKRGKHRTGCLVGCLRKLQ-----RWC 111

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQL 190
              +   Y  F   K    D  F ++  +
Sbjct: 112 LSSIFDEYQRFAAAKARISDQRFMELFDI 140


>gi|171695100|ref|XP_001912474.1| hypothetical protein [Podospora anserina S mat+]
 gi|170947792|emb|CAP59955.1| unnamed protein product [Podospora anserina S mat+]
          Length = 649

 Score = 94.8 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 32/237 (13%), Positives = 60/237 (25%), Gaps = 43/237 (18%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQ--------- 57
           +  +   +     G  VL    L  Y         +F+ + P  + + S Q         
Sbjct: 188 QDVVYGVWKAKEEGCCVLENFDLDEYEKFERVENGDFNWISPSFLAFASPQTAEVAKTPE 247

Query: 58  ------PNGTFIEY----------------LKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                      +                     E  I  ++ L                 
Sbjct: 248 GTEGWELLPKNLAQIESDAFINQPLRNVLTHFTERNIGLVVRLNSV------LYNASYFE 301

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKT----APKPLLIHCKSGADRTGLASAVYLY 151
            LGIQ I+             +++ I +         K + +HCK+G  RTG     YL 
Sbjct: 302 ALGIQHIDMIFEDGTCPPLSTVRKFIRLAHEMITVRKKGIAVHCKAGLGRTGCLIGAYLI 361

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
               +   E    +     G     +   + +      + +     +    + M A 
Sbjct: 362 YRYGFTANEVIAYMRFMRPGMVVGPQQHWLHLNQGVFREWWLEERIERKLRKEMAAN 418


>gi|320594044|gb|EFX06447.1| tyrosine phosphatase family protein [Grosmannia clavigera kw1407]
          Length = 343

 Score = 94.8 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 37/142 (26%), Positives = 56/142 (39%), Gaps = 13/142 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV   +YRS+ P         K  G+K+I+ L   + +++ +  +K  +   IQ  
Sbjct: 144 NFGQVVSG-LYRSSYPQPENYA-YLKSLGLKTIVTL---VDKNFTEGYQKFMSANNIQHH 198

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+            L  +L     PLLIHC  G  RTG   AV   I   +  E
Sbjct: 199 VFGMKGTKKEEIPLSTMEAILRLVLNRQNYPLLIHCNHGKHRTGCVVAVVRKIC-GWNNE 257

Query: 160 EAHRQLSMLYGHFPVLKTITMD 181
               +    Y  +  +K    D
Sbjct: 258 RIVHE----YRTYAGIKERDCD 275


>gi|241958954|ref|XP_002422196.1| tyrosine-protein phosphatase, putative [Candida dubliniensis CD36]
 gi|223645541|emb|CAX40200.1| tyrosine-protein phosphatase, putative [Candida dubliniensis CD36]
          Length = 280

 Score = 94.8 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  I+L 
Sbjct: 120 NFAPVI-NKIYRSSFPQPNNFAFLKKLK-LKSILCL---IPEDYPHLQQEFIKNENIKLF 174

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E       D   + +  +L    +P+LIHC  G  RTG    V   +  ++ 
Sbjct: 175 QLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIRKL-QNWS 233

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   MD  F ++
Sbjct: 234 ----LTLIFDEYRKFACPKERPMDQQFIEL 259


>gi|255321883|ref|ZP_05363033.1| protein tyrosine/serine phosphatase [Campylobacter showae RM3277]
 gi|255300987|gb|EET80254.1| protein tyrosine/serine phosphatase [Campylobacter showae RM3277]
          Length = 228

 Score = 94.8 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 67/160 (41%), Gaps = 11/160 (6%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
            T+    +NF+ V    ++RSAQ +G+       E GIKSI+NLR        +      
Sbjct: 72  ATLIDEAKNFYRVDE-LLFRSAQLDGSD-AAKLHELGIKSIVNLRHFSRGGDRRAFGDQF 129

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIV 153
                 L + PL +      +    L +I +      +L+HC  GADRTGL  A+Y  I 
Sbjct: 130 W-----LASKPLQSWEIKPAQIADVLRTIRERQKEGAVLVHCYHGADRTGLVVAMYRVIY 184

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLK--TITMDITFEKITQL 190
             +  + A  ++    YG   + +     +    E + ++
Sbjct: 185 QGWSLDAARSEMIDGGYGFHSMWQDIAGFLTPQNEALVRV 224


>gi|154277350|ref|XP_001539516.1| hypothetical protein HCAG_04983 [Ajellomyces capsulatus NAm1]
 gi|150413101|gb|EDN08484.1| hypothetical protein HCAG_04983 [Ajellomyces capsulatus NAm1]
          Length = 616

 Score = 94.8 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 58/209 (27%), Gaps = 41/209 (19%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQ--------- 57
           +  +   +     G+  L   SL  Y         +F+ + PH + + S Q         
Sbjct: 174 QDVVYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWITPHFLAFASPQHQQIDPIPP 233

Query: 58  --------------------PNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                               P     +        I  ++ L  +L    H         
Sbjct: 234 NTPEFAALPSTITEVLISDLPVPFKNVLSHFSSRNIGLVVRLNSELYSPSH------FTA 287

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +GI  ++             +++ I I   +    K + +HCK+G  RTG     YL   
Sbjct: 288 MGISHMDMIFEDGTCPPLPLVRRFIKIAHEMIHKKKGIAVHCKAGLGRTGCLIGAYLIYR 347

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
             +   E    +     G     +   + 
Sbjct: 348 HGFTANEVIAFMRFMRPGMVVGPQQHWLH 376


>gi|150865733|ref|XP_001385068.2| Protein tyrosine phosphatase CDC14 [Scheffersomyces stipitis CBS
           6054]
 gi|149386989|gb|ABN67039.2| Protein tyrosine phosphatase CDC14 [Scheffersomyces stipitis CBS
           6054]
          Length = 562

 Score = 94.8 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/181 (14%), Positives = 58/181 (32%), Gaps = 8/181 (4%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--- 63
           +  +   +     G++ L   +L  Y         +F+ +    I + S Q +       
Sbjct: 142 QDIVYAMWRAKERGMIDLTTFNLEEYEQYERVDQGDFNVISKDFIAFASPQQSSRKAGLN 201

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISI 123
           E  +K        +++  +  + H  +        IQ I+           E +++ I  
Sbjct: 202 EPFRKVLSFFVQNDVQLVVRLNSHLYDANEFTKRNIQHIDMIFDDGTCPTLEYVQKFIGA 261

Query: 124 LK---TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTIT 179
            +        + +HCK+G  RTG     +L     +   E    +  +  G     +   
Sbjct: 262 AETVINKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQHW 321

Query: 180 M 180
           +
Sbjct: 322 L 322


>gi|322699131|gb|EFY90895.1| tyrosine-protein phosphatase CDC14 [Metarhizium acridum CQMa 102]
          Length = 619

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 57/211 (27%), Gaps = 43/211 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +       + L    L +Y         +F+ + PH + + S Q         
Sbjct: 165 QDVVYGVWKAKEEKCIDLDNFDLEMYEKFERVEHGDFNWITPHFLAFASPQHTPVAKVTE 224

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +     E  I  ++ L   L    +        
Sbjct: 225 DSELWPLLPRDLAAVDAHPTLPQPFKNVLKHFSEKNIGLVVRLNSHLYSPSY------FE 278

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            LGIQ ++             +++ I +         K + +HCK+G  RTG     YL 
Sbjct: 279 ALGIQHLDMIFDDGTCPPLTTVRKFIRLAHETITVKKKGIAVHCKAGLGRTGCLIGAYLI 338

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
               +  +E    +     G     +   + 
Sbjct: 339 YRHGFTADEIISFMRFMRPGMVVGPQQHWLH 369


>gi|240280236|gb|EER43740.1| tyrosine phosphatase CDC14 [Ajellomyces capsulatus H143]
          Length = 578

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 58/209 (27%), Gaps = 41/209 (19%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQ--------- 57
           +  +   +     G+  L   SL  Y         +F+ + PH + + S Q         
Sbjct: 174 QDVVYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWITPHFLAFASPQHQQIDPIPP 233

Query: 58  --------------------PNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                               P     +        I  ++ L  +L    H         
Sbjct: 234 NTPEFAALPSTITEVLISDLPVPFKNVLSHFSSRNIGLVVRLNSELYSPSH------FTA 287

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +GI  ++             +++ I I   +    K + +HCK+G  RTG     YL   
Sbjct: 288 MGISHMDMIFEDGTCPPLPLVRRFIKIAHEMIHKKKGIAVHCKAGLGRTGCLIGAYLIYR 347

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
             +   E    +     G     +   + 
Sbjct: 348 HGFTANEVIAFMRFMRPGMVVGPQQHWLH 376


>gi|118380815|ref|XP_001023570.1| Dual specificity phosphatase, catalytic domain containing protein
           [Tetrahymena thermophila]
 gi|89305337|gb|EAS03325.1| Dual specificity phosphatase, catalytic domain containing protein
           [Tetrahymena thermophila SB210]
          Length = 373

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 63/181 (34%), Gaps = 28/181 (15%)

Query: 1   MIKIKKPRKNLLIFYIKILLG-----------VLVLCAVSLGLYFLTITTFTQNFHAVVP 49
           ++   +PR  +   Y ++L              +     +   Y    +    +   VVP
Sbjct: 133 LMLFTQPRTQIQKIYFQVLDCLKGIEEARRLKWIDTQQFNHIKYDHLASIQNGDISEVVP 192

Query: 50  HEIYRSAQP-----------NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
           ++IY    P                  + K+  I+ ++ L  +      K +E      G
Sbjct: 193 NKIYAFRGPRNVRENGINVAKPEDFVGIFKQINIQKVIQLNQE------KYDESKFTQAG 246

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           IQ +           +EQ+++ I  +      + +HC++G  RTG   A+Y     ++P 
Sbjct: 247 IQHVKIIFPDGGIPTNEQVEKFIQEVDRTEGNVAVHCQAGLGRTGTMIALYCMKQYYFPA 306

Query: 159 E 159
            
Sbjct: 307 R 307


>gi|225561181|gb|EEH09462.1| tyrosine-protein phosphatase CDC14 [Ajellomyces capsulatus G186AR]
          Length = 617

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 58/209 (27%), Gaps = 41/209 (19%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQ--------- 57
           +  +   +     G+  L   SL  Y         +F+ + PH + + S Q         
Sbjct: 174 QDVVYGVWKAKEEGLCGLKDFSLEEYEKFERVDMGDFNWITPHFLAFASPQHQQIDPIPP 233

Query: 58  --------------------PNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                               P     +        I  ++ L  +L    H         
Sbjct: 234 NTPEFAALPSTITEVLISDLPVPFKNVLSHFSSRNIGLVVRLNSELYSPSH------FTA 287

Query: 97  LGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           +GI  ++             +++ I I   +    K + +HCK+G  RTG     YL   
Sbjct: 288 MGISHMDMIFEDGTCPPLPLVRRFIKIAHEMIHKKKGIAVHCKAGLGRTGCLIGAYLIYR 347

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
             +   E    +     G     +   + 
Sbjct: 348 HGFTANEVIAFMRFMRPGMVVGPQQHWLH 376


>gi|238023257|ref|ZP_04603683.1| hypothetical protein GCWU000324_03184 [Kingella oralis ATCC 51147]
 gi|237865640|gb|EEP66780.1| hypothetical protein GCWU000324_03184 [Kingella oralis ATCC 51147]
          Length = 164

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 42/150 (28%), Positives = 71/150 (47%), Gaps = 7/150 (4%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + V   ++YRS Q N   +    ++ GI+S++NLR       HK ++  A    I LI
Sbjct: 9   NLYRVDS-KLYRSEQLNRDDLA-TIRQLGIRSVVNLRYFGR---HKNQKIFAGHPDIALI 63

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL   R    +  + L +I  +     +L+HC  GADRTG   A+Y  +    P  +A
Sbjct: 64  NRPLLTWRVQPRDIARVLRTIEQQQQQGAVLVHCYHGADRTGTIVAMYRIVYHGLPIADA 123

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQL 190
             ++    +G+  + + +    T E + Q+
Sbjct: 124 LAEMKHERFGYHSIWRNLERLFTEENVAQV 153


>gi|77554827|gb|ABA97623.1| tyrosine specific protein phosphatase family protein, putative,
           expressed [Oryza sativa Japonica Group]
          Length = 204

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 57/155 (36%), Gaps = 23/155 (14%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P+        +  G++S++ L    PE + +   +     GI+L 
Sbjct: 25  NFGMVDTG-VYRSGFPDPASF-GFLRGLGLRSVVYL---CPEPYMETNAEFLKAEGIRLF 79

Query: 103 NFPLSATR-------------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
            F +   +                D  +  L  IL     P+LIHCK G  RTG     +
Sbjct: 80  QFGIEGNKLCLTTGEEDPNVSIPVDAIMGALRVILDVRNHPVLIHCKRGKHRTGCLVGCF 139

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
             +  ++        +   Y  +   K+   D+ F
Sbjct: 140 RKL-QNWC----LSSVFEEYHRYAAGKSRLSDLKF 169


>gi|325187341|emb|CCA21879.1| hypothetical protein ALNC14_080220 [Albugo laibachii Nc14]
          Length = 169

 Score = 94.4 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 52/160 (32%), Gaps = 16/160 (10%)

Query: 30  LGLYFLTITTFTQ-NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK 88
           L             NF  +    +YRS  P         +  G++SIL L     E +  
Sbjct: 19  LEEDGDYEELIPPENFAMIERG-LYRSGFPKKKNFA-FLESLGLRSILTLVL---EEYPF 73

Query: 89  EEEKAANDLGIQLINFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTG 143
              +      IQL+ F +   +E   +  +      L ++L     P+LIHC  G  RTG
Sbjct: 74  ANTEFNKTNRIQLLQFGVPGNKEPFVDIPEAGMLSALKAVLDIRNHPMLIHCNKGKHRTG 133

Query: 144 LASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDIT 183
                   +        A+      Y  F   K   MD  
Sbjct: 134 CLVGSLRKVQ-----RWAYSSTFDEYIRFSSPKPRMMDQQ 168


>gi|68490198|ref|XP_711079.1| hypothetical protein CaO19.1850 [Candida albicans SC5314]
 gi|68490289|ref|XP_711035.1| hypothetical protein CaO19.9408 [Candida albicans SC5314]
 gi|46432307|gb|EAK91796.1| hypothetical protein CaO19.9408 [Candida albicans SC5314]
 gi|46432354|gb|EAK91840.1| hypothetical protein CaO19.1850 [Candida albicans SC5314]
          Length = 281

 Score = 94.4 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  I+L 
Sbjct: 121 NFAPVI-NKIYRSSFPQPNNFAFLKKLK-LKSILCL---IPEDYPHLQQEFIKNENIKLF 175

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E       D   + +  +L    +P+LIHC  G  RTG    V   +  ++ 
Sbjct: 176 QLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIRKL-QNWS 234

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   MD  F ++
Sbjct: 235 ----LTLIFDEYRKFACPKERPMDQQFIEL 260


>gi|322708819|gb|EFZ00396.1| tyrosine-protein phosphatase CDC14 [Metarhizium anisopliae ARSEF
           23]
          Length = 630

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 57/211 (27%), Gaps = 43/211 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +       + L    L +Y         +F+ + PH + + S Q         
Sbjct: 176 QDVVYGVWKAKEEKCIDLDNFDLEMYEKFERVEHGDFNWITPHFLAFASPQHTPVAKVTE 235

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +     E  I  ++ L   L    +        
Sbjct: 236 DSELWPLLPRDLGAVDAHPTLPQPFKNVLKHFSEKNIGLVVRLNSHLYSPSY------FE 289

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            LGIQ ++             +++ I +         K + +HCK+G  RTG     YL 
Sbjct: 290 ALGIQHLDMIFDDGTCPPLTTVRKFIRLAHETITVKKKGIAVHCKAGLGRTGCLIGAYLI 349

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
               +  +E    +     G     +   + 
Sbjct: 350 YRHGFTADEIISFMRFMRPGMVVGPQQHWLH 380


>gi|320102657|ref|YP_004178248.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319749939|gb|ADV61699.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 256

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/210 (17%), Positives = 68/210 (32%), Gaps = 11/210 (5%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI 63
           +  PR   L  +    L + VL       +          F  + P  +YR A      +
Sbjct: 51  LSLPRSIRLTAW----LALAVLAGWQAWRHGHDY-VLLSQFAEIEPGRVYRGAWQKPWPM 105

Query: 64  EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA------TRELNDEQI 117
             L  +Y IK+++ L           E+      G + ++ P+         R+L D+  
Sbjct: 106 SRLLNDYDIKTVVALAHPADHPLAIREKAQVEAHGARWVHLPIVDDRRFMQGRDLFDQID 165

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           + +  +   A +P+  HC  G +R  +    Y   V  +  +EA  ++   +G     + 
Sbjct: 166 EAVKVVGDPANQPVFFHCHHGINRASMVQMAYRMKVCGWSFDEAVAEIDRTFGLVAASRG 225

Query: 178 ITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
                      +            QP   T
Sbjct: 226 PDYRRMKRYYHERVLGEALPPLASQPHGPT 255


>gi|255547596|ref|XP_002514855.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
 gi|223545906|gb|EEF47409.1| Tyrosine-protein phosphatase SIW14, putative [Ricinus communis]
          Length = 200

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 53/146 (36%), Gaps = 14/146 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RSA P             ++S++ L     E + +E  +      IQL 
Sbjct: 20  NFSMVEDG-IFRSAFPQPANF-SFLHSLNLRSVIYLCL---EPYPEENMEFLRAHNIQLF 74

Query: 103 NFPLSAT----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
            F +           D  +  L  +L     P+LIHCK G  RTG     +  +      
Sbjct: 75  QFGIEGKTSSVSIPKDAILGALKVLLDVRNHPILIHCKRGKHRTGTLVGCFRKLQH---- 130

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITF 184
                 +   Y HF  +K+   D+ F
Sbjct: 131 -WCLSSVFEEYQHFAGVKSRAADLKF 155


>gi|46107320|ref|XP_380719.1| hypothetical protein FG00543.1 [Gibberella zeae PH-1]
          Length = 633

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 56/211 (26%), Gaps = 43/211 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +         L    L  Y         +F+ + PH + + S Q         
Sbjct: 185 QDVVYGVWKAKEEKCCDLDNFDLDEYERFERVEHGDFNWITPHFLAFASPQHAPVQKVTE 244

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +     E  I  ++ L  +L    +        
Sbjct: 245 GSELFPLLPRTIAAVDAHPKLPKPFKNVLKHFSEKNIGLVVRLNSQLYSPSY------FE 298

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKT----APKPLLIHCKSGADRTGLASAVYLY 151
            LGIQ ++         +   +++ I +         K + +HCK+G  RTG     YL 
Sbjct: 299 ALGIQHLDMIFDDGTCPSLTTVRKFIRLAHETITVRKKGIAVHCKAGLGRTGCLIGAYLI 358

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
               +   E    +     G     +   + 
Sbjct: 359 YRHGFTANEVISFMRFMRPGMVVGPQQHWLH 389


>gi|37181630|gb|AAQ88624.1| LKHP9428 [Homo sapiens]
          Length = 218

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 64/126 (50%), Gaps = 10/126 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H + P  +YRS  P+   +  L ++  + +++N   +  +SW  + +       I+ +
Sbjct: 46  NLHQMTP-TLYRSGLPDSRAL-PLLEKLNVGTVINFLPESDDSWLADSD-------IKQV 96

Query: 103 NFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
                     + + +  L +I +  A   +L+HCK G+DRTGL +A+Y  ++  + KE+A
Sbjct: 97  QLTYRTNHVDDSDVLAALRAIRQAEANGSVLMHCKHGSDRTGLMAAMYRVVIQGWSKEDA 156

Query: 162 HRQLSM 167
             ++++
Sbjct: 157 LNEMTL 162


>gi|257459745|ref|ZP_05624854.1| protein tyrosine/serine phosphatase [Campylobacter gracilis RM3268]
 gi|257443170|gb|EEV18304.1| protein tyrosine/serine phosphatase [Campylobacter gracilis RM3268]
          Length = 228

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/159 (25%), Positives = 66/159 (41%), Gaps = 11/159 (6%)

Query: 35  LTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
            T+    +NF+ V    ++RSAQ +G+       E GIKSI+NLR        +      
Sbjct: 72  ATLIDEAKNFYRVDE-LLFRSAQLDGS-YAAKLHELGIKSIVNLRHFSRGGDKRAFGDQF 129

Query: 95  NDLGIQLINFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIV 153
                 L N PL +      +    L +I +      +L+HC  GADRTGL  A+Y  I 
Sbjct: 130 W-----LANKPLQSWEIKPAQIADVLRTIRERQKEGAVLVHCYHGADRTGLVVAMYRVIY 184

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLK--TITMDITFEKITQ 189
             +  + A  ++    YG   + +     +    E + +
Sbjct: 185 QGWSLDAARSEMIDGGYGFHSMWQDIAGFLTPQNEALVR 223


>gi|217075344|gb|ACJ86032.1| unknown [Medicago truncatula]
          Length = 186

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 63/148 (42%), Gaps = 15/148 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    IYRS+ P  +      +   ++SI+ L    PE + +E      +  I+L
Sbjct: 21  PNFSMV-EDCIYRSSLPKPSSF-PFLQTLNLRSIIYL---CPEPYPEENLDFLKEQNIRL 75

Query: 102 INFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F +    E++     D  ++ L  ++     P+L+HCK G  RTG     +  +  ++
Sbjct: 76  FQFGIEGKTEVSLPALRDSIMEALKVLVDVRNHPILVHCKQGKHRTGRLVGCFRKL-QNW 134

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITF 184
               A  +    Y  F  +K+   D+TF
Sbjct: 135 CLSSAFEE----YQRFAGVKSRAADLTF 158


>gi|46109578|ref|XP_381847.1| hypothetical protein FG01671.1 [Gibberella zeae PH-1]
          Length = 304

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/145 (26%), Positives = 61/145 (42%), Gaps = 12/145 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+P  +YRS+ P     +   K  G+K+I++L  K     H  E    ++ GI+ +
Sbjct: 108 NFGIVIPG-VYRSSFPKSHDFD-YIKGLGLKTIVSLVKKDDLD-HDLETFITSE-GIRQV 163

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+      D     L  +L  +  PLLIHC  G  RTG    V   I   +   
Sbjct: 164 VFNMKGTKKEAIPLDTMKGILNVVLDQSNYPLLIHCNHGKHRTGCVVGVVRKIT-GWDVA 222

Query: 160 EAHRQLSMLYGHFPVLKTITMDITF 184
               +    Y  +   K   +D+T+
Sbjct: 223 RVVAE----YNTYAEPKAREVDVTY 243


>gi|293372029|ref|ZP_06618428.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|292633040|gb|EFF51622.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
          Length = 187

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/187 (22%), Positives = 80/187 (42%), Gaps = 10/187 (5%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           ++ LL   + ++  + +              +   N + +    +YRS QP+    +   
Sbjct: 3   KRILLSLLLVVIFSISIFSQNLEVEKITLPDSELTNLYKIDSG-VYRSEQPSHEDFKA-L 60

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           ++YGI   LNLR +  +         A    ++L      A   +N+EQ+ + + I+K  
Sbjct: 61  EKYGIGEALNLRNRHSDD------DEAAGTNVKLHRVKTKA-HSINEEQLIEALRIIKNR 113

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEK 186
             P++IHC  G+DRTG   A+Y  +  +  K +A  +++   +G   + K I   I    
Sbjct: 114 KAPIVIHCHHGSDRTGAVCALYRVVFQNVSKGDAIHEMTEGGFGFHRIYKNIIRRIKEAD 173

Query: 187 ITQLYPN 193
           I Q+   
Sbjct: 174 IEQIRRK 180


>gi|238880096|gb|EEQ43734.1| tyrosine-protein phosphatase SIW14 [Candida albicans WO-1]
          Length = 277

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 65/150 (43%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+ ++IYRS+ P      +LKK   +KSIL L   +PE +   +++   +  I+L 
Sbjct: 117 NFAPVI-NKIYRSSFPQPNNFAFLKKLK-LKSILCL---IPEDYPHLQQEFIKNENIKLF 171

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E       D   + +  +L    +P+LIHC  G  RTG    V      ++ 
Sbjct: 172 QLGMSGNKEPFVKISADLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIR-KFQNWS 230

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   MD  F ++
Sbjct: 231 ----LTLIFDEYRKFACPKERPMDQQFIEL 256


>gi|255089443|ref|XP_002506643.1| nad-k like protein [Micromonas sp. RCC299]
 gi|226521916|gb|ACO67901.1| nad-k like protein [Micromonas sp. RCC299]
          Length = 988

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/161 (18%), Positives = 63/161 (39%), Gaps = 12/161 (7%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---------KEEEKAANDLGIQLI 102
            YR  QP      ++    G K+I++LR +  ++           K  +    +  ++++
Sbjct: 261 FYRGGQPTAEGRAWMVSR-GFKTIVDLRFEDRDNQWTRPLGGVDGKGGKVGHVESQLEVV 319

Query: 103 NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P++     + E +++ I I      +P+L+HCK+G  RTG   + +         EEA
Sbjct: 320 HIPVTDMEPPSFEAVERFIEIANDETKRPMLVHCKAGIGRTGSMVSCWRISR-GMDVEEA 378

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
               S+      + +   +    ++  Q           E+
Sbjct: 379 LALESLNCDFGSIAQEAFVRSFADRFVQKRKTAEEMKREEE 419


>gi|149239280|ref|XP_001525516.1| hypothetical protein LELG_03444 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451009|gb|EDK45265.1| hypothetical protein LELG_03444 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 369

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 67/181 (37%), Gaps = 20/181 (11%)

Query: 27  AVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW 86
              +            NF  V+ + IYRS+ P  T   +LK              +PE +
Sbjct: 195 QFDIDEDEPLTPPE--NFALVI-NAIYRSSFPQPTNFSFLKLLKLKSV----LCLIPEDY 247

Query: 87  HKEEEKAANDLGIQLINFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADR 141
              +E+     GI+L   P+S  +E      +D   + +  +L  + +P+LIHC  G  R
Sbjct: 248 PLLQEQFLASQGIKLFQLPMSGNKEPFVKISSDLITQAIQIVLDPSNQPILIHCNRGKHR 307

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
           TG    V   +  ++        +   Y  F   K   MD  F    +LY +   K    
Sbjct: 308 TGCLVGVLRRL-QNWS----KTIIFDEYRKFAAPKERPMDQQF---IELYDDREIKRYCY 359

Query: 202 Q 202
           +
Sbjct: 360 E 360


>gi|154296234|ref|XP_001548549.1| hypothetical protein BC1G_12944 [Botryotinia fuckeliana B05.10]
 gi|150843508|gb|EDN18701.1| hypothetical protein BC1G_12944 [Botryotinia fuckeliana B05.10]
          Length = 613

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/211 (12%), Positives = 55/211 (26%), Gaps = 43/211 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G   L    L  Y         +F+ + P  + + S Q +       
Sbjct: 177 QDVVYGVWRAKEQGFCALPQFDLEEYERYERVDQGDFNWLTPDFLAFASPQHHPVQPILP 236

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +        I  ++ L  +L             
Sbjct: 237 SSPLYASLPTTLEDVDTHPTLPTPFKNVLKHFTSRNIGLVVRLNSELYSPSF------FT 290

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            LGI+ ++             +++ I++         + + +HCK+G  RTG     YL 
Sbjct: 291 ALGIEHLDMIFDDGTCPPLSVVRKFITLAHEMITVQKRGIAVHCKAGLGRTGCLIGAYLI 350

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
               +   E    +     G     +   + 
Sbjct: 351 YRYGFTANEIIAYMRFMRPGMVVGPQQHWLH 381


>gi|253559464|gb|ACT32424.1| hypothetical protein [Pseudomonas fluorescens]
          Length = 226

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 76/171 (44%), Gaps = 18/171 (10%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
             N + + P  +YRS+ P+G  +  L  +  I +++    +  + W           GI+
Sbjct: 43  NYNLYQMSP-TLYRSSLPDGAAL-PLLSKLRIGTVITFLPESDKRWLST-------PGIE 93

Query: 101 LINFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            +  P       + + ++ L ++    A  P+L+HCK G+DRTGL +A+Y  +V  + KE
Sbjct: 94  QVQLPYRTNHVDDSDILRALRAVQAAEAKGPVLMHCKHGSDRTGLVAAMYRVVVQGWSKE 153

Query: 160 EAHRQLSM-LYG---HFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
           +A  +++   +G   HF       M    +K+     N    GD    + A
Sbjct: 154 DALNEMTEGGFGDSHHFKDGVRYMMQADVDKLRVALAN----GDCSTSVFA 200


>gi|255727414|ref|XP_002548633.1| tyrosine-protein phosphatase CDC14 [Candida tropicalis MYA-3404]
 gi|240134557|gb|EER34112.1| tyrosine-protein phosphatase CDC14 [Candida tropicalis MYA-3404]
          Length = 452

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 60/188 (31%), Gaps = 7/188 (3%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--E 64
           +  +   +     G++ L    L  Y         +F+ +    I + S Q +      E
Sbjct: 41  QDIVYAMWRAKERGMIDLTTFDLEEYEQYERVDQGDFNVISKDFIAFASPQQSKRGGINE 100

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI--- 121
             +K        +++  +  + H  + K      I+ I+           E +++ I   
Sbjct: 101 PFQKVLDYFIEHDVQLVVRLNSHLYDAKEFTKRNIKHIDMIFEDGTCPTLEYVQKFIGAA 160

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
             +      + +HCK+G  RTG     +L     +   E    + M   G     +   +
Sbjct: 161 ECIINKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMVRPGMVVGPQQHWL 220

Query: 181 DITFEKIT 188
            +  +   
Sbjct: 221 YLHQDDFR 228


>gi|164658746|ref|XP_001730498.1| hypothetical protein MGL_2294 [Malassezia globosa CBS 7966]
 gi|159104394|gb|EDP43284.1| hypothetical protein MGL_2294 [Malassezia globosa CBS 7966]
          Length = 668

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/244 (13%), Positives = 69/244 (28%), Gaps = 50/244 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRS----------- 55
           +  L      +   +L L    L  Y         +++ + PH + + S           
Sbjct: 224 QDILYGVRRALDHELLDLTTFDLESYEFYEQVQNGDWNWITPHFLAFASPKDRAYMATLA 283

Query: 56  AQ---------------PNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           +Q               P+        +++ I  ++ L                 D GI+
Sbjct: 284 SQGPYAAECTAKRMPVNPSLQRTVEYFQQHNISLVVRLNNA------LYHRGVFEDAGIE 337

Query: 101 LINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
             +         +D+ ++  I        A   + +HCK+G  RTG+    YL     + 
Sbjct: 338 HKDLYFDDGSNPSDDILRTFIQDADRTIQAGGVIAVHCKAGLGRTGVLIGAYLIWRYGFT 397

Query: 158 KEEAHRQLSMLYG--------HF------PVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
             E    + ++          HF        ++    D    ++ +         D  Q 
Sbjct: 398 ASEVIGYMRLMRPGCVVGPQQHFMYENASKWVRWGVEDRLRAELARQISTAAVPSDIPQT 457

Query: 204 MNAT 207
              +
Sbjct: 458 PATS 461


>gi|85079914|ref|XP_956442.1| hypothetical protein NCU03333 [Neurospora crassa OR74A]
 gi|28917507|gb|EAA27206.1| predicted protein [Neurospora crassa OR74A]
          Length = 331

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/143 (22%), Positives = 50/143 (34%), Gaps = 13/143 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF  VVP  +YRS+ P         +   +K+++ L  K     +       +  GI+ 
Sbjct: 132 KNFGVVVPG-VYRSSFPQTEDY-PFIEGLKLKTMVTLVQKDFPVGYDA---FLSRNGIKH 186

Query: 102 INFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             F +  T+            L  +L  A  PLLIHC  G  RTG    +       +  
Sbjct: 187 HVFDMKGTKKEAIPITTMKAILRLVLNQANHPLLIHCNHGKHRTGCVVGIVRRT-LGWDV 245

Query: 159 EEAHRQLSMLYGHFPVLKTITMD 181
                +    Y  +   K    D
Sbjct: 246 SNILEE----YRSYAEPKVRETD 264


>gi|159483417|ref|XP_001699757.1| cell division cycle protein 14 [Chlamydomonas reinhardtii]
 gi|158281699|gb|EDP07453.1| cell division cycle protein 14 [Chlamydomonas reinhardtii]
          Length = 306

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/166 (15%), Positives = 55/166 (33%), Gaps = 20/166 (12%)

Query: 38  TTFTQNFHAVVPHEIYRSAQP-------------NGTFIEYLKKEYGIKSILNLRGKLPE 84
                + + +VP +    + P                      +  G+ +I+ L  K+  
Sbjct: 141 QVENGDLNWIVPGKFVAFSGPAARCNEIAGYRLHTPEDYWEYFRRRGVTTIVRLNKKV-- 198

Query: 85  SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
                + K   D G +            ND  I++ +  ++  P  + +HCK+G  RTG+
Sbjct: 199 ----YDRKRFLDGGFKHHEMYFPDGSCPNDAIIQRFLDTVEAEPGSIAVHCKAGLGRTGV 254

Query: 145 ASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQ 189
              +Y+     +  EE    + +   G     +   +     ++  
Sbjct: 255 LICLYIMKHYRFTAEEVIGYIRVCRPGSVIGPQQNFIREMESRMWH 300


>gi|308811847|ref|XP_003083231.1| ATP-NAD kinase family protein (ISS) [Ostreococcus tauri]
 gi|116055110|emb|CAL57506.1| ATP-NAD kinase family protein (ISS) [Ostreococcus tauri]
          Length = 721

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 54/162 (33%), Gaps = 11/162 (6%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE------EEKAANDLGIQLINFP 105
            YR  QP              K++++LRG   ++   +       +       + +++ P
Sbjct: 177 FYRGGQPTAEG-RAWLVRNNFKTVIDLRGSDRDNQWLQAFGGGSGQGTYGPSALNIVHIP 235

Query: 106 LSATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           +       DE + + I  +     +P+L+HCK+G  RTG   A +         +EA  Q
Sbjct: 236 IHDMEPPTDEDVDRFIEAVNNESMRPVLVHCKAGIGRTGALVACWRV-HQGMDVDEALSQ 294

Query: 165 LSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
            +++     + +                  V    +      
Sbjct: 295 ENLVCDFGSIAQEAY--HFIGNYETKEAEAVLGEHSSLQDAP 334


>gi|146183755|ref|XP_001026979.2| hypothetical protein TTHERM_00688770 [Tetrahymena thermophila]
 gi|146143485|gb|EAS06737.2| hypothetical protein TTHERM_00688770 [Tetrahymena thermophila
           SB210]
          Length = 354

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/225 (13%), Positives = 62/225 (27%), Gaps = 43/225 (19%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP----- 58
           I      L      I LG   +   ++  Y       + N   ++P++I     P     
Sbjct: 24  IISILDCLKAIKRAIDLGWFNVETFNIKEYEKLEDQESGNISVIIPNKIVALRGPVSEKN 83

Query: 59  -------------NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
                        N   +    K   +++I+             ++       I   + P
Sbjct: 84  NEQNQIKTRYYRINPEQLIPQLKFIKVQTIVRCNSPEE-----YDKFIFAPHNIDHFDIP 138

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIH-------------------CKSGADRTGLAS 146
                   D+ IK  I I+  +   + +H                    K+G  RTG   
Sbjct: 139 FPDGSCPKDDIIKSFIEIVDNSNGVVGVHFINNNTYLHDQIFINFGEFKKAGLGRTGTLI 198

Query: 147 AVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQL 190
           A Y     ++P  E    + +   G     +   +    + + + 
Sbjct: 199 ACYAIQKYNFPAREIIAWIRLCRSGSILGKQQQFLLHYEQILKEQ 243


>gi|255721925|ref|XP_002545897.1| hypothetical protein CTRG_00678 [Candida tropicalis MYA-3404]
 gi|240136386|gb|EER35939.1| hypothetical protein CTRG_00678 [Candida tropicalis MYA-3404]
          Length = 284

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 69/165 (41%), Gaps = 18/165 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+ ++IYRS+ P         K+  +KSIL L   +PE +   +++   +  I+L 
Sbjct: 124 NFAPVI-NQIYRSSFPQPNNF-TFLKKLKLKSILCL---IPEDYPHLQQEFIKNENIKLF 178

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              +S  +E      +D   + +  +L    +P+LIHC  G  RTG    V   +  ++ 
Sbjct: 179 QLGMSGNKEPFVKISSDLITEAVKIVLNPENQPILIHCNRGKHRTGCLVGVIRRL-QNWS 237

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQ 202
                  +   Y  F   K   MD  F    +LY +       ++
Sbjct: 238 F----TLICDEYRKFAAPKERPMDQQF---IELYDDTEILKYCQE 275


>gi|79387510|ref|NP_186929.2| phosphatase/ phosphoprotein phosphatase/ protein tyrosine
           phosphatase [Arabidopsis thaliana]
 gi|51969092|dbj|BAD43238.1| unknown protein [Arabidopsis thaliana]
 gi|332640340|gb|AEE73861.1| tyrosine specific protein phosphatase-like protein [Arabidopsis
           thaliana]
          Length = 203

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 46/127 (36%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  P         K   ++SI+ L    PE + +E  K      I+L 
Sbjct: 20  NFSMVEDG-IYRSGFPRPENF-SFLKTLNLRSIIYL---CPEPYPEENLKFLEANNIKLY 74

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    +       D  +  L  ++     P+LIHCK G  RTG         V  + 
Sbjct: 75  QFGIEGKTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQSWC 133

Query: 158 KEEAHRQ 164
                 +
Sbjct: 134 LSSVLEE 140


>gi|6728982|gb|AAF26980.1|AC018363_25 unknown protein [Arabidopsis thaliana]
 gi|34365627|gb|AAQ65125.1| At3g02800 [Arabidopsis thaliana]
          Length = 199

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 46/127 (36%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  P         K   ++SI+ L    PE + +E  K      I+L 
Sbjct: 16  NFSMVEDG-IYRSGFPRPENF-SFLKTLNLRSIIYL---CPEPYPEENLKFLEANNIKLY 70

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    +       D  +  L  ++     P+LIHCK G  RTG         V  + 
Sbjct: 71  QFGIEGKTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQSWC 129

Query: 158 KEEAHRQ 164
                 +
Sbjct: 130 LSSVLEE 136


>gi|151944476|gb|EDN62754.1| oxidant-induced cell cycle arrest [Saccharomyces cerevisiae YJM789]
 gi|190409047|gb|EDV12312.1| hypothetical protein SCRG_03193 [Saccharomyces cerevisiae RM11-1a]
 gi|207341667|gb|EDZ69656.1| YNL056Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256273270|gb|EEU08211.1| Oca2p [Saccharomyces cerevisiae JAY291]
 gi|259149303|emb|CAY82545.1| Oca2p [Saccharomyces cerevisiae EC1118]
 gi|323335830|gb|EGA77109.1| Oca2p [Saccharomyces cerevisiae Vin13]
          Length = 197

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 67/166 (40%), Gaps = 13/166 (7%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV     +YRS  P      ++K +  +K+I+ +     +   +E +       I+
Sbjct: 8   NFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIK 65

Query: 101 LINFPLSATRE--LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + ++R+  + +   + L  +L     P+L+H   G  R G+   +   ++  +  
Sbjct: 66  YYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWST 125

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLY---PNNVSKGDTE 201
              +++    YG F       +D+ F  + +     P NV  G  +
Sbjct: 126 AGIYQE----YGLFSGGMKDGVDLEFITMFETNLKIPRNVIPGFAK 167


>gi|50290417|ref|XP_447640.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526950|emb|CAG60577.1| unnamed protein product [Candida glabrata]
          Length = 530

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 61/190 (32%), Gaps = 17/190 (8%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--- 63
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +   +   
Sbjct: 142 QDVVYGVWRAKEKGLIDLHSFNLETYERYEHVENGDFNVLTPDFIAFASPQEDPKVLSSG 201

Query: 64  ---------EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                    +  +      +  N+   +  + H   +K   D+GIQ ++         + 
Sbjct: 202 TLTPKSHLNQPFRSVLNFFANNNVHLVVRLNSHLYNKKHFEDVGIQHLDLIFEDGTCPDM 261

Query: 115 EQIKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYG 170
             +K        +      + +HCK+G  RTG     +L     +   E    L     G
Sbjct: 262 SIVKNFVGAAETIIRRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPG 321

Query: 171 HFPVLKTITM 180
                +   +
Sbjct: 322 MVVGPQQHWL 331


>gi|328772409|gb|EGF82447.1| hypothetical protein BATDEDRAFT_9641 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 170

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 56/147 (38%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P+ IYRS  PN     +L K  G+KS++ +     + + +E         + + 
Sbjct: 14  NFAMVEPN-IYRSGYPNKKNFPFLLK-LGLKSVMYI---CEDDYTQETLDFWRINNVCVF 68

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  ++  +E        +    L+ +L    +P+L+HC  G  R G        +   + 
Sbjct: 69  HMRIAGNKEPFGEIEQKDIADALLKVLDEKNQPILLHCNKGKHRVGCLIGCLRKL-QKWS 127

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                  +   Y  F   KT   D  F
Sbjct: 128 ----MASIFDEYRRFAGTKTHIADQEF 150


>gi|213401215|ref|XP_002171380.1| Cdc14-related protein phosphatase Clp1/Flp1 [Schizosaccharomyces
           japonicus yFS275]
 gi|211999427|gb|EEB05087.1| Cdc14-related protein phosphatase Clp1/Flp1 [Schizosaccharomyces
           japonicus yFS275]
          Length = 557

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/203 (12%), Positives = 61/203 (30%), Gaps = 15/203 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           +  +   +      +L +  + +  Y         +F+ + P +    A P      +  
Sbjct: 147 QDCVYGVWRARECAILNIRNIDVQDYETHERVENGDFNWITP-KFIAFASPIQAGWGHNG 205

Query: 68  KEYG-----------IKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
            +               +  N+R  +  +    +++      IQ  +         +   
Sbjct: 206 TQAKKLPQSFAIVLDYFTKNNVRLVVRLNGPLYDKREFERCDIQHRDMYFEDGTVPDLSM 265

Query: 117 IKQLISILKTAP--KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
           +K+ I + ++      + +HCK+G  RTG     YL     +   E    + +   G   
Sbjct: 266 VKEFIDLTESVEPDGVIAVHCKAGLGRTGCLIGAYLMYKYPFTANEVIAFMRIMRPGMVV 325

Query: 174 VLKTITMDITFEKITQLYPNNVS 196
             +   + I        Y   + 
Sbjct: 326 GPQQHWLHINQAHFRAYYFEKLM 348


>gi|149369956|ref|ZP_01889807.1| hypothetical protein SCB49_02744 [unidentified eubacterium SCB49]
 gi|149356447|gb|EDM45003.1| hypothetical protein SCB49_02744 [unidentified eubacterium SCB49]
          Length = 186

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 76/166 (45%), Gaps = 12/166 (7%)

Query: 2   IKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGT 61
           +  K  + + +     +  G      ++        +    N   +    +YRS QP+  
Sbjct: 1   MDFKMNKTHYIFILALLSFGFSFAQDMNS---KKFESRDFNNLFQIN-DSLYRSDQPSKK 56

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
             +   ++YG K+I+N R        +++++ A D  ++L++ P+   +    + I+ L 
Sbjct: 57  AFKE-LEDYGFKTIINFRR------FRDDKRKARDTNLKLVHLPMQTAKVTETDIIEAL- 108

Query: 122 SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM 167
             LK A KP+LIHC  G+DRTG+  A Y  +  ++ KE A  +  +
Sbjct: 109 KALKDAKKPVLIHCWHGSDRTGVVIASYRIVFENWTKEAAISEFRI 154


>gi|238478343|ref|NP_001154304.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|332189657|gb|AEE27778.1| putative tyrosine-protein phosphatase [Arabidopsis thaliana]
          Length = 247

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/182 (19%), Positives = 55/182 (30%), Gaps = 47/182 (25%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        +  G++SI+ L    PE + +   +     GI+L 
Sbjct: 58  NFSMVDNG-IFRSGFPDSANF-SFLQTLGLRSIIYL---CPEPYPESNLQFLKSNGIRLF 112

Query: 103 NFPLSATRE-------------------------------------LNDEQIKQLISILK 125
            F +   +                                       + +    L  +L 
Sbjct: 113 QFGIEGNKCVPDLDNEISLHLWNSKHQKQGPLTNGLSKTLEPFVNIPDHKIRMALKVLLD 172

Query: 126 TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFE 185
               P+LIHCK G  RTG        +   +        +   Y  F   K    D  F 
Sbjct: 173 EKNHPVLIHCKRGKHRTGCLVGCLRKL-QKWC----LTSIFDEYQRFAAAKARVSDQRFM 227

Query: 186 KI 187
           +I
Sbjct: 228 EI 229


>gi|332880031|ref|ZP_08447715.1| hypothetical protein HMPREF9074_03481 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332682027|gb|EGJ54940.1| hypothetical protein HMPREF9074_03481 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 183

 Score = 92.5 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 77/174 (44%), Gaps = 7/174 (4%)

Query: 19  LLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL 78
           +   + L     G    T+     N + V    +YRS Q      + + K   IKSI+NL
Sbjct: 8   VYLFVCLIPSLWGQQPATLVNAEANLYKVDE-LLYRSEQLVSED-KAIIKRIPIKSIINL 65

Query: 79  RGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKS 137
           R         + +  A   G++LIN PL   R    E  + L  I +      +L+HC  
Sbjct: 66  RYFTRSG---DRKLFAPSEGVKLINHPLLTWRIKAPEIAQTLKLIRQHQQEGAVLLHCYH 122

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQL 190
           GADRTG+  A+Y  I  ++  ++A  ++ +  YG+  V K +    T + + ++
Sbjct: 123 GADRTGIMVAMYRIIYQNWSIKDAKHEMLNGPYGYHSVWKNLEALFTEQTVAEV 176


>gi|6324272|ref|NP_014342.1| Oca2p [Saccharomyces cerevisiae S288c]
 gi|1730735|sp|P53949|OCA2_YEAST RecName: Full=Tyrosine-protein phosphatase-like protein OCA2;
           AltName: Full=Oxidant-induced cell-cycle arrest protein
           2
 gi|1301927|emb|CAA95929.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|1314218|gb|AAA99655.1| Ynl2439p [Saccharomyces cerevisiae]
 gi|285814594|tpg|DAA10488.1| TPA: Oca2p [Saccharomyces cerevisiae S288c]
          Length = 197

 Score = 92.5 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 66/166 (39%), Gaps = 13/166 (7%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV     +YRS  P      ++K +  +K+I+ +     +   +E +       I+
Sbjct: 8   NFSPVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIK 65

Query: 101 LINFPLSATRE--LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + ++R+  + +   + L  +L     P+L+H   G  R G+   +   ++  +  
Sbjct: 66  YYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWST 125

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLY---PNNVSKGDTE 201
               ++    YG F       +D+ F  + +     P NV  G  +
Sbjct: 126 AGICQE----YGLFSGGMKDGVDLEFITMFETNLKIPRNVIPGFAK 167


>gi|150024972|ref|YP_001295798.1| hypothetical protein FP0882 [Flavobacterium psychrophilum JIP02/86]
 gi|149771513|emb|CAL42982.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86]
          Length = 193

 Score = 92.5 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 13/141 (9%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR----------GKLP 83
           ++       NF  +   ++Y+S       IE   K+Y IKSI++LR           ++P
Sbjct: 23  YVYDMNINHNFETITEGKVYKSGVIPPDEIESYVKKYNIKSIVDLRFPGTTDLVNNPEIP 82

Query: 84  ESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKT-APKPLLIHCKSGADRT 142
                E+E  A   G+    F   + +    E +K  + I+   +  P+LIHC  G  R 
Sbjct: 83  TELTAEKEAIAKIKGVNY--FNNGSDQVPTPENVKTFLKIMDNKSNYPVLIHCYHGIGRA 140

Query: 143 GLASAVYLYIVAHYPKEEAHR 163
            L SA+Y     ++  ++A  
Sbjct: 141 ELYSAIYRIEYENFTNKDARN 161


>gi|302308055|ref|NP_984836.2| AEL025Wp [Ashbya gossypii ATCC 10895]
 gi|299789274|gb|AAS52660.2| AEL025Wp [Ashbya gossypii ATCC 10895]
          Length = 536

 Score = 92.5 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/194 (14%), Positives = 58/194 (29%), Gaps = 28/194 (14%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIY-------------- 53
           +  +   +     G++ L    L +Y         +F+ + P  I               
Sbjct: 142 QDVVYGIWRAKETGLVDLNTFRLEVYEKYERVENGDFNVLTPDFIAFASPEEDMRRPYVS 201

Query: 54  ---RSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATR 110
              R  QP    +    K+  ++ ++ L        H    +   D+GI+ ++       
Sbjct: 202 GRTRLNQPF-KRVLEFFKDNNVQLVVRLNS------HLYRAQHFEDVGIKHLDMIFEDGT 254

Query: 111 ELNDEQIKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM 167
             +   +K        +      + +HCK+G  RTG     +L     +   E    L  
Sbjct: 255 CPDLSIVKNFVGAAETIINQGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRF 314

Query: 168 -LYGHFPVLKTITM 180
              G     +   +
Sbjct: 315 IRPGMVVGPQQHWI 328


>gi|297832916|ref|XP_002884340.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297330180|gb|EFH60599.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 203

 Score = 92.1 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 46/127 (36%), Gaps = 11/127 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  P         K   +++I+ L    PE + +E  +      I+L 
Sbjct: 20  NFSMVEDG-IYRSGFPRPENF-SFLKTLNLRAIIYL---CPEPYPEENLQFLEANNIKLY 74

Query: 103 NFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +    +       D  +  L  ++     P+LIHCK G  RTG         V  + 
Sbjct: 75  QFGIEGKTDPPTLMPKDTVLDALRVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQSWC 133

Query: 158 KEEAHRQ 164
                 +
Sbjct: 134 LSSVLEE 140


>gi|325520902|gb|EGC99881.1| protein tyrosine/serine phosphatase [Burkholderia sp. TJI49]
          Length = 195

 Score = 92.1 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/137 (24%), Positives = 65/137 (47%), Gaps = 10/137 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N + + P  +YRSAQ + + +    ++ GI+ +++ R          ++       I +
Sbjct: 47  NNLYRITP-SLYRSAQLSRSDV-PQLEKLGIRKVISFR------AFHSDDSILAGTQITM 98

Query: 102 INFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           +  P++     + + +  L  +       P+LIHC+ GADRTGL SA+   +   + +E+
Sbjct: 99  LRIPINTWHIRDRDMVAALKVLRTADQDGPVLIHCQHGADRTGLVSALCRVVYQGWTREQ 158

Query: 161 AHRQL-SMLYGHFPVLK 176
           A  +L    YG  PV +
Sbjct: 159 ALDELQHGGYGFHPVWR 175


>gi|332878283|ref|ZP_08446009.1| hypothetical protein HMPREF9074_01748 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332683734|gb|EGJ56605.1| hypothetical protein HMPREF9074_01748 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 181

 Score = 92.1 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/150 (27%), Positives = 61/150 (40%), Gaps = 13/150 (8%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
           YRS Q      + + K   IK+I+NLR        K+ ++     GI LIN PL   R  
Sbjct: 41  YRSEQLVKAN-KEVIKRTPIKTIINLRYFTRS---KDRKEFYFTDGITLINHPLLTWRIT 96

Query: 113 NDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
             +  + L  I K      +LIHC  GADRTG+  A+Y  I   +    A +++      
Sbjct: 97  LKDIAQVLQRIRKAQQQGAVLIHCYHGADRTGIMVAMYRIIYHGWSIAAAKKEMLQG--- 153

Query: 172 FPVLKTITMDITFEKITQLYPNNVSKGDTE 201
                T      ++ +  L+     K   E
Sbjct: 154 -----TYAYHSIWKNLEALFTEETVKEVRE 178


>gi|325265784|ref|ZP_08132471.1| protein tyrosine/serine phosphatase [Kingella denitrificans ATCC
           33394]
 gi|324982767|gb|EGC18392.1| protein tyrosine/serine phosphatase [Kingella denitrificans ATCC
           33394]
          Length = 193

 Score = 92.1 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 7/153 (4%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N H V   ++YRS QP    I  +     I++I+NLR        +  +  A +  I+L+
Sbjct: 40  NLHRV-DDKLYRSEQPIADDIAAINAAQ-IRTIVNLRYFNRN---RNNDLFAQNPHIRLV 94

Query: 103 NFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL   R    +    L  I +      +L+HC  GADRTG+  A Y  I  ++   +A
Sbjct: 95  NQPLLTWRVRPKDLAAALYQIEQGQKHGAVLVHCYHGADRTGIVIAFYRMIYQNWTLADA 154

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQLYPN 193
             ++    +G+  V K +    T E + ++   
Sbjct: 155 KAEMLQGGFGYHSVWKNLENLFTEETLAEVKTE 187


>gi|118346381|ref|XP_977224.1| Protein-tyrosine phosphatase containing protein [Tetrahymena
           thermophila]
 gi|89288436|gb|EAR86424.1| Protein-tyrosine phosphatase containing protein [Tetrahymena
           thermophila SB210]
          Length = 520

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 62/204 (30%), Gaps = 25/204 (12%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             +        LG   L    L  Y+        +   ++P + +    P          
Sbjct: 135 DCMRSLQKAQQLGWFDLKTFDLERYY---ELMKYDISEIIPKKFFAFRGPRDETDDLTLP 191

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
            +      K+ G++ ++ L             +   D  I  I+               Q
Sbjct: 192 PSAYIEPFKKEGVQLVVRLNNSDS-----YNPQPFVDNKINHIDLFFEDGSIPPRNIANQ 246

Query: 120 L-----ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
                  ++ + +  P+ +HC++G  RTG   A+Y      +  EE      M       
Sbjct: 247 FFALSERALEEKSNCPIAVHCRAGLGRTGTLIALYCIKHYKFTAEEIIAYTRMARPGSIH 306

Query: 175 LKTITMDITFEKITQL---YPNNV 195
              +    +++K  Q+   Y NN+
Sbjct: 307 GPQMMYLQSYDKSIQMQRSYSNNI 330


>gi|330806771|ref|YP_004351233.1| hypothetical protein PSEBR_a100 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374879|gb|AEA66229.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 226

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 76/169 (44%), Gaps = 18/169 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRS+ P+G  +  L  +  I +++    +  + W           GI+ +
Sbjct: 45  NLYQMSP-TLYRSSLPDGAAL-PLLTKLRIGTVITFLPESDKRWLST-------PGIEQV 95

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             P       + + ++ L ++    A  P+L+HCK G+DRTGL +A+Y  +V  + KE+A
Sbjct: 96  QLPYRTNHVDDSDILRALRAVQAAEAKGPVLMHCKHGSDRTGLVAAMYRVVVQGWSKEDA 155

Query: 162 HRQLSM-LYG---HFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
             +++   +G   HF       M    +K+     N    GD    + A
Sbjct: 156 LNEMTEGGFGDSHHFKDGVRYMMQADVDKLRVALAN----GDCSTSVFA 200


>gi|302922966|ref|XP_003053576.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256734517|gb|EEU47863.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 621

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 55/211 (26%), Gaps = 43/211 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +         L    L  Y         +F+ + PH + + S Q         
Sbjct: 173 QDVVYGVWKAKEEKCCDLDNFDLEQYEKFERVEHGDFNWITPHFLAFASPQHEPVAKITE 232

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +     E  I  ++ L   L    +        
Sbjct: 233 DDEMFPFLPRTLTAVDEHPTLPKPFKNVLTHFSEKNIGLVVRLNSALYSPSY------FE 286

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            LGIQ ++         +   +++ I +         K + +HCK+G  RTG     YL 
Sbjct: 287 ALGIQHLDMIFDDGTCPSLVTVRKFIRLAHETITIKKKGIAVHCKAGLGRTGCLIGAYLI 346

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
               +   E    +     G     +   + 
Sbjct: 347 YRHGFTANEVISFMRFMRPGMVVGPQQHWLH 377


>gi|207345631|gb|EDZ72391.1| YFR028Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|323305124|gb|EGA58874.1| Cdc14p [Saccharomyces cerevisiae FostersB]
 gi|323355198|gb|EGA87025.1| Cdc14p [Saccharomyces cerevisiae VL3]
          Length = 498

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 62/188 (32%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +       
Sbjct: 89  QDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLA 148

Query: 61  ---TFIEYLKKE-YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
              + +    K      +  N++  +  + H   +K   D+GIQ ++         +   
Sbjct: 149 TKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSI 208

Query: 117 IKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
           +K        +      + +HCK+G  RTG     +L     +   E    L     G  
Sbjct: 209 VKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 268

Query: 173 PVLKTITM 180
              +   +
Sbjct: 269 VGPQQHWL 276


>gi|71019627|ref|XP_760044.1| hypothetical protein UM03897.1 [Ustilago maydis 521]
 gi|74701239|sp|Q4P7L6|OCA1_USTMA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|46099837|gb|EAK85070.1| hypothetical protein UM03897.1 [Ustilago maydis 521]
          Length = 158

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 65/162 (40%), Gaps = 17/162 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N+  V  +  YRS QP+        ++ G+KS++ L  + PE    +      D  I+L
Sbjct: 6   PNYGMVEEN-FYRSGQPDQLNF-PFLEKLGLKSVIWLAPEEPEPGFLD---FCVDQNIEL 60

Query: 102 INFPL----SATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            +  +    +A   + +E + Q + +L + A  P+L+ C  G  RTG     +  +   +
Sbjct: 61  HHLGVLYSTNAWDPITEEVVLQALHLLVQPATYPVLVMCNLGRHRTGTVVGCFRKL-QRW 119

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
                  +    Y  F   +   +    E+  +L+   +  G
Sbjct: 120 NLSAILEE----YRRFVGGQKYRI--LNEQFIELFDEELVFG 155


>gi|260944298|ref|XP_002616447.1| hypothetical protein CLUG_03688 [Clavispora lusitaniae ATCC 42720]
 gi|238850096|gb|EEQ39560.1| hypothetical protein CLUG_03688 [Clavispora lusitaniae ATCC 42720]
          Length = 458

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/183 (15%), Positives = 59/183 (32%), Gaps = 11/183 (6%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQ-----PNGT 61
           +  +   +      ++ L   +L  Y         +F+ +    I + S Q     P   
Sbjct: 41  QDIVYAMWRAKERDMVDLTNFNLEEYEQYERVDQGDFNVISKDFIAFASPQQNLRKPGVL 100

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
             E  KK        +++  +  + H  +       GIQ I+           + +K+ I
Sbjct: 101 N-EPFKKVLSFFKANDVQLVVRLNSHLYDATEFTKRGIQHIDMIFEDGTCPTLDYVKKFI 159

Query: 122 ---SILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKT 177
                + +    + +HCK+G  RTG     +L     +   E    +  +  G     + 
Sbjct: 160 GAAECIISRGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMIRPGMVVGPQQ 219

Query: 178 ITM 180
             +
Sbjct: 220 HWL 222


>gi|323337794|gb|EGA79037.1| Cdc14p [Saccharomyces cerevisiae Vin13]
          Length = 498

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 62/188 (32%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +       
Sbjct: 89  QDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLA 148

Query: 61  ---TFIEYLKKE-YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
              + +    K      +  N++  +  + H   +K   D+GIQ ++         +   
Sbjct: 149 TKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSI 208

Query: 117 IKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
           +K        +      + +HCK+G  RTG     +L     +   E    L     G  
Sbjct: 209 VKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 268

Query: 173 PVLKTITM 180
              +   +
Sbjct: 269 VGPQQHWL 276


>gi|51012717|gb|AAT92652.1| YNL056W [Saccharomyces cerevisiae]
          Length = 197

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 67/166 (40%), Gaps = 13/166 (7%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF +VV     +YRS  P      ++K +  +K+I+ +     +   +E +       I+
Sbjct: 8   NFSSVVSTDVSLYRSGYPMPLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIK 65

Query: 101 LINFPLSATRE--LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + ++R+  + +   + L  +L     P+L+H   G  R G+   +   ++  +  
Sbjct: 66  YYHIFMDSSRDEGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWST 125

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLY---PNNVSKGDTE 201
               ++    YG F       +D+ F  + +     P NV  G  +
Sbjct: 126 AGICQE----YGLFSGGMKDGVDLEFITMFETNLKIPRNVIPGFAK 167


>gi|224128928|ref|XP_002329001.1| predicted protein [Populus trichocarpa]
 gi|222839235|gb|EEE77586.1| predicted protein [Populus trichocarpa]
          Length = 202

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 55/149 (36%), Gaps = 16/149 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    I+RS  P  +      +   ++SI+ L    PE++ +E     +   I+L
Sbjct: 19  TNFSMVEDG-IFRSGLPQPSNF-GFLETLNLRSIIYL---CPEAYPQENMDFVDAHDIKL 73

Query: 102 INFPLS------ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
             F +       +T   N      L  ++     P+LIHCK G  RTG     +  +   
Sbjct: 74  FQFGIEGKTESSSTSIPNHTITGALKVLIDVRNHPVLIHCKRGKHRTGCLVGCFRKLQT- 132

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITF 184
                    +   Y  F  +K    D+ F
Sbjct: 133 ----WCLSSVFEEYQRFAGVKWRATDLRF 157


>gi|154296236|ref|XP_001548550.1| hypothetical protein BC1G_12945 [Botryotinia fuckeliana B05.10]
 gi|150843509|gb|EDN18702.1| hypothetical protein BC1G_12945 [Botryotinia fuckeliana B05.10]
          Length = 517

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/211 (12%), Positives = 55/211 (26%), Gaps = 43/211 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G   L    L  Y         +F+ + P  + + S Q +       
Sbjct: 206 QDVVYGVWRAKEQGFCALPQFDLEEYERYERVDQGDFNWLTPDFLAFASPQHHPVQPILP 265

Query: 61  -------------------------TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
                                      +        I  ++ L  +L             
Sbjct: 266 SSPLYASLPTTLEDVDTHPTLPTPFKNVLKHFTSRNIGLVVRLNSELYSPSF------FT 319

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTA----PKPLLIHCKSGADRTGLASAVYLY 151
            LGI+ ++             +++ I++         + + +HCK+G  RTG     YL 
Sbjct: 320 ALGIEHLDMIFDDGTCPPLSVVRKFITLAHEMITVQKRGIAVHCKAGLGRTGCLIGAYLI 379

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVLKTITMD 181
               +   E    +     G     +   + 
Sbjct: 380 YRYGFTANEIIAYMRFMRPGMVVGPQQHWLH 410


>gi|170111675|ref|XP_001887041.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164638084|gb|EDR02364.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 322

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/208 (14%), Positives = 60/208 (28%), Gaps = 37/208 (17%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSA------ 56
               +  L   +  +  G+  +   S+  Y         +++ + PH I + S       
Sbjct: 111 NLNIQDCLWGMWKAMQNGLCDMNEFSVEDYEFYEKVENGDWNWLTPHFIAFASPVDTNWI 170

Query: 57  -------------------QPNGT-FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
                               P          ++  IK ++ L  +        +     D
Sbjct: 171 KRDKEAKEGKTNLSALQRKLPTPFLNCLDYFEKRNIKLVVRLNTE------LYDRNTFLD 224

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGLASAVYLYIV 153
            GI  +           DE ++  I +      A   + +HCK+G  RTG     Y+   
Sbjct: 225 RGIDHMELYFDDGTNPTDEIVRTFIDVADRVIEAGGVVAVHCKAGLGRTGTLIGAYMIWK 284

Query: 154 AHYPKEEAHRQLS-MLYGHFPVLKTITM 180
             +   EA   +  +  G     +   M
Sbjct: 285 YGFTANEAIAFMRIIRPGSVVGPQQQYM 312


>gi|323454228|gb|EGB10098.1| dual specificity protein phosphatase-like protein CDC14A
           [Aureococcus anophagefferens]
          Length = 398

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 27/189 (14%), Positives = 59/189 (31%), Gaps = 21/189 (11%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNF------HAVVPHEIYRSAQPNGTF 62
             L      + LG L         Y         +         + P  ++  A      
Sbjct: 150 DVLRGVAKALALGHLDYATFDCDEYDRMERLEHGDLAPLARRREIAPG-VHTFA---PED 205

Query: 63  IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
              L +  G+  ++    K        +++A    GI+ +          +++ +++ I 
Sbjct: 206 YVPLFQRLGVTCVVRFNKK------LYDKRAFTRAGIRHVELFYEDGGNPSEQIMQRFIQ 259

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM- 180
           + +  P  + +HCK+G  RTG     Y+     Y   E    + +   G     +   + 
Sbjct: 260 VCEQEPGAIAVHCKAGLGRTGTNIGAYMMKHWGYSATECMGWMRVCRPGSVIGPQQQFIL 319

Query: 181 ---DITFEK 186
              D  + +
Sbjct: 320 DAEDRLWRE 328


>gi|269122994|ref|YP_003305571.1| protein tyrosine/serine phosphatase [Streptobacillus moniliformis
           DSM 12112]
 gi|268314320|gb|ACZ00694.1| protein tyrosine/serine phosphatase [Streptobacillus moniliformis
           DSM 12112]
          Length = 189

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 44/166 (26%), Positives = 68/166 (40%), Gaps = 17/166 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +N + +    +YRS Q     +  +  E GIK+I+NLR         +++K   +  + L
Sbjct: 29  KNMYKI-DGGVYRSQQLESEDL-SIINELGIKTIINLRFFNR----DKDKKIFKETDLIL 82

Query: 102 INFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           IN PL        E  + L  I K      +L HC  G+DRTGL S +Y  I   Y  +E
Sbjct: 83  INNPLKTWNITPKEVAQILYDIEKSKENGAVLFHCYHGSDRTGLISGMYRIIYQDYEIDE 142

Query: 161 AHRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMN 205
           A  +L    YG             +  I +++  N       +  N
Sbjct: 143 ALLELVQGSYGFHK---------IWSNIPKMFNENTVTEIKNEIFN 179


>gi|190406600|gb|EDV09867.1| protein phosphatase [Saccharomyces cerevisiae RM11-1a]
          Length = 551

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 62/188 (32%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +       
Sbjct: 142 QDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLA 201

Query: 61  ---TFIEYLKKE-YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
              + +    K      +  N++  +  + H   +K   D+GIQ ++         +   
Sbjct: 202 TKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSI 261

Query: 117 IKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
           +K        +      + +HCK+G  RTG     +L     +   E    L     G  
Sbjct: 262 VKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 321

Query: 173 PVLKTITM 180
              +   +
Sbjct: 322 VGPQQHWL 329


>gi|151940789|gb|EDN59176.1| protein phosphatase [Saccharomyces cerevisiae YJM789]
 gi|256268813|gb|EEU04167.1| Cdc14p [Saccharomyces cerevisiae JAY291]
          Length = 551

 Score = 91.0 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 62/188 (32%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +       
Sbjct: 142 QDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLA 201

Query: 61  ---TFIEYLKKE-YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
              + +    K      +  N++  +  + H   +K   D+GIQ ++         +   
Sbjct: 202 TKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSI 261

Query: 117 IKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
           +K        +      + +HCK+G  RTG     +L     +   E    L     G  
Sbjct: 262 VKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 321

Query: 173 PVLKTITM 180
              +   +
Sbjct: 322 VGPQQHWL 329


>gi|310799951|gb|EFQ34844.1| tyrosine phosphatase [Glomerella graminicola M1.001]
          Length = 328

 Score = 91.0 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 50/142 (35%), Gaps = 12/142 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VVP  +YRS+ P         +  G+KSI+ L  K      +      +  GI+  
Sbjct: 135 NFGVVVPG-VYRSSYPKPEDF-GFIRNLGLKSIVTLVQKD--GVDEPYTAFMSGNGIRHH 190

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+            L  +L     PLLIHC  G  RTG    V    V  +   
Sbjct: 191 VFNMKGTKKEAIPIRTMKAILRLVLNREHHPLLIHCNHGKHRTGCVVGVVR-KVTGWELS 249

Query: 160 EAHRQLSMLYGHFPVLKTITMD 181
               +    Y  +   K    D
Sbjct: 250 PIVDE----YRSYAEPKIRDCD 267


>gi|14318551|ref|NP_116684.1| Cdc14p [Saccharomyces cerevisiae S288c]
 gi|1168807|sp|Q00684|CDC14_YEAST RecName: Full=Tyrosine-protein phosphatase CDC14
 gi|836783|dbj|BAA09267.1| cell division control protein 14 [Saccharomyces cerevisiae]
 gi|259146220|emb|CAY79479.1| Cdc14p [Saccharomyces cerevisiae EC1118]
 gi|285811923|tpg|DAA12468.1| TPA: Cdc14p [Saccharomyces cerevisiae S288c]
          Length = 551

 Score = 91.0 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 62/188 (32%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +       
Sbjct: 142 QDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLA 201

Query: 61  ---TFIEYLKKE-YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
              + +    K      +  N++  +  + H   +K   D+GIQ ++         +   
Sbjct: 202 TKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSI 261

Query: 117 IKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
           +K        +      + +HCK+G  RTG     +L     +   E    L     G  
Sbjct: 262 VKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 321

Query: 173 PVLKTITM 180
              +   +
Sbjct: 322 VGPQQHWL 329


>gi|870756|dbj|BAA09533.1| phosphoprotein phosphatase [Saccharomyces cerevisiae]
          Length = 551

 Score = 91.0 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 62/188 (32%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +       
Sbjct: 142 QDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLA 201

Query: 61  ---TFIEYLKKE-YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
              + +    K      +  N++  +  + H   +K   D+GIQ ++         +   
Sbjct: 202 TKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSI 261

Query: 117 IKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
           +K        +      + +HCK+G  RTG     +L     +   E    L     G  
Sbjct: 262 VKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 321

Query: 173 PVLKTITM 180
              +   +
Sbjct: 322 VGPQQHWL 329


>gi|148908507|gb|ABR17366.1| unknown [Picea sitchensis]
          Length = 416

 Score = 91.0 bits (224), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 36/147 (24%), Positives = 54/147 (36%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN        K   ++SI+ L    PE + +   K      IQ+ 
Sbjct: 271 NFAMVDKG-VYRSGFPNHANF-PFLKTLKLRSIIYL---CPEPYSEVNMKFLRAEEIQIF 325

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +   +E       D+    L  +L     P+LIHCK+G   T         I  ++ 
Sbjct: 326 QFGIIGYKEPIIGISEDDIRDALKILLDIRNHPVLIHCKTGKHPTSCLVGCLRKI-QNWC 384

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                  +   Y  F  +K    D+ F
Sbjct: 385 LAT----VFDEYQRFVGIKARVSDLQF 407


>gi|50553190|ref|XP_504005.1| YALI0E16038p [Yarrowia lipolytica]
 gi|49649874|emb|CAG79598.1| YALI0E16038p [Yarrowia lipolytica]
          Length = 564

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 56/192 (29%), Gaps = 22/192 (11%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI 63
           I   +  +   +     G L L   +L  Y         +F+ + PH I   A P     
Sbjct: 132 ILTIQDVVYGCWRAKEKGFLDLRHFNLDEYEQYEKVDQGDFNELPPHYI-AFASPQQEDF 190

Query: 64  EY-----------LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
                          + + ++ ++ L           + +     GI+ ++         
Sbjct: 191 LTPLDHAFNNVLDYFETHNVQLVVRLNSI------LYDARQFEQRGIKHVDMIFDDGTVP 244

Query: 113 NDEQIKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-L 168
             + +K+       +      + +HCK+G  RTG     +L     +   E    +    
Sbjct: 245 TMDMVKKFVGAAECIIEQGGKIAVHCKAGLGRTGCLIGAHLIYSYGFTAAECIAYMRFLR 304

Query: 169 YGHFPVLKTITM 180
            G     +   +
Sbjct: 305 PGMVVGPQQHWL 316


>gi|116199785|ref|XP_001225704.1| hypothetical protein CHGG_08048 [Chaetomium globosum CBS 148.51]
 gi|88179327|gb|EAQ86795.1| hypothetical protein CHGG_08048 [Chaetomium globosum CBS 148.51]
          Length = 306

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/156 (25%), Positives = 54/156 (34%), Gaps = 15/156 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VVP  +YRS+ P         +   +K+I+ L  K     +       +  GIQ  
Sbjct: 113 NFGIVVPG-VYRSSFPQAEDYA-FIQGLKLKTIVTLVHKEFPRGYDA---FLHRNGIQHA 167

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+            L  +L     PLLIHC  G  RTG    V   +   +   
Sbjct: 168 IFDMKGTKKESIPVATMESILRVVLDRRNHPLLIHCNHGKHRTGCVIGVIRKLS-GWNLS 226

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNV 195
               +    Y  +   K    D   E IT   P N 
Sbjct: 227 SIVNE----YKAYAEPKIRECD--IEYITGFEPINT 256


>gi|21553927|gb|AAM63010.1| unknown [Arabidopsis thaliana]
          Length = 204

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 46/128 (35%), Gaps = 11/128 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    IYRS  P             ++SI+ L    PE + ++  K+     I+L
Sbjct: 18  PNFSMVEDG-IYRSGFPELENF-GFLSTLNLRSIIYL---CPEPYPEDNLKSLASNNIKL 72

Query: 102 INFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F +    +      K      L  ++     P+LIHCK G  RTG         V ++
Sbjct: 73  FQFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQNW 131

Query: 157 PKEEAHRQ 164
                  +
Sbjct: 132 CLSSVLEE 139


>gi|297811789|ref|XP_002873778.1| hypothetical protein ARALYDRAFT_488502 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297319615|gb|EFH50037.1| hypothetical protein ARALYDRAFT_488502 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 203

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 46/128 (35%), Gaps = 11/128 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    IYRS  P             ++S++ L    PE + ++  K+     I+L
Sbjct: 17  PNFSMVEDG-IYRSGFPQLENF-GFLSTLNLRSVIYL---CPEPYPEDNLKSLQSNNIKL 71

Query: 102 INFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F +    +      K      L  ++     P+LIHCK G  RTG         V ++
Sbjct: 72  FQFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQNW 130

Query: 157 PKEEAHRQ 164
                  +
Sbjct: 131 CLSSVLEE 138


>gi|221103489|ref|XP_002154547.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 517

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/199 (17%), Positives = 54/199 (27%), Gaps = 22/199 (11%)

Query: 18  ILLGVLVLCAVSLGL--YFLTITTFTQNFHA----VVPHEIYRSAQPN----------GT 61
            L G+ + C +      Y       T NFH     +VP +      P             
Sbjct: 139 CLQGLYMGCKIQNWFSSYESIKYPQTTNFHLDMNLIVPGKYIAFKDPTINSSKKKVCVSK 198

Query: 62  FIEYLKKEYGIKSILNLRGKL-----PESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
            +    K  GIK+++ L G                             P       +  Q
Sbjct: 199 SVMNELKRCGIKAVVRLNGNDHLTNLEYYGPPYSSSEFKQEQFFHFEIPFEDAGVPSITQ 258

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVL 175
           I +   + K     + +HC +G  RT       L     +        L M   G     
Sbjct: 259 INEFEILCKRFAGKVAVHCHAGLGRTATMIGSILIKSYGFDSRAVCGWLKMCRRGSIMGS 318

Query: 176 KTITMDITFEKITQLYPNN 194
           +   +D   ++I   Y  N
Sbjct: 319 QHFFLDKFQKQIESKYSFN 337


>gi|242022864|ref|XP_002431858.1| dual specificity protein phosphatase CDC14, putative [Pediculus
           humanus corporis]
 gi|212517190|gb|EEB19120.1| dual specificity protein phosphatase CDC14, putative [Pediculus
           humanus corporis]
          Length = 865

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/193 (12%), Positives = 58/193 (30%), Gaps = 16/193 (8%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN----- 59
              +  L   +   + G       +             + + +VP +      P      
Sbjct: 177 INMKNCLDALHKASIFGFFNFNDFNTIECSHYENIEHGDLNWIVPQKFIAFPGPVEEKND 236

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                 F         +  ++ L     +  +  +        I+  +  +    +  + 
Sbjct: 237 YYHHPYFYIEYFLSNHVTDVVRLN----QRAYDAKCFTMF--NIRHHDLYMQDGADPPEG 290

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K  + I ++AP  + +HCK+G  RTG     YL        +EA   + +   G    
Sbjct: 291 ILKTFLKIAESAPGAIAVHCKAGLGRTGSLIGAYLLKHYRMTAKEAIAWIRICRPGSVIG 350

Query: 175 LKTITMDITFEKI 187
            +   ++   E +
Sbjct: 351 HQQTWLENHEESL 363


>gi|322699333|gb|EFY91095.1| tyrosine phosphatase [Metarhizium acridum CQMa 102]
          Length = 194

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 58/168 (34%), Gaps = 14/168 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS+ P     +      G+K+++ L  K       + +      GI+ +
Sbjct: 35  NFGVVFPG-VYRSSYPKPEDYD-FLGSLGLKTVVTLVKKDELDH--DLQSFLTTNGIRQV 90

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+            L  +L     PL++HC  G  RTG   A    +   +   
Sbjct: 91  IFNMKGTKKEAIPMSTMRSILELVLDQKNYPLMLHCNHGKHRTGCVVAAIRKLS-GWQLG 149

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
               +    Y  F   K    D   + I+      +       P+ +T
Sbjct: 150 AVLDE----YKAFAEPKVRECD--VDYISAFPCGPLQSLRVRPPLQST 191


>gi|323348793|gb|EGA83033.1| Cdc14p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 387

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 62/188 (32%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +       
Sbjct: 89  QDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLA 148

Query: 61  ---TFIEYLKKE-YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
              + +    K      +  N++  +  + H   +K   D+GIQ ++         +   
Sbjct: 149 TKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSI 208

Query: 117 IKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
           +K        +      + +HCK+G  RTG     +L     +   E    L     G  
Sbjct: 209 VKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 268

Query: 173 PVLKTITM 180
              +   +
Sbjct: 269 VGPQQHWL 276


>gi|255720308|ref|XP_002556434.1| KLTH0H13156p [Lachancea thermotolerans]
 gi|238942400|emb|CAR30572.1| KLTH0H13156p [Lachancea thermotolerans]
          Length = 505

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 60/187 (32%), Gaps = 14/187 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFIEYL 66
           +  +   +     G++ L    L  Y         +F+ + P  I   S + +       
Sbjct: 142 QDVVYGVWRAKERGLVNLNTFDLETYERYERVKNGDFNVLTPDFIALASPEEDAHHRTTA 201

Query: 67  KKEY---GIKSIL------NLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQI 117
            K +     +S+L      N++  +  + H   +K   DLG++ ++         +   +
Sbjct: 202 SKSHLNGPFRSVLKFFSENNVQLVVRLNSHLYNKKHFEDLGMKHVDLIFEDGSCPDMSIV 261

Query: 118 KQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFP 173
                    +      + +HCK+G  RTG     +L     +   E    L     G   
Sbjct: 262 HGFVGAAETIINEGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIGFLRFIRPGMVV 321

Query: 174 VLKTITM 180
             +   +
Sbjct: 322 GPQQHWL 328


>gi|328779714|ref|XP_396296.4| PREDICTED: dual specificity protein phosphatase CDC14A-like [Apis
           mellifera]
          Length = 521

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 53/187 (28%), Gaps = 16/187 (8%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
             L         G        +  Y           + +VP +      P+         
Sbjct: 202 DCLNALKKAASFGFFNFNDFDVVEYEKYEDMRNGALNWMVPQKFLAFVGPSTEPGTPYHP 261

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
                    +  + +++ L  K              ++GI   +  +          + +
Sbjct: 262 PECYIDYFLQNEVTAVVRLNKK------AYNASRFTEVGITHYDMFMPDGTVPPKRILNE 315

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
            +++ +    P+ +HCK+G  RTG   A +L         EA   + +   G     +  
Sbjct: 316 FLNLSENTSGPIAVHCKAGLGRTGSLIAAFLIKHYKMTAREAIAWIRICRPGSVIGHQQS 375

Query: 179 TMDITFE 185
            ++   +
Sbjct: 376 WLENIEK 382


>gi|254412857|ref|ZP_05026630.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196180592|gb|EDX75583.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 150

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/152 (25%), Positives = 68/152 (44%), Gaps = 5/152 (3%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N   +  +    + Q     +     + G+KS+LNLR +  E +  +E++ A   G+Q +
Sbjct: 3   NAKKINDNLTVATNQVTPEQL-QQAAQAGVKSVLNLRSREEEGFASDEKQQAEAAGLQYV 61

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           N P+     L +E + Q++  ++  PKP LIHCKSG  R+G+ + +Y+        E+A 
Sbjct: 62  NIPVKP-DALTEELVSQVLQQIEELPKPALIHCKSGL-RSGMMALMYVATREGMTAEQAM 119

Query: 163 RQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
                    F   K+  M   F+     +   
Sbjct: 120 E--KGKSMGFDCEKSPPMKEFFKTYISQHSKA 149


>gi|294464817|gb|ADE77914.1| unknown [Picea sitchensis]
          Length = 462

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/147 (23%), Positives = 53/147 (36%), Gaps = 15/147 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  PN        K   ++SI+ L    PE +     +      I+  
Sbjct: 317 NFAMVDKG-VYRSGFPNHANF-PFLKTLKLRSIIYL---CPEPYPGVNMEFLRAEEIRFF 371

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +F +   +E       D+    L  +L     P+LIHC++G   T         I  ++ 
Sbjct: 372 HFGIKEYKEPIMGISEDDVRDALKILLDIRNHPVLIHCRTGKRPTSCLVGCLRKI-QNWC 430

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITF 184
                  +   Y  F   KT   D+ F
Sbjct: 431 ----LASVFDEYQRFAGTKTQVSDLQF 453


>gi|15237359|ref|NP_197152.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|9759130|dbj|BAB09615.1| unnamed protein product [Arabidopsis thaliana]
 gi|107738251|gb|ABF83668.1| At5g16480 [Arabidopsis thaliana]
 gi|332004915|gb|AED92298.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
          Length = 204

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 47/128 (36%), Gaps = 11/128 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V   EIYRS  P             ++SI+ L    PE + ++  K+     I+L
Sbjct: 18  PNFSMV-EDEIYRSGFPELENF-GFLSTLNLRSIIYL---CPEPYPEDNLKSLASNNIKL 72

Query: 102 INFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             F +    +      K      L  ++     P+LIHCK G  RTG         V ++
Sbjct: 73  FQFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTGCLVGCLR-KVQNW 131

Query: 157 PKEEAHRQ 164
                  +
Sbjct: 132 CLSSVLEE 139


>gi|407518|emb|CAA52971.1| putative protein tyrosine phosphatase [Saccharomyces cerevisiae]
          Length = 326

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 62/188 (32%), Gaps = 15/188 (7%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNG------ 60
           +  +   +     G++ L + +L  Y         +F+ + P  I + S Q +       
Sbjct: 47  QDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLA 106

Query: 61  ---TFIEYLKKE-YGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
              + +    K      +  N++  +  + H   +K   D+GIQ ++         +   
Sbjct: 107 TKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSI 166

Query: 117 IKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHF 172
           +K        +      + +HCK+G  RTG     +L     +   E    L     G  
Sbjct: 167 VKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMV 226

Query: 173 PVLKTITM 180
              +   +
Sbjct: 227 VGPQQHWL 234


>gi|167045003|gb|ABZ09667.1| putative dual specificity phosphatase, catalytic domain protein
           [uncultured marine crenarchaeote HF4000_APKG8G15]
          Length = 164

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 55/148 (37%), Gaps = 7/148 (4%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  ++ +++  S  P          E GIKSI+ +R    E    +  K    L I   +
Sbjct: 22  FSWLIDNKLAGSGIPTSIDEVQWAIEQGIKSIVTVR---EEPLDDDWVKDIKYLHIMSND 78

Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
             +    +L          I  T  +P+++HC +G  RTG   A YL        ++A +
Sbjct: 79  MGVPEFVDLVSAVDFIHSRI--TNNEPVMVHCLAGLGRTGTLLACYLIKHQKMSADDAMQ 136

Query: 164 QLSMLY-GHF-PVLKTITMDITFEKITQ 189
           ++     G      +   +    + + +
Sbjct: 137 KVREERPGSIQSFPQEEIIFQFAKSLQR 164


>gi|257454910|ref|ZP_05620158.1| protein tyrosine/serine phosphatase [Enhydrobacter aerosaccus SK60]
 gi|257447620|gb|EEV22615.1| protein tyrosine/serine phosphatase [Enhydrobacter aerosaccus SK60]
          Length = 182

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 66/145 (45%), Gaps = 9/145 (6%)

Query: 34  FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA 93
           +  +     N + +   +++RS Q     I  + ++YGI +++NLR         + E+ 
Sbjct: 12  WAKLRCQHANLYQIDE-QLFRSEQLTPDDI-GIIQQYGINTLINLRFFDR----DDNEEN 65

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL--KTAPKPLLIHCKSGADRTGLASAVYLY 151
             +L +  IN PL        +  + L  IL  +     +L+HC  G+DRTG+  A+Y  
Sbjct: 66  LANLPLTFINHPLMTWAIKPQQLAEILYDILWHQARGDKVLVHCYHGSDRTGITVAMYRI 125

Query: 152 IVAHYPKEEAHRQLSM-LYGHFPVL 175
           +V ++  E A  ++    YG   + 
Sbjct: 126 LVQNWTIEHAKIEMQDGGYGFHWIW 150


>gi|119491367|ref|XP_001263238.1| protein-tyrosine phosphatase, putative [Neosartorya fischeri NRRL
           181]
 gi|119411398|gb|EAW21341.1| protein-tyrosine phosphatase, putative [Neosartorya fischeri NRRL
           181]
          Length = 613

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/221 (13%), Positives = 57/221 (25%), Gaps = 55/221 (24%)

Query: 31  GLYFLTITTFTQNFHAVVPHEI-YRSAQPNG----------------------------- 60
             Y         +F+ + P  + + S Q                                
Sbjct: 194 EEYEKFERVDMGDFNWITPQFLAFASPQHEPIAPIPSNTPEYAALPSTVSQVISSKLPLP 253

Query: 61  -TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
              +        +  ++ L  +L    +         LGI  I+             +++
Sbjct: 254 FKNVLAHFATRNVGLVVRLNSELYSPSY------FTALGINHIDMIFEDGTCPPLPLVRR 307

Query: 120 LISILKTA----PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            I +         K + +HCK+G  RTG     YL     +   E    +     G    
Sbjct: 308 FIKMAHEMITVKNKGIAVHCKAGLGRTGCLIGAYLIYRYGFTANEIIAFMRFMRPGMVVG 367

Query: 175 LKTITM-------------DITFEKITQLYPNNVSKGDTEQ 202
            +   +             D   EK+ Q+ P  ++ G    
Sbjct: 368 PQQHWLHLNQGSFREWWFEDSMKEKLAQMQPAPITPGRAST 408


>gi|194364100|ref|YP_002026710.1| hypothetical protein Smal_0322 [Stenotrophomonas maltophilia
           R551-3]
 gi|194346904|gb|ACF50027.1| protein of unknown function DUF442 [Stenotrophomonas maltophilia
           R551-3]
          Length = 166

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 4/120 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
            + V P  +Y   QP+ T ++ L  + G++++++LR    +     E + A  LG++ + 
Sbjct: 26  LNEVRPG-LYAGGQPSATQLQALAAQ-GVRTVIDLRQPDEDRGFD-ETRVAESLGLRYVR 82

Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
            P++    L+   I+ +   L+ +  P+L+HC SG +R G    +      H   E+A +
Sbjct: 83  IPVAGADGLDAANIRAVHQALQQSQGPVLLHCASG-NRAGAVLGLINARYEHASPEQALQ 141


>gi|58266070|ref|XP_570191.1| protein-tyrosine-phosphatase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57226424|gb|AAW42884.1| protein-tyrosine-phosphatase, putative [Cryptococcus neoformans
           var. neoformans JEC21]
          Length = 212

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 60/160 (37%), Gaps = 16/160 (10%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA----ANDLGI 99
           F  V P  +YRSA P  + +        +K+I++L  + P     +  +        LG+
Sbjct: 17  FSIVEPG-VYRSASPTPSQV-PFLAGLNLKTIISLTPEHPIKPLLQFVRTTGISFVHLGL 74

Query: 100 QLINFPLSATRELNDEQIKQLIS--ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
                P +  R +  E IK  +   IL T   P+L+    G  +TG        +   + 
Sbjct: 75  THWRRPGTDWRPVRYEIIKTALEAYILDTRAHPVLLIDPLGVHQTGCLVGALRMM-QGWN 133

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
              A  +    Y      K   +D   E+  +L+ +++  
Sbjct: 134 FASALME----YRAHAGSKHRYVD---EQYIELFDSDLIN 166


>gi|322704326|gb|EFY95922.1| tyrosine phosphatase [Metarhizium anisopliae ARSEF 23]
          Length = 365

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/142 (23%), Positives = 52/142 (36%), Gaps = 12/142 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  +YRS+ P     +      G+K+++ L  K     H  E   A   GI+ +
Sbjct: 204 NFGVVFPG-VYRSSYPKPEGYD-FLGSLGLKTVVTLVKKDE-PDHDLESFLAT-NGIRQV 259

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            F +  T+            L  +L     PLL+HC  G  RTG   A    +   +  +
Sbjct: 260 IFNMKGTKKEAIPMSTMRSILELVLDQKNYPLLLHCNHGKHRTGCVVAAIRKLS-GWQLD 318

Query: 160 EAHRQLSMLYGHFPVLKTITMD 181
               +    Y  +   K    D
Sbjct: 319 AVVDE----YRAYAEPKVRECD 336


>gi|50310437|ref|XP_455238.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644374|emb|CAG97946.1| KLLA0F03487p [Kluyveromyces lactis]
          Length = 180

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 53/132 (40%), Gaps = 9/132 (6%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE 111
           +YRS  P      ++K +  +K+++ +     +    E +    +  I+  + P+ +T++
Sbjct: 19  LYRSGYPMPLNYSFIKHQLHLKTVIYV---GDKDILPEYKAFLEEESIKFHHIPMKSTKD 75

Query: 112 LN--DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY 169
                E    L  +L     P+L+H   G  R G+   +   ++  +     +++    Y
Sbjct: 76  PEIQKEMETVLKLVLDVNNYPILVHSNKGKHRVGVVVGIIRKLLLGWSMTGIYQE----Y 131

Query: 170 GHFPVLKTITMD 181
             F   +   +D
Sbjct: 132 DLFTGGQKGDID 143


>gi|134110776|ref|XP_775852.1| hypothetical protein CNBD2610 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258518|gb|EAL21205.1| hypothetical protein CNBD2610 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 212

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 60/160 (37%), Gaps = 16/160 (10%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA----ANDLGI 99
           F  V P  +YRSA P  + +        +K+I++L  + P     +  +        LG+
Sbjct: 17  FSIVEPG-VYRSASPTPSQV-PFLAGLNLKTIISLTPEHPIKPLLQFVRTTGISFVHLGL 74

Query: 100 QLINFPLSATRELNDEQIKQLIS--ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
                P +  R +  E IK  +   IL T   P+L+    G  +TG        +   + 
Sbjct: 75  THWRRPGTDWRPVRYEIIKTALEAYILDTRAHPVLLIDPLGVHQTGCLVGALRMM-QGWN 133

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
              A  +    Y      K   +D   E+  +L+ +++  
Sbjct: 134 FASALME----YRAHAGSKHRYVD---EQYIELFDSDLIN 166


>gi|19115628|ref|NP_594716.1| Cdc14-related protein phosphatase Clp1/Flp1 [Schizosaccharomyces
           pombe 972h-]
 gi|26393807|sp|Q9P7H1|FLP1_SCHPO RecName: Full=Tyrosine-protein phosphatase CDC14 homolog; AltName:
           Full=CDC fourteen-like phosphatase 1
 gi|7160233|emb|CAB76271.1| Cdc14-related protein phosphatase Clp1/Flp1 [Schizosaccharomyces
           pombe]
          Length = 537

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 64/220 (29%), Gaps = 28/220 (12%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP--------- 58
           +  +   +      +L +  + +  Y         +F+ + P +    A P         
Sbjct: 147 QDCVYGLWRARESSILNIRNIDVHDYETYERVENGDFNWISP-KFIAFASPIQAGWNHAS 205

Query: 59  -NGTFIEYLKK-------EYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATR 110
                +               +K I+ L G         ++K   ++GI+          
Sbjct: 206 TRPKKLPQPFAIVLDYFVANKVKLIVRLNGP------LYDKKTFENVGIRHKEMYFEDGT 259

Query: 111 ELNDEQIKQLISILKTAP--KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM- 167
                 +K+ I + +       + +HCK+G  RTG     YL     +   E    + + 
Sbjct: 260 VPELSLVKEFIDLTEEVEEDGVIAVHCKAGLGRTGCLIGAYLIYKHCFTANEVIAYMRIM 319

Query: 168 LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT 207
             G     +   +    +   + Y    + G   Q   A 
Sbjct: 320 RPGMVVGPQQHWL-HINQVHFRAYFYEKAMGRAIQQATAA 358


>gi|70999354|ref|XP_754396.1| protein-tyrosine phosphatase [Aspergillus fumigatus Af293]
 gi|66852033|gb|EAL92358.1| protein-tyrosine phosphatase, putative [Aspergillus fumigatus
           Af293]
 gi|159127412|gb|EDP52527.1| protein-tyrosine phosphatase, putative [Aspergillus fumigatus
           A1163]
          Length = 613

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/218 (13%), Positives = 57/218 (26%), Gaps = 55/218 (25%)

Query: 31  GLYFLTITTFTQNFHAVVPHEI-YRSAQPNG----------------------------- 60
             Y         +F+ + P  + + S Q                                
Sbjct: 194 EEYEKFERVDMGDFNWITPQFLAFASPQHEPVALIPSNTPEYAALPSTVSQVISSKLPLP 253

Query: 61  -TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
              +        +  ++ L  +L    +         LGI  I+             +++
Sbjct: 254 FKNVLAHFATRNVGLVVRLNSELYSPSY------FTALGINHIDMIFEDGTCPPLPLVRR 307

Query: 120 LISILKTA----PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            I +         K + +HCK+G  RTG     YL     +   E    +     G    
Sbjct: 308 FIKMAHEMITVKNKGIAVHCKAGLGRTGCLIGAYLIYRYGFTANEIIAFMRFMRPGMVVG 367

Query: 175 LKTITM-------------DITFEKITQLYPNNVSKGD 199
            +   +             D   EK+ Q+ P  ++ G 
Sbjct: 368 PQQHWLHLNQGSFREWWFEDSMKEKLAQMQPAPITPGR 405


>gi|242219398|ref|XP_002475479.1| candidate tyrosine protein phosphatase [Postia placenta Mad-698-R]
 gi|220725338|gb|EED79330.1| candidate tyrosine protein phosphatase [Postia placenta Mad-698-R]
          Length = 649

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/189 (14%), Positives = 55/189 (29%), Gaps = 29/189 (15%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSA------ 56
               +  L   Y  +  G+  +    +  Y         +++ + P+ I + S       
Sbjct: 164 NLNIQDCLWGIYKAMQNGLCDMNEFDVEEYEYYEKVENGDWNWLTPNFIAFASGSPPSSP 223

Query: 57  ------------QPNGT-FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
                        P          ++  +K ++ L           + +   D GI    
Sbjct: 224 TRSQGEHALQRKLPTPFLNCLDYFEKQNVKLVVRLNNP------LYDRQVFMDRGINHYE 277

Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLI---HCKSGADRTGLASAVYLYIVAHYPKEE 160
                     DE +++ I +     +   +   HCK+G  RTG     YL     +   E
Sbjct: 278 LYFDDGTNPTDEIVRKFIDLADEVVEAGGVVAVHCKAGLGRTGTLVGAYLIWKYGFTASE 337

Query: 161 AHRQLSMLY 169
           A   + +  
Sbjct: 338 AIAFMRIAR 346


>gi|50303765|ref|XP_451828.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|32892078|gb|AAP88978.1| CDC14 [Kluyveromyces lactis]
 gi|49640960|emb|CAH02221.1| KLLA0B06622p [Kluyveromyces lactis]
          Length = 508

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 60/190 (31%), Gaps = 17/190 (8%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFIE-- 64
           +  +   +     G++ L    L  Y         + +A+ P  I + S Q      +  
Sbjct: 142 QDIVYGIWRAKENGLIDLSNFQLETYEKYERVENGDLNALTPDFIAFASPQEEMRRHQAL 201

Query: 65  ----------YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                       +K        +++  +  + H   +K   D+GIQ ++         + 
Sbjct: 202 SSATKSHLNQPFRKVLDYFKENDVQLVVRLNSHLYNKKHFEDIGIQHLDMIFEDGTCPDL 261

Query: 115 EQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYG 170
             ++  +   +T       + +HCK+G  RTG     +L     +   E    L     G
Sbjct: 262 SIVQNFVGAAETIIKQGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFMRPG 321

Query: 171 HFPVLKTITM 180
                +   +
Sbjct: 322 MVVGPQQHWL 331


>gi|301108377|ref|XP_002903270.1| putative tyrosine-protein phosphatase OCA1, putative [Phytophthora
           infestans T30-4]
 gi|262097642|gb|EEY55694.1| putative tyrosine-protein phosphatase OCA1, putative [Phytophthora
           infestans T30-4]
          Length = 744

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 54/151 (35%), Gaps = 13/151 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK-----EEEKAANDL 97
           N+  +    +YRS QPN        +   +++I+ L  + P    +     +E +     
Sbjct: 581 NYGMIEED-LYRSGQPNELNF-PFLERLNLRTIIYLALEEPNPQFQSFVEEQEIQLVFLG 638

Query: 98  GIQLINFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           G   +     A   L++E +   + I L  +  PL I C  G DRTG        I   +
Sbjct: 639 GNTRMESRRKAWEPLSEETVLAALDIILDRSNYPLYITCHLGRDRTGAVVGCLRKI-QGW 697

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                   +   Y  F   K    +  F ++
Sbjct: 698 H----LSSIFEEYRRFAGSKVRLQNEQFIEL 724


>gi|42569581|ref|NP_180855.2| tyrosine specific protein phosphatase family protein [Arabidopsis
           thaliana]
 gi|30102538|gb|AAP21187.1| At2g32960 [Arabidopsis thaliana]
 gi|110743267|dbj|BAE99524.1| hypothetical protein [Arabidopsis thaliana]
 gi|330253673|gb|AEC08767.1| phosphotyrosine protein phosphatase-like protein [Arabidopsis
           thaliana]
          Length = 257

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 56/181 (30%), Gaps = 49/181 (27%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    I+RS  P+        K  G++SI++L    PE + +   +     GI L 
Sbjct: 66  NFSMVDNG-IFRSGFPDSANF-SFIKTLGLRSIISL---CPEPYPENNMQFLKSNGISLF 120

Query: 103 NFPLSATR---------------------------------------ELNDEQIKQLISI 123
            F +  ++                                        L+ +  + L  +
Sbjct: 121 QFGIEGSKSKCLPGLENEVWLHIWSSKHQKEDFYTNGNSKTSEPFVDILDQKIREALKVL 180

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDIT 183
           L     PLLIHCK G  RTG        +   +       +    Y  F   K    D  
Sbjct: 181 LDEKNHPLLIHCKRGKHRTGCLVGCMRKL-QKWCITSILDE----YKRFAAAKARVSDQR 235

Query: 184 F 184
           F
Sbjct: 236 F 236


>gi|145354251|ref|XP_001421404.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581641|gb|ABO99697.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 363

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 56/154 (36%), Gaps = 13/154 (8%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE------EEKAANDLGIQLINFPL 106
           YR  QP              K++++LRG   ++   +       +       + +++ P+
Sbjct: 175 YRGGQPTAEG-RAWLVRNNFKTVIDLRGSDRDNQWLQAFGGGSGQGTFGASALNIVHIPI 233

Query: 107 SATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
                  +E +K+ I  +     +P+L+HCK+G  RTG   A +         +EA    
Sbjct: 234 PDMEPPTEEDVKRFIETVNDDKMRPILVHCKAGIGRTGSLVACWRV-HQGMDVDEALSAE 292

Query: 166 SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGD 199
           S++     + +         +      N    G+
Sbjct: 293 SLVCDFGSIAQE----AFVREYAAKLNNKTFNGE 322


>gi|228472848|ref|ZP_04057605.1| protein tyrosine/serine phosphatase [Capnocytophaga gingivalis ATCC
           33624]
 gi|228275430|gb|EEK14207.1| protein tyrosine/serine phosphatase [Capnocytophaga gingivalis ATCC
           33624]
          Length = 178

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 41/161 (25%), Positives = 66/161 (40%), Gaps = 16/161 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + V    +YRS Q      E + +   IK+I+NLR        K+    +   GI LI
Sbjct: 29  NLYQVDS-LLYRSEQLVKADKEEILRT-PIKTIINLRYFTRS---KDRNVFSPTDGITLI 83

Query: 103 NFPLSATRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL   R    +  + L  I ++     +LIHC  GAD TG+  A+Y  I   +    A
Sbjct: 84  NHPLLTWRITPKDIAQVLKRIRRSQEQGAVLIHCYHGADCTGIMVAMYRIIYHDWSIAAA 143

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTE 201
            +++    YG+            ++ +  L+     K   +
Sbjct: 144 KKEMLQGPYGYHS---------IWKNLEALFTEETVKEVRK 175


>gi|328772667|gb|EGF82705.1| hypothetical protein BATDEDRAFT_22794 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 675

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 54/137 (39%), Gaps = 7/137 (5%)

Query: 59  NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118
           +   +    KE  IK+I+ L  K        +++     GI+ I           +  +K
Sbjct: 276 SMDNLIRYMKEKNIKTIIRLNNKT------YDKRKFVLAGIEHIELYFPDGTTPPEGILK 329

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKT 177
           + + I +T   P+ +HCK+G  RTG   A ++         E    +  +  G     + 
Sbjct: 330 RFLEICETREGPIAVHCKAGLGRTGSLIASFIMKHYKMTACEVISFMRVLRPGSVVGPQQ 389

Query: 178 ITMDITFEKITQLYPNN 194
             +     K+ +++PNN
Sbjct: 390 NYLQAMQTKLWKMHPNN 406


>gi|328773804|gb|EGF83841.1| hypothetical protein BATDEDRAFT_21375 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 172

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 55/151 (36%), Gaps = 15/151 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V    +YRS QPN        ++ G+K+++ L  + P           +D  I  
Sbjct: 15  TNFGLVEE-RLYRSGQPNELNF-PFLEKLGLKTVIFLAPEEPNQRFLN---FIDDQEINF 69

Query: 102 INFPLSA----TRELNDEQI-KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
            +   ++       +++E + + L  +L     P+++ C  G  RTG        +   +
Sbjct: 70  FHLGFNSTANAWDPISEEVVLESLEHMLDPRNYPVMVMCNLGRHRTGTVVGCLRKL-QKW 128

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                   +   Y  +   K   +   F ++
Sbjct: 129 N----LASIFEEYRRYAGPKVRILSEQFIEL 155


>gi|328870334|gb|EGG18709.1| putative tyrosine phosphatase family protein [Dictyostelium
           fasciculatum]
          Length = 164

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 51/150 (34%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QPN        ++  +K I+ L  + P           +D  I+LI
Sbjct: 9   NFGMVADD-LYRSGQPNELNF-PFLEKLQLKKIIFLAPEDPSQQF---VNFCDDQDIELI 63

Query: 103 NFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  +            D  I  L  IL     PL I C  G  RTG        +   + 
Sbjct: 64  HLGIDTMTNPWNPISEDVVISALKIILNPDNYPLAIMCNLGRHRTGTVVGCLRKL-QRWN 122

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                 +    Y  F   K   ++  F ++
Sbjct: 123 LTSILEE----YRRFAGSKVRLLNEQFIEL 148


>gi|146307496|ref|YP_001187961.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina ymp]
 gi|145575697|gb|ABP85229.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina ymp]
          Length = 226

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 65/125 (52%), Gaps = 10/125 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA P+   +  L+   GI +++N   +  E W K+         +  +
Sbjct: 56  NLYRMTPD-LYRSALPSAGDLPQLQA-LGIATVINFYQRGDEQWLKDPR-------VVQV 106

Query: 103 NFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + PL   R  + + I+ L SI +  +   +LIHCK G +RTGL +A+Y  I  ++ KE+A
Sbjct: 107 HLPLRTDRIDDADVIEVLRSIRQAQSRGRVLIHCKHGQNRTGLIAAMYRVIYQNWSKEQA 166

Query: 162 HRQLS 166
             ++ 
Sbjct: 167 LAEMR 171


>gi|258544337|ref|ZP_05704571.1| protein tyrosine/serine phosphatase [Cardiobacterium hominis ATCC
           15826]
 gi|258520417|gb|EEV89276.1| protein tyrosine/serine phosphatase [Cardiobacterium hominis ATCC
           15826]
          Length = 177

 Score = 88.3 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 17/153 (11%)

Query: 41  TQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           T + H V P  +YRS Q +      L+    I++I+NLR       H+         GI+
Sbjct: 6   TNHLHEVTP-SLYRSEQLDQDDTALLQA-LNIRTIINLRYFNRGDDHRN----FGHTGIR 59

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKP-LLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +IN PL       +E  + L +I ++     +L+HC  G DRTGL   +Y  +  ++   
Sbjct: 60  IINIPLLTWNIKAEEMAQVLYTIEQSEKYGNVLVHCYHGEDRTGLTIGLYRILYQNWNTA 119

Query: 160 EAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
           +A  ++   YG+         +  +  I + Y 
Sbjct: 120 DAEAEMR-RYGY---------NRIWRNIPRFYK 142


>gi|303284104|ref|XP_003061343.1| NAD k-like protein [Micromonas pusilla CCMP1545]
 gi|226457694|gb|EEH54993.1| NAD k-like protein [Micromonas pusilla CCMP1545]
          Length = 836

 Score = 88.3 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 54/128 (42%), Gaps = 14/128 (10%)

Query: 52  IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-----------KEEEKAANDLGIQ 100
            YR  QP          E G K++++LR +  ++             K   + A+D G +
Sbjct: 153 FYRGGQPTAEG-RAWLAERGFKTVIDLRFEDRDNQWTKPFGGGVGVGKRAPRLADDAGFE 211

Query: 101 LINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +++ P++       E +++ I +    A +P+L+HCK+G  RTG   + +         +
Sbjct: 212 VVHMPVTDMEPPTFELVERFIEVANDRARRPMLVHCKAGIGRTGSMVSCWRISR-GMDVD 270

Query: 160 EAHRQLSM 167
           EA      
Sbjct: 271 EARSISHW 278


>gi|121705916|ref|XP_001271221.1| protein-tyrosine phosphatase, putative [Aspergillus clavatus NRRL
           1]
 gi|119399367|gb|EAW09795.1| protein-tyrosine phosphatase, putative [Aspergillus clavatus NRRL
           1]
          Length = 611

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 25/208 (12%), Positives = 53/208 (25%), Gaps = 42/208 (20%)

Query: 31  GLYFLTITTFTQNFHAVVPHEI-YRSAQPNG----------------------------- 60
             Y         +F+ + P  + + S Q                                
Sbjct: 194 EEYEKFERVDMGDFNWITPDFLAFASPQHQPIAPVPFDTPEYDALPSTISEVISSKLPLP 253

Query: 61  -TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
              +        +  ++ L  +L    +         LGI  I+             +++
Sbjct: 254 FKNVLAHFASRDVGLVVRLNSELYSPSY------FTALGINHIDMIFEDGTCPPLPLVRR 307

Query: 120 LISILKTA----PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            I +         + + +HCK+G  RTG     YL     +   E    +     G    
Sbjct: 308 FIKMAHDMITVKKRGIAVHCKAGLGRTGCLIGAYLIYRYGFTANEIIAFMRFMRPGMVVG 367

Query: 175 LKTITMDITFEKITQLYPNNVSKGDTEQ 202
            +   + +      + +  +  K    Q
Sbjct: 368 PQQHWLHLNQGSFREWWFEDSMKEKLAQ 395


>gi|149194664|ref|ZP_01871759.1| hypothetical protein CMTB2_04767 [Caminibacter mediatlanticus TB-2]
 gi|149135087|gb|EDM23568.1| hypothetical protein CMTB2_04767 [Caminibacter mediatlanticus TB-2]
          Length = 166

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 71/132 (53%), Gaps = 3/132 (2%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ 119
              +E + K+Y IKS+LNLRG+     +  EE+    LG++     +S+    + E++++
Sbjct: 2   PWNLEKIIKKYDIKSVLNLRGRGNY-LYDLEEEICKKLGVEYKVITISSRVLPSYEKLEE 60

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA-HRQLSMLYGHFPVLKTI 178
           L++ LK + KPLL HCK+GADRTG  + ++ +++     + A  ++L +   +  + K  
Sbjct: 61  LVNYLKNSKKPLLFHCKAGADRTGFVAVLW-HVLQGRDVKWAVKKELKLSKAYISLSKAG 119

Query: 179 TMDITFEKITQL 190
            +   F K    
Sbjct: 120 RVKKMFLKYNNQ 131


>gi|281210434|gb|EFA84600.1| putative tyrosine phosphatase family protein [Polysphondylium
           pallidum PN500]
          Length = 167

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 58/165 (35%), Gaps = 19/165 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QPN        ++  +K I+ L    P           +D  I+LI
Sbjct: 9   NFGMVADD-LYRSGQPNELNF-PFLEKLQLKKIIFLAPDDPSQQF---VNFCDDQDIELI 63

Query: 103 NFPLSA----TRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  +         ++++ +   + I L     PL I C  G  RTG        +   + 
Sbjct: 64  HLGMDTHTNPWNPISEDIVISALKIVLDPDSYPLHIMCNLGRHRTGTVVGCLRKL-QRWN 122

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLY----PNNVSKG 198
                 +    Y  F   K   ++  F ++        P+N  KG
Sbjct: 123 LTSILEE----YRRFAGSKVRLLNEQFIELFDTDLVGIPDNAPKG 163


>gi|321257939|ref|XP_003193755.1| protein-tyrosine-phosphatase [Cryptococcus gattii WM276]
 gi|317460225|gb|ADV21968.1| protein-tyrosine-phosphatase, putative [Cryptococcus gattii WM276]
          Length = 212

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 59/160 (36%), Gaps = 16/160 (10%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKA----ANDLGI 99
           F  V P  +YRSA P  + +        +K+I++L  + P     +  +        LG+
Sbjct: 17  FSIVEPG-VYRSASPTPSQV-PFLAGLNLKTIISLTPEHPIKPLVQFVRTTGISFVHLGL 74

Query: 100 QLINFPLSATRELNDEQIKQLIS--ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
                P +  R +  E IK  +   +L T   P+L+    G  +TG        +   + 
Sbjct: 75  THWRRPGTDWRPVRYEIIKTALEAYVLDTRAHPVLLIDPLGVHQTGCLVGALRMM-QGWN 133

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
              A  +    Y      K   +D   E   +L+ +++  
Sbjct: 134 FASALME----YRAHAGSKHRYVD---EHYIELFDSDLIN 166


>gi|50291433|ref|XP_448149.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527460|emb|CAG61100.1| unnamed protein product [Candida glabrata]
          Length = 186

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 62/168 (36%), Gaps = 13/168 (7%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  +V     +YRS  P      +++ +  +K+I+ +  K       E  +      I 
Sbjct: 13  NFAPIVSTDVSLYRSGYPMPLNYSFIRGQLHLKTIIYVGDKSE--PMPEYAEFLERERIN 70

Query: 101 LINFPLSATRELNDE--QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + + R+ + +    + L  +L+    P+LIH   G  R G+   +   ++  +  
Sbjct: 71  YHHIHMDSCRDPDIDAQMDRVLQLVLRADNYPILIHSNKGKHRVGVVVGIIRKLLQGWSI 130

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
              +++    YG F        D    +   ++  ++       P  A
Sbjct: 131 AGIYQE----YGLFSG---GLKDEADLEYITMFETDILMDPRTVPRFA 171


>gi|302697187|ref|XP_003038272.1| hypothetical protein SCHCODRAFT_72472 [Schizophyllum commune H4-8]
 gi|300111969|gb|EFJ03370.1| hypothetical protein SCHCODRAFT_72472 [Schizophyllum commune H4-8]
          Length = 383

 Score = 87.9 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 27/217 (12%), Positives = 57/217 (26%), Gaps = 47/217 (21%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI 63
               +  L   +     G+  +    +  Y         +++ + P +    A P  T  
Sbjct: 164 NLSIQDCLWGVWKAQQNGLCDMNEFDVEDYEYYEKVENGDWNWITP-KFIAFASPVETNW 222

Query: 64  EY------------------------------------LKKEYGIKSILNLRGKLPESWH 87
                                                   ++ G+K ++ L  +      
Sbjct: 223 LKNQKEARESLSHSTSSSSGSNLALQRRLPAPFQNCLDYFEKRGVKLVVRLNTE------ 276

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGL 144
             +     D GI  +           DE +++ +            + +HCK+G  RTG 
Sbjct: 277 LYDRNHFLDRGIDHMELYFDDGTNPTDEIVREFLDTSDRIIENGGVVAVHCKAGLGRTGT 336

Query: 145 ASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
               Y+     +   EA   + +   G     +   M
Sbjct: 337 LIGAYMIWKYGFTANEAIAFMRIVRPGSVVGPQQQYM 373


>gi|254521540|ref|ZP_05133595.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
 gi|219719131|gb|EED37656.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
          Length = 166

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
                 + V P  +Y   QP+GT +  L  + G++++++LR    +     E   A  LG
Sbjct: 21  AENAPLNEVRPG-LYAGGQPSGTQLRALAAQ-GVRTVIDLRQPDEDRGFD-EAGVAESLG 77

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           ++ +  P++    L+   ++ +   L+ +  P+L+HC SG +R G    +      H   
Sbjct: 78  LRYVRIPVAGADGLDAANLRAVHQALQQSAGPVLLHCASG-NRAGAVLGLVTAHYEHASP 136

Query: 159 EEAHR 163
           E+A +
Sbjct: 137 EQALQ 141


>gi|254569462|ref|XP_002491841.1| Putative protein tyrosine phosphatase [Pichia pastoris GS115]
 gi|238031638|emb|CAY69561.1| Putative protein tyrosine phosphatase [Pichia pastoris GS115]
 gi|328351660|emb|CCA38059.1| Putative tyrosine-protein phosphatase OCA1 [Pichia pastoris CBS
           7435]
          Length = 203

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/141 (24%), Positives = 49/141 (34%), Gaps = 13/141 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-----KEEEKAANDL 97
           NF  V    +YRS QP+        KE  +KSI+ L  + P+            K   +L
Sbjct: 39  NFCPV-ERHLYRSGQPSTIN-HSFLKELNLKSIIWLAIEDPQDNFLKFIDDNNIKFFYNL 96

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           G   I+         N    + L  I+ T   PLL+ C  G  RTG        +   + 
Sbjct: 97  GFNSIDNNSWDGLSEN-SIKQSLEVIVDTRNYPLLVCCGMGRHRTGTIIGCLRKL-QGWN 154

Query: 158 KEEAHRQLSMLYGHFPVLKTI 178
                  +S  Y  F   +  
Sbjct: 155 ----LSSVSEEYRRFTGSRGG 171


>gi|328350589|emb|CCA36989.1| cell division cycle 14 [Pichia pastoris CBS 7435]
          Length = 531

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 60/182 (32%), Gaps = 10/182 (5%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI---- 63
           +  +   +      ++ L + +L  Y         + + +    I   A P  +      
Sbjct: 140 QDVVYAVWRAKERKMIDLTSFNLEEYEQYERVDQGDLNVISKDFI-AFASPKQSRKNGPL 198

Query: 64  -EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
            +  KK        +++  +  + H  + +  +  GIQ I+           E +++ + 
Sbjct: 199 NQPFKKVLDYFCKNDVQLVVRLNSHLYDSEEFSKRGIQHIDMIFDDGTCPTLEYVQKFVG 258

Query: 123 ILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
             +T       + +HCK+G  RTG     +L     +   E    + M   G     +  
Sbjct: 259 AAETVIAKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMVRPGMVVGPQQH 318

Query: 179 TM 180
            +
Sbjct: 319 WL 320


>gi|254566161|ref|XP_002490191.1| Protein phosphatase required for mitotic exit [Pichia pastoris
           GS115]
 gi|238029987|emb|CAY67910.1| Protein phosphatase required for mitotic exit [Pichia pastoris
           GS115]
          Length = 555

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 60/182 (32%), Gaps = 10/182 (5%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI---- 63
           +  +   +      ++ L + +L  Y         + + +    I   A P  +      
Sbjct: 164 QDVVYAVWRAKERKMIDLTSFNLEEYEQYERVDQGDLNVISKDFI-AFASPKQSRKNGPL 222

Query: 64  -EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
            +  KK        +++  +  + H  + +  +  GIQ I+           E +++ + 
Sbjct: 223 NQPFKKVLDYFCKNDVQLVVRLNSHLYDSEEFSKRGIQHIDMIFDDGTCPTLEYVQKFVG 282

Query: 123 ILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTI 178
             +T       + +HCK+G  RTG     +L     +   E    + M   G     +  
Sbjct: 283 AAETVIAKGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIAYMRMVRPGMVVGPQQH 342

Query: 179 TM 180
            +
Sbjct: 343 WL 344


>gi|17549688|ref|NP_523028.1| putative tyrosine specific protein phosphatase [Ralstonia
           solanacearum GMI1000]
 gi|17431943|emb|CAD18620.1| probable tyrosine phosphatase protein [Ralstonia solanacearum
           GMI1000]
          Length = 214

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 49/139 (35%), Gaps = 17/139 (12%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  V      IYR  +P         K+  IK+I+ L          EE+  A   GI+
Sbjct: 48  NFGVVSEGVISIYRGGEPVDEQEWQFLKDSKIKTIVKLNQYSKAVSESEEDHLAEKYGIK 107

Query: 101 ---------------LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLA 145
                            N  L    + N  +             P+ +HC  G DRTGL 
Sbjct: 108 VIKVFMGPEDCILGKHCNIDLDEMPDPNLVEKAINEITAAAGNGPVYVHCSHGQDRTGLV 167

Query: 146 SAVYLYIVAHYPKEEAHRQ 164
            A+Y   V  Y +++A  +
Sbjct: 168 VALYRMRVQGYCRKKADDE 186


>gi|254584937|ref|XP_002498036.1| ZYRO0G00616p [Zygosaccharomyces rouxii]
 gi|238940930|emb|CAR29103.1| ZYRO0G00616p [Zygosaccharomyces rouxii]
          Length = 524

 Score = 87.1 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/190 (14%), Positives = 62/190 (32%), Gaps = 17/190 (8%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEI-YRSAQPNGTFI--- 63
           +  +   +     G++ L + +L  Y         + + + P  I + S Q +   I   
Sbjct: 142 QDVVYGVWRAKERGLIDLHSFNLENYERYEHVENGDLNVLTPDFIAFASPQEDSRLINSN 201

Query: 64  ---------EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELND 114
                    +  +      +  N++  +  +     +K   D+GIQ ++         + 
Sbjct: 202 TVSSKSHLNQAFRSVLKFFANNNIQLVVRLNSPLYNKKHFEDVGIQHLDMIFEDGTCPDL 261

Query: 115 EQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYG 170
             ++  +   +T       + +HCK+G  RTG     +L     +   E    L     G
Sbjct: 262 SIVQNFVGAAETIIKGGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIGFLRFMRPG 321

Query: 171 HFPVLKTITM 180
                +   +
Sbjct: 322 MVVGPQQHWL 331


>gi|297823087|ref|XP_002879426.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
 gi|297325265|gb|EFH55685.1| tyrosine specific protein phosphatase family protein [Arabidopsis
           lyrata subsp. lyrata]
          Length = 254

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 58/181 (32%), Gaps = 49/181 (27%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V + I+RS  P+        K  G++SI++L    PE + +   +     GI L 
Sbjct: 63  NFA-IVDNGIFRSGFPDIANF-SFIKTLGLRSIISL---CPEPYPENNMQFLKSNGISLF 117

Query: 103 NFPLSATR---------------------------------------ELNDEQIKQLISI 123
            F +  ++                                        L+ +  + L  +
Sbjct: 118 QFGIEGSKSKCLPGLENEVWLHIWSSKHQKEGSYTNGNSKTSEPLVDILDHKIREALKVL 177

Query: 124 LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDIT 183
           L     PLLIHCK G  RTG        +   +        +   Y  F   K    D  
Sbjct: 178 LDEKNHPLLIHCKRGKHRTGCLVGCMRKL-QKWC----ITSIFDEYQRFAAAKARVSDQR 232

Query: 184 F 184
           F
Sbjct: 233 F 233


>gi|194697854|gb|ACF83011.1| unknown [Zea mays]
          Length = 164

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 58/158 (36%), Gaps = 26/158 (16%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V   I+RS  P+     +L     ++SI+ L    PE + +E  +     GI+L  F +
Sbjct: 1   MVDDGIFRSGLPDAANFRFLLS-LNLRSIVYL---CPEPYAEENARFLRTNGIRLHQFAV 56

Query: 107 SATR-----------------ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
             ++                    +   + L  +L    + +LIHCK G  RTG      
Sbjct: 57  EGSKSGPTVLDTMSAQEPFVHIPEETIREALKVVLDVRNQLVLIHCKRGKHRTGCVVGCL 116

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
             +   +        +   Y HF   K  T D  F ++
Sbjct: 117 RKL-QKWC----LSSVFDEYLHFAAAKARTTDQRFMEL 149


>gi|207725072|ref|YP_002255469.1| tyrosine phosphatase protein [Ralstonia solanacearum MolK2]
 gi|206590302|emb|CAQ37263.1| tyrosine phosphatase protein [Ralstonia solanacearum MolK2]
          Length = 216

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/183 (21%), Positives = 58/183 (31%), Gaps = 24/183 (13%)

Query: 1   MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPH--EIYRSAQP 58
           + KI    +      I  ++ +L  C                NF  V      IYR  QP
Sbjct: 11  LAKIPSRIRRTAFLPIATVMALLAGCQTP-----PHEEGKPVNFGVVSEGPISIYRGGQP 65

Query: 59  NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ---------------LIN 103
                    KE  +K I+ L          +E+K A    I+                 +
Sbjct: 66  VDDKEWQFLKEKKVKDIVKLNKYSEAVSESDEDKFAEKYNIKVIKVFMGPEDCVPGVHCS 125

Query: 104 FPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
                        +   I  +  A    P+ +HC  G DRTGL  A+Y   V  Y K++A
Sbjct: 126 IDPDLDEMPAKNSVATAIEEITVAAGNGPVYVHCSHGQDRTGLVVALYRMRVQGYCKKKA 185

Query: 162 HRQ 164
             +
Sbjct: 186 DDE 188


>gi|281356890|ref|ZP_06243380.1| protein tyrosine/serine phosphatase [Victivallis vadensis ATCC
           BAA-548]
 gi|281316448|gb|EFB00472.1| protein tyrosine/serine phosphatase [Victivallis vadensis ATCC
           BAA-548]
          Length = 180

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query: 42  QNFHAVVPH-EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
            NF AV     I+RS QP     E L K  G KSILNLR       +  + K    L ++
Sbjct: 26  TNFKAVDEELGIFRSGQPGRKEFEALAKR-GFKSILNLRN------YHSDLKLIRGLELK 78

Query: 101 LINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
                ++      ++ +   + I++ APKPLLIHC  G+DRTG   A +   V ++  E+
Sbjct: 79  EFRCGVNTGSV-TEKDLLNAVRIVRDAPKPLLIHCWHGSDRTGTVVAAFRIAVQNWEVEK 137

Query: 161 AHRQLSML 168
           A  ++ + 
Sbjct: 138 AIAEMRLP 145


>gi|50551653|ref|XP_503301.1| YALI0D26125p [Yarrowia lipolytica]
 gi|49649169|emb|CAG81507.1| YALI0D26125p [Yarrowia lipolytica]
          Length = 168

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 60/169 (35%), Gaps = 17/169 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  P          +  +KSI+   G      +++  + A   GI L 
Sbjct: 8   NFAFVADG-IYRSGHPLPINY-PFLNQLDLKSIIYF-GDRDIGDNQDYIEWAKSEGITLH 64

Query: 103 NFPLSATRELNDE-----QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            F +++ +E   E       + L  +L     P+L+H   G  R G+   V   I+  + 
Sbjct: 65  YFHVNSAKEPFVENDPEAIRQALQILLDRRNFPILVHSNKGKHRIGVLVGVMRKILQGWC 124

Query: 158 KEEAHRQLSMLYGHFPVLKTITMD----ITFEKITQLYPNNVSKGDTEQ 202
                  +   Y  F   K   +D     TFE   Q   N   +    Q
Sbjct: 125 LAG----IFDEYSRFAAGK-GDLDVEFIETFETKLQFDLNYAPEWLAIQ 168


>gi|256820351|ref|YP_003141630.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea DSM
           7271]
 gi|256581934|gb|ACU93069.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea DSM
           7271]
          Length = 182

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 49/165 (29%), Positives = 73/165 (44%), Gaps = 8/165 (4%)

Query: 15  YIKILLGVLVLCAVSLG-LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIK 73
              ++L  L+   +SL      T+     N + V    +YRS Q      + +KK   IK
Sbjct: 2   KKNLILYFLLFSFISLWGQQKATLIHADANLYKVDS-LLYRSEQLVNEDKKIIKKIP-IK 59

Query: 74  SILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK-TAPKPLL 132
           +I+NLR         +++      GI+LIN PL   R    E    L  I K      +L
Sbjct: 60  TIINLRYFTRSG---DKKIFHASEGIKLINHPLLTWRIKAPEIASVLKLIRKHQNEGAVL 116

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLK 176
           IHC  GADRTG+  A+Y  I   +   +A  ++ +  YG+  V K
Sbjct: 117 IHCYHGADRTGIMVAMYRIIYEDWSIADAKNEMLNGPYGYHSVWK 161


>gi|300698028|ref|YP_003748689.1| tyrosine phosphatase protein [Ralstonia solanacearum CFBP2957]
 gi|299074752|emb|CBJ54312.1| putative tyrosine phosphatase protein [Ralstonia solanacearum
           CFBP2957]
          Length = 216

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 59/181 (32%), Gaps = 24/181 (13%)

Query: 3   KIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPH--EIYRSAQPNG 60
           KI    +      I  ++ +L  C          +     NF  V      IYR  QP  
Sbjct: 13  KIPSRIRQTAFLPIATVMALLAGCQTPPHEDGKPV-----NFGVVSEGPISIYRGGQPVD 67

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ---------------LINFP 105
                  KE  +K+I+ L          +E+K A    I+                 +  
Sbjct: 68  DKEWGFLKEKKVKTIVKLNKYSDAVSEYDEDKFAEKYNIKVIKVFMGPEDCVPGVHCSID 127

Query: 106 LSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
                      +   I  +  A    P+ +HC  G DRTGL  A+Y   V  Y K++A  
Sbjct: 128 PDLDEMPAKNSVATAIEEITVAAGNGPVYVHCSHGQDRTGLVVALYRMRVQGYCKKKADD 187

Query: 164 Q 164
           +
Sbjct: 188 E 188


>gi|238486600|ref|XP_002374538.1| protein-tyrosine phosphatase, putative [Aspergillus flavus
           NRRL3357]
 gi|220699417|gb|EED55756.1| protein-tyrosine phosphatase, putative [Aspergillus flavus
           NRRL3357]
          Length = 626

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/205 (13%), Positives = 55/205 (26%), Gaps = 41/205 (20%)

Query: 33  YFLTITTFTQNFHAVVPHEI-YRSAQPNG------------------------------T 61
           Y         +F+ + P  + + S Q                                  
Sbjct: 214 YEKYERVDMGDFNWITPQFLAFASPQHEPIAPIPPNTPEYAALPSTISQVQASKLPLPFK 273

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
            +        I  ++ L  +L    +         LGI  I+             +++ I
Sbjct: 274 NVLAHFASRDIGLVVRLNSELYSPSY------FTALGITHIDMIFEDGTCPPLPLVRRFI 327

Query: 122 SI---LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKT 177
            +   + T  K + +HCK+G  RTG     YL     +   E    +     G     + 
Sbjct: 328 KMAHDMITKKKGIAVHCKAGLGRTGCLIGAYLIYRYGFTANEIIAFMRFMRPGMVVGPQQ 387

Query: 178 ITMDITFEKITQLYPNNVSKGDTEQ 202
             + +      + +  +  K    Q
Sbjct: 388 HWLHLNQGAFREWWFEDSMKEKLAQ 412


>gi|328857416|gb|EGG06533.1| hypothetical protein MELLADRAFT_36193 [Melampsora larici-populina
           98AG31]
          Length = 298

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 57/172 (33%), Gaps = 20/172 (11%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTF-------- 62
           L      I L +L L    L  Y         +++ + PH I   A P            
Sbjct: 112 LYGVKRAIDLRLLKLDEFDLKEYECFEKVENGDYNWLSPHFI-AFASPVEPQGGRIGKSF 170

Query: 63  --IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
             I    ++ G++ ++ L  K        +E    + G+               E +++ 
Sbjct: 171 KMILDQFEKVGVRLVVRLNKK------LYDENRFLERGMAHKEMYFDDGTNPTMEMVREF 224

Query: 121 ISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY 169
           I++          + +HCK+G  RTG     YL     +  EE    + ++ 
Sbjct: 225 ITMCDRIIEEGGVVAVHCKAGLGRTGTLIGAYLIYKYSFTAEEVIGFMRIMR 276


>gi|255718337|ref|XP_002555449.1| KLTH0G09592p [Lachancea thermotolerans]
 gi|238936833|emb|CAR25012.1| KLTH0G09592p [Lachancea thermotolerans]
          Length = 169

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 64/161 (39%), Gaps = 13/161 (8%)

Query: 43  NFHAVVPHE--IYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV  E  +YRS  P      ++  +  +++I+ +     +   ++  +      IQ
Sbjct: 8   NFAPVVSTEVSLYRSGYPMPLNYAFIADQLHLRTIIYV---GDKELSEDYNEFLTQHNIQ 64

Query: 101 LINFPLSATRELN--DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
                +++ R+ N  ++  K L  I+  A  P+LIH   G  R G+   +   ++  +  
Sbjct: 65  YHFVHMNSCRDKNVQEQMDKVLRLIVDRANYPILIHSNKGKHRVGVVVGIIRKLLQGWST 124

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGD 199
              +++    Y  F       +D   E IT      + + D
Sbjct: 125 TGIYQE----YDIFSGGLKGQVD--LEFITMFDTELIVRRD 159


>gi|223940783|ref|ZP_03632617.1| hypothetical protein Cflav_PD0102 [bacterium Ellin514]
 gi|223890540|gb|EEF57067.1| hypothetical protein Cflav_PD0102 [bacterium Ellin514]
          Length = 334

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 51/125 (40%), Gaps = 8/125 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +     Y  + P G       K  GIK+I+ + G  P+       + A+  GI+ +
Sbjct: 57  NFFQL-SDRFYSGSAPEGESAFAELKNRGIKTIITVDGAKPD------VETAHRFGIRYV 109

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           + P+         Q  +L+   +T P P+ IHC  G  R    +AV       +  E+A 
Sbjct: 110 HLPIGYDGVPT-NQAIRLVKAAETLPGPIYIHCHHGMHRGPAGAAVICMATEGWSAEQAD 168

Query: 163 RQLSM 167
             L +
Sbjct: 169 SWLRL 173


>gi|331238761|ref|XP_003332035.1| tyrosine-protein phosphatase CDC14 [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309311025|gb|EFP87616.1| tyrosine-protein phosphatase CDC14 [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 576

 Score = 85.2 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 54/159 (33%), Gaps = 20/159 (12%)

Query: 24  VLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTF----------IEYLKKEYGIK 73
           +L    L  Y         +++ + PH I   A P  +           I    +  G+K
Sbjct: 136 ILQEFDLKEYETFEKVEHGDYNWLSPHFI-AFASPVESANGRIGKAFKLILDQFERVGVK 194

Query: 74  SILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA---PKP 130
            ++ L  K        +E      GI               E +++ I+I +        
Sbjct: 195 LVIRLNKK------LYDETRFTKRGIAHREMYFDDGTNPTMEMVREFITISERIIGEGGV 248

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY 169
           + +HCK+G  RTG     YL     +  EEA   + ++ 
Sbjct: 249 VAVHCKAGLGRTGTLIGAYLIYKYRFTAEEAIGFMRIMR 287


>gi|315223492|ref|ZP_07865348.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea F0287]
 gi|314946527|gb|EFS98519.1| protein tyrosine/serine phosphatase [Capnocytophaga ochracea F0287]
          Length = 182

 Score = 84.8 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 74/165 (44%), Gaps = 8/165 (4%)

Query: 15  YIKILLGVLVLCAVSLG-LYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIK 73
              ++L +++   +SL      T+     N + V    +YRS Q      + +KK   IK
Sbjct: 2   KKNLILYLVLFSFISLWGQQKATLIHADANLYKVDS-LLYRSEQLVNEDKKIIKKIP-IK 59

Query: 74  SILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK-TAPKPLL 132
           +I+NLR         +++      GI+LIN PL   R    E    L  I K      +L
Sbjct: 60  TIINLRYFTRSG---DKKIFHASEGIKLINHPLLTWRIKAPEIASVLKLIRKHQNEGAVL 116

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLK 176
           IHC  GADRTG+  A+Y  I   +   +A  ++ +  YG+  V K
Sbjct: 117 IHCYHGADRTGIMVAMYRIIYEDWSIADAKNEMLNGPYGYHSVWK 161


>gi|330827548|ref|XP_003291836.1| hypothetical protein DICPUDRAFT_156475 [Dictyostelium purpureum]
 gi|325077959|gb|EGC31638.1| hypothetical protein DICPUDRAFT_156475 [Dictyostelium purpureum]
          Length = 167

 Score = 84.8 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 55/150 (36%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QPN        ++  +K I+ L    P    +   +   D  I+LI
Sbjct: 9   NFGMVADD-LYRSGQPNELNF-PFLEKLQLKKIIFLAPDDPSQQFQNFVE---DQDIELI 63

Query: 103 NFPLSA----TRELNDEQIKQLISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  +         +++E +   + I+      PL++ C  G  RTG        +   + 
Sbjct: 64  HLGMDTHQNPWNPISEEIVISALKIILNMESYPLMVMCNLGRHRTGTVIGCLRKL-QRWN 122

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   ++  F ++
Sbjct: 123 ----LTSIFEEYRRFAGSKVRLLNEQFIEL 148


>gi|167042507|gb|ABZ07232.1| putative dual specificity phosphatase, catalytic domain protein
           [uncultured marine crenarchaeote HF4000_ANIW133C7]
          Length = 164

 Score = 84.8 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 59/164 (35%), Gaps = 8/164 (4%)

Query: 29  SLGLYFLTITTFTQN-FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH 87
            +        T   + F  ++ +++  SA P          E G+KSI+ +R    E   
Sbjct: 6   DVWRKVHGTITGRPDRFSWLIENKLAGSAIPTSIDEVQWLIEQGVKSIVTVR---EEPLD 62

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASA 147
            +  K  N L I   +  +    +L          I  T  + +++HC +G  RTG   A
Sbjct: 63  DDWIKDVNYLHIMSNDMGVPEFNDLVHAVDFIHRRI--TNKESVMVHCLAGLGRTGTVLA 120

Query: 148 VYLYIVAHYPKEEAHRQLS-MLYGHF-PVLKTITMDITFEKITQ 189
            YL    +   +EA +++     G      +   +    + +  
Sbjct: 121 SYLIKYQNMSADEAMKKVREQRPGSIQSYPQEEIIFQFAKSLQH 164


>gi|299748001|ref|XP_001837393.2| phosphoprotein phosphatase [Coprinopsis cinerea okayama7#130]
 gi|298407772|gb|EAU84309.2| phosphoprotein phosphatase [Coprinopsis cinerea okayama7#130]
          Length = 654

 Score = 84.4 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 64/217 (29%), Gaps = 47/217 (21%)

Query: 4   IKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFI 63
               +  L   +  +  G+  +   S+  Y         +++ + P  I   A PN    
Sbjct: 165 NLNIQDCLWGVWKAMQHGLCDMNEFSVEEYEYYEKVENGDWNWLTPGFI-AFASPNDPNY 223

Query: 64  EY------------------------------------LKKEYGIKSILNLRGKLPESWH 87
            +                                      ++  IK ++ L  K      
Sbjct: 224 IHARKDIHDSPGLSRSTSGSSNLALQRKLPTTFQNCLDYFQKRNIKLVVRLNTK------ 277

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGL 144
             ++KA  D+GI  +           DE ++  + +      +   + +HCK+G  RTG 
Sbjct: 278 LYDKKAFLDVGIDHLELYFDDGTNPTDEIVRTFLDVSDRIIESGGVVAVHCKAGLGRTGT 337

Query: 145 ASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITM 180
               YL     +   EA   + +   G     +   M
Sbjct: 338 LIGAYLIWKYGFTASEAIAFMRIVRPGSVVGPQQQYM 374


>gi|152989083|ref|YP_001346608.1| hypothetical protein PSPA7_1223 [Pseudomonas aeruginosa PA7]
 gi|150964241|gb|ABR86266.1| hypothetical protein PSPA7_1223 [Pseudomonas aeruginosa PA7]
          Length = 218

 Score = 84.4 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA PN   +  L +   +K++++       +W            I+++
Sbjct: 48  NLYRMSP-TLYRSALPNAQSVA-LLERLQVKTVVSFIKDDDRAWL-------GQAPIRIV 98

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P  A R  + E +  L  +       P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 99  SLPTHADRVDDTEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158

Query: 162 HRQL 165
             ++
Sbjct: 159 LEEM 162


>gi|91203414|emb|CAJ71067.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 151

 Score = 84.4 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 9/136 (6%)

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPES---WHKEEEKAANDLGIQLINFPLSATREL 112
           +QP+   I+    + G KS++NLR    E      KEE       G++ ++ P+S   E+
Sbjct: 15  SQPSEEEIKK-LPQQGFKSVVNLRASGEEDQPLSPKEEGDLVKKTGMKYLHIPVSTKEEI 73

Query: 113 NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ---LSMLY 169
             E + +    ++  P P+ +HC +G  R G  + +Y  +      EEA ++   +    
Sbjct: 74  KPELVDRFRKEIELLPAPVFVHCHTGK-RAGAFTMMYQALKEGVTGEEAIQKAESMGFAC 132

Query: 170 GHFPVLKTITMDITFE 185
              P LK   +D   +
Sbjct: 133 D-VPQLKAFFIDYINQ 147


>gi|298706396|emb|CBJ29405.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 182

 Score = 84.4 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 54/152 (35%), Gaps = 15/152 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    ++RS  P         +  G++SIL L    PES      + A + G+ + 
Sbjct: 41  NFSMVSEG-VFRSGYPIACNF-PFLRRLGLQSILCL---CPESVLPGSLEWAKESGVSME 95

Query: 103 NFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              L              +      +     +P+L+HC +G  +TG A         ++ 
Sbjct: 96  MCDLGENSPPFVSMPLAAMRKAVDYLSDCRNRPVLVHCLTGKTQTGCAIGCLR-RRQNW- 153

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
              A   +   Y  F       +D+ F ++ +
Sbjct: 154 ---ALGAIFDEYTRFAGPSAKPLDMQFIELFE 182


>gi|225715140|gb|ACO13416.1| Dual specificity protein phosphatase 23 [Esox lucius]
          Length = 151

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 11/135 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P ++   A+P  T       + GI+ ++ L  + P ++           G++L
Sbjct: 7   PNFSWVEPKKLAGLARPQLTAHYQYLLDNGIQHLVCLCERKPPNYD-------TVPGVKL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPK 158
            +  ++       EQI++ +SI++ A      + +HC  G  RTG   A YL        
Sbjct: 60  HHINITDFSPPTPEQIQRFLSIVEQANAKSEGVAVHCMHGHGRTGTMLACYLVKTRKMSG 119

Query: 159 EEAHRQL-SMLYGHF 172
            +A +++  + +G  
Sbjct: 120 IDAIKEIRRIRHGSI 134


>gi|156843003|ref|XP_001644571.1| hypothetical protein Kpol_1003p18 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115217|gb|EDO16713.1| hypothetical protein Kpol_1003p18 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 184

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 44  FHAVVPHEI--YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           F  VV  ++  YRS  P      ++K +  +++I+ +     +   +E  K   D  I  
Sbjct: 15  FSPVVSTDVSIYRSGYPMPLNYPFIKDQLNLRTIIYI--GDRKDISEEYSKFLEDEKISY 72

Query: 102 INFPLSATRE--LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            +  + + R+  + D   + L  +L     P+LIH   G  R G+   +   ++  +   
Sbjct: 73  HHIFMDSCRDEGIEDRMNEVLNLVLDVGNYPILIHSNKGKHRVGVVVGIIRKLLQGWSTA 132

Query: 160 EAHRQLSM 167
             +++ ++
Sbjct: 133 GIYQEYNI 140


>gi|161529268|ref|YP_001583094.1| dual specificity protein phosphatase [Nitrosopumilus maritimus
           SCM1]
 gi|160340569|gb|ABX13656.1| dual specificity protein phosphatase [Nitrosopumilus maritimus
           SCM1]
          Length = 169

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 48/132 (36%), Gaps = 13/132 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL-PESWHKEEEKAANDLGIQ 100
            NF  ++  ++  S  P            G+KSI+ +     P++W +          I 
Sbjct: 25  TNFSWLIEEKLAGSGMPTSFDEFDWIVNQGVKSIVTMTENSLPDNWVQ---------NIG 75

Query: 101 LINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            ++ P       + E I   +  +    T    +++HC +G  R G   A Y      + 
Sbjct: 76  YLHVPTPDFTAPDMENIDSAVDFIHEQITNDHAVMVHCAAGMGRAGTILACYFVKYKKFT 135

Query: 158 KEEAHRQLSMLY 169
            E+A +++    
Sbjct: 136 AEDAIKKIREER 147


>gi|110833348|ref|YP_692207.1| hypothetical protein ABO_0487 [Alcanivorax borkumensis SK2]
 gi|110646459|emb|CAL15935.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 179

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 66/157 (42%), Gaps = 6/157 (3%)

Query: 18  ILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILN 77
           +L   +V+  ++L +Y         +F  V   ++YRS       I  + +  G+ +I+N
Sbjct: 2   LLYIAIVISVLALVIYRY--RKLMYHFRVVERRKLYRSGTLGPIGIRIMHRILGVNTIVN 59

Query: 78  LRGKLPE---SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIH 134
           LR +       W+ ++       G++L+N P++      + QI   I  L  A    L+H
Sbjct: 60  LRLESEYSKNGWYFKQLDYCRRHGVKLVNIPMAQDTPPTEAQIVAFIEELGRADSRCLVH 119

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
           C+ G  RTG+              E A  Q   LYGH
Sbjct: 120 CEMGVIRTGMMVVAVATRCYGVT-EMAVWQHFPLYGH 155


>gi|254578750|ref|XP_002495361.1| ZYRO0B09482p [Zygosaccharomyces rouxii]
 gi|238938251|emb|CAR26428.1| ZYRO0B09482p [Zygosaccharomyces rouxii]
          Length = 218

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/164 (20%), Positives = 57/164 (34%), Gaps = 21/164 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+         +  +K+I+ L  + P+          +   IQL 
Sbjct: 49  NFCPV-ERYLYRSGQPSPVNF-PFLLDLNLKTIIWLANEEPQDSLL---VFCDRHDIQLQ 103

Query: 103 NFPLSATRELNDE---------QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++     +D           I  L +I+     PLL+ C  G  RTG        I+
Sbjct: 104 FAAINPDGGEDDNPWDGLTEHSIINALQTIVDQDNYPLLVCCGMGRHRTGTVIGCLRRIM 163

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
             +        +S  Y  F   +   +    E + + +  N  K
Sbjct: 164 -GWN----LASVSEEYRRFTGSRGGRI--LVELLIEAFDTNSVK 200


>gi|218889835|ref|YP_002438699.1| putative protein phosphatase [Pseudomonas aeruginosa LESB58]
 gi|218770058|emb|CAW25820.1| putative protein phosphatase [Pseudomonas aeruginosa LESB58]
          Length = 218

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA PN   +  L +   +K++++       +W            ++++
Sbjct: 48  NLYRMSP-TLYRSALPNAQNVA-LLQRLQVKTVVSFIKDDDRAWL-------GQAPVRVL 98

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P  A R  + E +  L  +       P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 99  SLPTHADRVDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158

Query: 162 HRQL 165
             ++
Sbjct: 159 LEEM 162


>gi|118576481|ref|YP_876224.1| protein-tyrosine phosphatase [Cenarchaeum symbiosum A]
 gi|118195002|gb|ABK77920.1| protein-tyrosine phosphatase [Cenarchaeum symbiosum A]
          Length = 166

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 45/127 (35%), Gaps = 11/127 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+   +  S  P            G+KS++ +  +                 ++ 
Sbjct: 20  TNFSWVIEGSLAGSGMPTTAGEFGWLLSQGVKSVVTMTQEALPGEW--------TNRVEY 71

Query: 102 INFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
            + P         E I+  +S ++    A    ++HC +G  RTG   A YL     +  
Sbjct: 72  CHVPTPDMGSPGMEGIESAVSFIRGQIAAGNAAVVHCAAGMGRTGTILACYLVKHEGHSA 131

Query: 159 EEAHRQL 165
           +EA  ++
Sbjct: 132 DEAITRI 138


>gi|119501138|ref|XP_001267326.1| tyrosine phosphatase family protein [Neosartorya fischeri NRRL 181]
 gi|119415491|gb|EAW25429.1| tyrosine phosphatase family protein [Neosartorya fischeri NRRL 181]
          Length = 166

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 50/129 (38%), Gaps = 13/129 (10%)

Query: 83  PESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKS 137
              + ++ +    + GI+     + A ++             L  +L  A  PLL+HC  
Sbjct: 7   EGDYTQDHQVFLEENGIEHRRILILANKDPTIRTPDHVVNRVLEIMLNKANHPLLLHCNK 66

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI---TQLYPNN 194
           G  RTG     +   V  +      ++    Y +F   K+  +D  F ++   T+L P  
Sbjct: 67  GKHRTGCIVGCFR-KVQGWDMPAIRKE----YINFSWPKSRPLDERFIELFDDTRLRPLA 121

Query: 195 VSKGDTEQP 203
           VS G +  P
Sbjct: 122 VSSGASSWP 130


>gi|327188528|gb|EGE55739.1| protein tyrosine/serine phosphatase [Rhizobium etli CNPAF512]
          Length = 191

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 67/135 (49%), Gaps = 10/135 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P   +RSAQ     ++   +  GIK+I++LR          +        I+L+
Sbjct: 45  NLYRITP-TFFRSAQIRKDDVKA-IRLLGIKTIVSLR------AFHSDRNLPGLERIKLV 96

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
             P++     +++ I  L +I       P+L+HC+ G+DRTG+ +A+Y  +   + +++A
Sbjct: 97  GVPMNTWHIEDEDIIAALRAIRSAEKHGPVLLHCQHGSDRTGVVTAMYRVVFQKWSRKKA 156

Query: 162 HRQL-SMLYGHFPVL 175
             +L S  +G+  + 
Sbjct: 157 LDELQSGGFGYHAIW 171


>gi|111226554|ref|XP_001134556.1| hypothetical protein DDB_G0281953 [Dictyostelium discoideum AX4]
 gi|121962478|sp|Q1ZXG8|D1060_DICDI RecName: Full=Probable tyrosine-protein phosphatase DG1060;
           AltName: Full=Developmental gene 1060 protein
 gi|90970644|gb|EAS66873.1| hypothetical protein DDB_G0281953 [Dictyostelium discoideum AX4]
          Length = 166

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 54/150 (36%), Gaps = 15/150 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QPN        ++  +K I+ L    P    +   +   D  I+LI
Sbjct: 9   NFGMVADD-LYRSGQPNELNF-PFLEKLQLKKIIFLAPDDPSQQFQNFVE---DQDIELI 63

Query: 103 NFPLSA----TRELNDEQIKQ-LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  +         +++E +   L  IL     PL I C  G  RTG        +   + 
Sbjct: 64  HLGMDTHQNPWNPISEEIVISALKIILNPDNYPLHIMCNLGRHRTGTVVGCLRKL-QRWN 122

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +   Y  F   K   ++  F ++
Sbjct: 123 ----LTSIFEEYRRFAGSKVKLLNEQFIEL 148


>gi|158333648|ref|YP_001514820.1| Rieske iron-sulfur (cyt b6f) fusion protein [Acaryochloris marina
           MBIC11017]
 gi|158303889|gb|ABW25506.1| rieske iron-sulfur (cyt b6f) fusion protein [Acaryochloris marina
           MBIC11017]
          Length = 343

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 59/134 (44%), Gaps = 4/134 (2%)

Query: 57  QPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
           QP    I     + G KS+LNLR    + +   E +  +  G+   N P++   +L++  
Sbjct: 208 QPTPDQI-QDAAQLGFKSVLNLRSPQEDGFLINESQLVHSAGMNYANLPINPA-DLSEAT 265

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLK 176
            +Q+++I+    KP+L+HCK G  R+G  + +Y  +   +  ++   Q+  L        
Sbjct: 266 AEQVLTIIDQLSKPILLHCKGGL-RSGAMALLYEAVHQQWTTDQLLAQVHKLDLPLA-AH 323

Query: 177 TITMDITFEKITQL 190
              +    + +   
Sbjct: 324 PQLLHFIQDYVDAQ 337


>gi|325280120|ref|YP_004252662.1| hypothetical protein Odosp_1446 [Odoribacter splanchnicus DSM
           20712]
 gi|324311929|gb|ADY32482.1| hypothetical protein Odosp_1446 [Odoribacter splanchnicus DSM
           20712]
          Length = 170

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 9/124 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +NF+ +    +YRS QP+        +++G++ ILNLR       +  + K A    + L
Sbjct: 25  KNFYRIGDG-VYRSDQPSAA-CFRELEKFGMREILNLRC------YHTDTKEAQGTSLIL 76

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
            + P  AT  L  + +   + I++    PLL HC  G+DRTG  +A+Y  +  H PK+ A
Sbjct: 77  HHLPTRAT-LLRLDDLVTAMQIIRDRKGPLLFHCWHGSDRTGAVAAMYRMVFQHVPKQHA 135

Query: 162 HRQL 165
             ++
Sbjct: 136 IDEM 139


>gi|150865371|ref|XP_001384559.2| putative tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
 gi|149386627|gb|ABN66530.2| putative tyrosine phosphatase [Scheffersomyces stipitis CBS 6054]
          Length = 172

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 48/132 (36%), Gaps = 12/132 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V   +IYRS  P         K+  +K+I+ L          + ++      I+  
Sbjct: 7   NFALV-EDKIYRSGFPMPINY-PFLKQLKLKTIIYLDKHGTAEIMAQYQEWLTTTDIKFH 64

Query: 103 NFPLSATRELNDEQIKQ----------LISILKTAPKPLLIHCKSGADRTGLASAVYLYI 152
           N  + A++E  +   +           L  +L     P+LIH   G  RTG+   +   +
Sbjct: 65  NLLMEASQEPFNRPDEHQQAQESLTIALSLMLDKQNFPMLIHSNKGKHRTGVLVGLMRKL 124

Query: 153 VAHYPKEEAHRQ 164
           +  +       +
Sbjct: 125 LQGWSMSGIFEE 136


>gi|319411970|emb|CBQ74013.1| related to SIW14-Tyrosine phosphatase involved in actin
           filamentorganization [Sporisorium reilianum]
          Length = 233

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 51/146 (34%), Gaps = 15/146 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  PN    E   +   +KS+L L     E +            I+  
Sbjct: 86  NFSMVSRG-IYRSGHPNERNFE-FLRRLNLKSVLYL---GTEDYRANMTAWTAAQHIRTF 140

Query: 103 NFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           +  L+  +E   E  +      L  IL+    P+LIHC  G  R G    +   +   + 
Sbjct: 141 HLRLAINKEPTAEMDEADVVQALQLILRPENWPILIHCNKGKYRVGCVVGLLRRL-QGWS 199

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDIT 183
               H  +   Y  F   K   ++  
Sbjct: 200 ----HTSIFEEYSRFAGTKISDLEFI 221


>gi|71064100|gb|AAZ22508.1| Oca1p [Saccharomyces cerevisiae]
          Length = 238

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 57/162 (35%), Gaps = 17/162 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+            +K+I+ L  + P+    E     + + +Q  
Sbjct: 72  NFCPV-ERYLYRSGQPSPVNF-PFLLNLKLKTIIWLSNEEPQDTLLEFCDT-HRINLQFA 128

Query: 103 NFPLSATRELND-------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
                A  + N          I  L +I+     PLL+ C  G  RTG        I+  
Sbjct: 129 AINPDAGEDDNPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLRRIM-G 187

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           +        +S  Y  F   +   +    E + + +  N+ K
Sbjct: 188 WN----LASVSEEYRRFTGSRGGRI--LVELLIEAFDTNLVK 223


>gi|119489654|ref|ZP_01622413.1| hypothetical protein L8106_13055 [Lyngbya sp. PCC 8106]
 gi|119454391|gb|EAW35540.1| hypothetical protein L8106_13055 [Lyngbya sp. PCC 8106]
          Length = 150

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 12/151 (7%)

Query: 48  VPHEI-YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +  ++   + Q   T +     + G KS+LN R    E +  +EEK A   G++ +N P+
Sbjct: 7   INGQLSIATNQVTPTQL-QEAAQAGFKSVLNFRSPQEEGFLSDEEKQAEAAGLEYVNIPV 65

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH---R 163
            A   + DE  +++I  +   PKP+L+HCKSG  R+G  + +Y+ I      +      +
Sbjct: 66  KANG-ITDELAEKIIEQIDQLPKPILLHCKSGL-RSGAMALMYIAIKEKISADIILEQGK 123

Query: 164 QLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
           ++      FP +K              + NN
Sbjct: 124 EMGFDCNKFPEMKE-----FLITYISKHSNN 149


>gi|313109305|ref|ZP_07795272.1| putative protein phosphatase [Pseudomonas aeruginosa 39016]
 gi|310881774|gb|EFQ40368.1| putative protein phosphatase [Pseudomonas aeruginosa 39016]
          Length = 218

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA PN   +  L +   +K++++       +W            ++++
Sbjct: 48  NLYRMSP-TLYRSALPNAQSVA-LLQRLQVKTVVSFIKDDDRAWL-------GQAPVRVV 98

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P  A R  + E +  L  +       P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 99  SLPTHADRVDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158

Query: 162 HRQL 165
             ++
Sbjct: 159 LEEM 162


>gi|329766140|ref|ZP_08257699.1| dual specificity protein phosphatase [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329137411|gb|EGG41688.1| dual specificity protein phosphatase [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 165

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 50/131 (38%), Gaps = 11/131 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  ++  ++  S  P  +       + G+ SI+ +     E+   +E  +A    I  
Sbjct: 20  TNFSWLIEDKLAGSGMPTSSDEFDWIIKQGVTSIVTMT----ENALPDEWVSA----IGY 71

Query: 102 INFPLSATRELNDEQIKQLISILKT---APKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           ++ P       + E+I   +  +       + +++HC +G  R G   A Y      +  
Sbjct: 72  LHVPTPDLTAPDMERIDTAVDFIHEKISNDQTVMVHCAAGMGRAGTILACYFVKYQKFSA 131

Query: 159 EEAHRQLSMLY 169
           ++A  ++    
Sbjct: 132 KDAINKIRTER 142


>gi|323352559|gb|EGA85058.1| Oca1p [Saccharomyces cerevisiae VL3]
          Length = 238

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 57/162 (35%), Gaps = 17/162 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+            +K+I+ L  + P+    E     + + +Q  
Sbjct: 72  NFCPV-ERYLYRSGQPSPVNF-PFLLNLKLKTIIWLSNEEPQDTLLEFCDT-HRINLQFA 128

Query: 103 NFPLSATRELND-------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
                A  + N          I  L +I+     PLL+ C  G  RTG        I+  
Sbjct: 129 AINPDAGEDDNPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLRRIM-G 187

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           +        +S  Y  F   +   +    E + + +  N+ K
Sbjct: 188 WN----LASVSEEYRRFTGSRGGRI--LVELLIEAFDTNLVK 223


>gi|254569370|ref|XP_002491795.1| Putative protein with similarity to predicted tyrosine phosphatases
           Oca1p and Siw14p [Pichia pastoris GS115]
 gi|238031592|emb|CAY69515.1| Putative protein with similarity to predicted tyrosine phosphatases
           Oca1p and Siw14p [Pichia pastoris GS115]
 gi|328351704|emb|CCA38103.1| Putative tyrosine-protein phosphatase OCA1 [Pichia pastoris CBS
           7435]
          Length = 207

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 51/139 (36%), Gaps = 14/139 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +V   IYRS  P         ++  +K+I+ L G   +++  +  +   D GI   
Sbjct: 49  NFA-IVEDGIYRSGHPQAFNF-PYLQKLNLKTIIYL-GDKTDNY--DYYRWLRDQGIDFH 103

Query: 103 NFPLSATRELND-----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
              + +  E           + L  I+     P+LIH   G  R G+   +   ++  + 
Sbjct: 104 YLNMQSCVEPFMFKDDSVIQQALKLIVHKENYPMLIHSNKGKHRVGVLVGIMRKLLQGWC 163

Query: 158 KEEAHRQLSMLYGHFPVLK 176
                  +   YG F   K
Sbjct: 164 ISG----IFDEYGRFAGGK 178


>gi|116051921|ref|YP_789236.1| hypothetical protein PA14_13660 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296387597|ref|ZP_06877072.1| hypothetical protein PaerPAb_05562 [Pseudomonas aeruginosa PAb1]
 gi|115587142|gb|ABJ13157.1| putative protein phosphatase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 218

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA PN   +  L +   +K++++       +W            ++++
Sbjct: 48  NLYRMSP-TLYRSALPNAQSVA-LLQRLQVKTVVSFIKDDDRAWL-------GQAPVRVV 98

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P  A R  + E +  L  +       P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 99  SLPTHADRVDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158

Query: 162 HRQL 165
             ++
Sbjct: 159 LEEM 162


>gi|49078204|gb|AAT49761.1| PA3885 [synthetic construct]
          Length = 219

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA PN   +  L +   +K++++       +W            ++++
Sbjct: 48  NLYRMSP-TLYRSALPNAQSVA-LLQRLQVKTVVSFIKDDDRAWL-------GQAPVRVL 98

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P  A R  + E +  L  +       P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 99  SLPTHADRVDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158

Query: 162 HRQL 165
             ++
Sbjct: 159 LEEM 162


>gi|58263244|ref|XP_569032.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57223682|gb|AAW41725.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 157

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 54/151 (35%), Gaps = 16/151 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V     YRSAQP+        ++  +KSI+ +  + P        +     GI+L 
Sbjct: 2   NFGLVEDG-FYRSAQPS-ELCFSFLEKLNLKSIIWVGAEEPSDIFLSFIE---SQGIKLY 56

Query: 103 NFPLSATRELNDE------QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           N                   I+ L  +L+ +  P L+ C  G  RTG     Y  +    
Sbjct: 57  NLAPQTNHLPPLPPPPEPLIIQALTLLLRPSTFPTLLCCNMGRHRTGTVVGCYRKLQ--- 113

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
               A   +   Y  +  +K   ++  F ++
Sbjct: 114 --RWALSSILEEYRRYAGMKVRVLNEQFIEL 142


>gi|88900443|ref|NP_001034709.1| hypothetical protein LOC323834 [Danio rerio]
 gi|56208091|emb|CAI21375.1| novel protein similar to vertebrate dual specificity phosphatase 23
           (DUSP23) [Danio rerio]
 gi|111309264|gb|AAI21762.1| Si:dkeyp-95d10.1 [Danio rerio]
          Length = 161

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 54/131 (41%), Gaps = 10/131 (7%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
               NF  V P ++   A+P          ++GIK +++L    P ++     +   +  
Sbjct: 8   AEPPNFSWVEPCKLAGLARPTMVHHYRYLLDHGIKHLVSLLEIKPPNY-----EKCPE-- 60

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAH 155
           + L    +      +  QI Q +SI++ A      + +HC  G  RTG   A YL    H
Sbjct: 61  LSLHQISIVDFTPPSRSQILQFLSIVEKANAKGEGVAVHCAHGHGRTGTMLACYLVKSRH 120

Query: 156 YPKEEAHRQLS 166
              EEA +++ 
Sbjct: 121 LSGEEAIKEIR 131


>gi|6324230|ref|NP_014300.1| Oca1p [Saccharomyces cerevisiae S288c]
 gi|1730756|sp|P50946|OCA1_YEAST RecName: Full=Putative tyrosine-protein phosphatase OCA1; AltName:
           Full=Oxidant-induced cell-cycle arrest protein 1
 gi|189029255|sp|A6ZRY1|OCA1_YEAS7 RecName: Full=Putative tyrosine-protein phosphatase OCA1; AltName:
           Full=Oxidant-induced cell-cycle arrest protein 1
 gi|929854|emb|CAA90527.1| ORF N2194 [Saccharomyces cerevisiae]
 gi|1302010|emb|CAA95975.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|151944435|gb|EDN62713.1| oxidant-induced cell-cycle arrest [Saccharomyces cerevisiae YJM789]
 gi|190409088|gb|EDV12353.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gi|207341726|gb|EDZ69703.1| YNL099Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256271649|gb|EEU06690.1| Oca1p [Saccharomyces cerevisiae JAY291]
 gi|259149261|emb|CAY82503.1| Oca1p [Saccharomyces cerevisiae EC1118]
 gi|285814552|tpg|DAA10446.1| TPA: Oca1p [Saccharomyces cerevisiae S288c]
 gi|323303234|gb|EGA57032.1| Oca1p [Saccharomyces cerevisiae FostersB]
 gi|323307428|gb|EGA60702.1| Oca1p [Saccharomyces cerevisiae FostersO]
 gi|323331952|gb|EGA73364.1| Oca1p [Saccharomyces cerevisiae AWRI796]
 gi|323335801|gb|EGA77080.1| Oca1p [Saccharomyces cerevisiae Vin13]
          Length = 238

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 57/162 (35%), Gaps = 17/162 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+            +K+I+ L  + P+    E     + + +Q  
Sbjct: 72  NFCPV-ERYLYRSGQPSPVNF-PFLLNLKLKTIIWLSNEEPQDTLLEFCDT-HRINLQFA 128

Query: 103 NFPLSATRELND-------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
                A  + N          I  L +I+     PLL+ C  G  RTG        I+  
Sbjct: 129 AINPDAGEDDNPWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLRRIM-G 187

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           +        +S  Y  F   +   +    E + + +  N+ K
Sbjct: 188 WN----LASVSEEYRRFTGSRGGRI--LVELLIEAFDTNLVK 223


>gi|15599080|ref|NP_252574.1| protein tyrosine phosphatase TpbA [Pseudomonas aeruginosa PAO1]
 gi|107103400|ref|ZP_01367318.1| hypothetical protein PaerPA_01004470 [Pseudomonas aeruginosa PACS2]
 gi|254236783|ref|ZP_04930106.1| hypothetical protein PACG_02796 [Pseudomonas aeruginosa C3719]
 gi|9950065|gb|AAG07272.1|AE004805_10 protein tyrosine phosphatase TpbA [Pseudomonas aeruginosa PAO1]
 gi|126168714|gb|EAZ54225.1| hypothetical protein PACG_02796 [Pseudomonas aeruginosa C3719]
          Length = 218

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA PN   +  L +   +K++++       +W            ++++
Sbjct: 48  NLYRMSP-TLYRSALPNAQSVA-LLQRLQVKTVVSFIKDDDRAWL-------GQAPVRVL 98

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P  A R  + E +  L  +       P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 99  SLPTHADRVDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158

Query: 162 HRQL 165
             ++
Sbjct: 159 LEEM 162


>gi|213513848|ref|NP_001134900.1| Dual specificity protein phosphatase 23 [Salmo salar]
 gi|209737010|gb|ACI69374.1| Dual specificity protein phosphatase 23 [Salmo salar]
          Length = 151

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 61/151 (40%), Gaps = 12/151 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P ++   A P  T       + GI+ ++ L  + P ++           G++L
Sbjct: 7   PNFSWVEPTKLAGLAFPRMTAHYQYLLDNGIQHLVCLCERKPPNYD-------TVPGVKL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPK 158
            +  +        EQI++ +SI++ +      + +HC  G  RTG   A YL        
Sbjct: 60  HHINIIDFTPPTPEQIQRFLSIVEESNAKGEGVAVHCMHGHGRTGTMLACYLVKTRKISG 119

Query: 159 EEAHRQL-SMLYGHF-PVLKTITMDITFEKI 187
            +A  ++  + +G      +   +   +++I
Sbjct: 120 IDAINEIRRLRHGSIETHDQEKAVVQFYQRI 150


>gi|223590114|sp|A5DE24|OCA1_PICGU RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|190345526|gb|EDK37427.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 185

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 54/151 (35%), Gaps = 16/151 (10%)

Query: 37  ITTFTQ-NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE------ 89
           +      NF  V   ++YRS QP+    +   ++  +K+I+ L  + P+    +      
Sbjct: 11  LRIIPPLNFCPV-EKQLYRSGQPSIIN-QSFLQDLNLKTIIWLASEEPQEEFLDYCSMNS 68

Query: 90  -EEKAANDLGIQLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASA 147
              +    +        ++    LN+  IK+ + ++      P+L+ C  G  RTG    
Sbjct: 69  INIEFVGMINDDYSYQNVNPWDSLNETTIKKALELICDRNNYPMLVCCGMGRHRTGTVIG 128

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTI 178
               +   +        +S  Y  F   +  
Sbjct: 129 CLRRL-QGWN----LASVSEEYRRFTGARGG 154


>gi|119477626|ref|ZP_01617776.1| hypothetical protein GP2143_09195 [marine gamma proteobacterium
           HTCC2143]
 gi|119449129|gb|EAW30369.1| hypothetical protein GP2143_09195 [marine gamma proteobacterium
           HTCC2143]
          Length = 194

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/168 (16%), Positives = 60/168 (35%), Gaps = 12/168 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF          + QP     + +    G   ++ +      +   + ++   DLG++ 
Sbjct: 34  TNFRQ-YSATFASAGQPTREQFK-MLAGQGFDRVVYIAFTSNPNALPDADQLVKDLGMEY 91

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           ++ P++    L D+      S+ + + K  L+HC+  A R    + +Y  I       EA
Sbjct: 92  MHVPVAFDNPLADDFYAFADSMQRNSGKKTLLHCQVNA-RATAFAFLYRVINEGMDIAEA 150

Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK--GDTEQPMNAT 207
              ++           +  D  F  + Q   N++S      +  +  T
Sbjct: 151 KSDMNT----IWQPNKVWRDFIFAVLAQ---NDISPDCETCDWTLPPT 191


>gi|254576919|ref|XP_002494446.1| ZYRO0A01650p [Zygosaccharomyces rouxii]
 gi|238937335|emb|CAR25513.1| ZYRO0A01650p [Zygosaccharomyces rouxii]
          Length = 187

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 50/126 (39%), Gaps = 6/126 (4%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV     +YRS  P      +++ +  +++I+++     +    E  +      IQ
Sbjct: 24  NFSPVVSTDVSLYRSGYPMPLNYPFIRDQLHLRTIIHV--GDKQDLSPEYAEFLEQGNIQ 81

Query: 101 LINFPLSATREL--NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             N  + + R+    D   + L  +L     P+LIH   G  R G    +   ++  +  
Sbjct: 82  FHNIYMDSCRDDGFKDRMNQILEIVLNVDNYPMLIHSGKGKHRVGTVVGIIRKLLQGWSI 141

Query: 159 EEAHRQ 164
              +++
Sbjct: 142 AGIYQE 147


>gi|327290607|ref|XP_003230014.1| PREDICTED: dual specificity protein phosphatase 23-like [Anolis
           carolinensis]
          Length = 151

 Score = 82.1 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 53/140 (37%), Gaps = 11/140 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P  +   A P          E GI+ +++L  + P   H          GI +
Sbjct: 7   PNFSWVEPGRLAGLAMPRLPAHYRYMYENGIRHLVSLTERSP-PHHDTCP------GIHV 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               ++     + EQI++ + I++ A    +   +HC  G  RTG   A YL        
Sbjct: 60  HRLRIADFHPPSPEQIQRFLQIVEDANAKGEAAAVHCMLGFGRTGTMLACYLVKTQKISG 119

Query: 159 EEAHRQLS-MLYGHFPVLKT 177
            +A R++  + +G       
Sbjct: 120 ADAIREIRKLRHGSIETPDQ 139


>gi|318101979|ref|NP_001187589.1| dual specificity protein phosphatase 23 [Ictalurus punctatus]
 gi|308323438|gb|ADO28855.1| dual specificity protein phosphatase 23 [Ictalurus punctatus]
          Length = 152

 Score = 82.1 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 56/159 (35%), Gaps = 17/159 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V PH++     P  T         GIK ++ L  +    +H          G+ L
Sbjct: 7   PNFSWVDPHKLAGLGMPRMTAHYQFLLNNGIKHLITL-SERKPPYHDTCP------GLTL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPK 158
            +  +        +QIK+ +SI++ A      + +HC  G  RTG   A YL        
Sbjct: 60  HHIRIHDFCAPTFDQIKRFLSIVEEANSKGEGVAVHCLHGFGRTGTMLACYLVESRKISG 119

Query: 159 EEAHRQLS-MLYGHFPVLKTITMDITFEKITQLYPNNVS 196
            +A  ++  +  G              + I Q Y  N  
Sbjct: 120 IDAINEIRKIRRGSIET------QEQEQMIVQFYQQNKC 152


>gi|156841424|ref|XP_001644085.1| hypothetical protein Kpol_505p3 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114720|gb|EDO16227.1| hypothetical protein Kpol_505p3 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 284

 Score = 82.1 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 58/162 (35%), Gaps = 17/162 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+            +K+I+ L  + P+    E  +  ND+ +Q  
Sbjct: 118 NFCPV-ERYLYRSGQPSPVNF-PFLSNLNLKTIIWLANEEPQDTLLEFCET-NDIELQFS 174

Query: 103 NFPLSATRELND-------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
                A  + N          I  L +I+     PLLI C  G  RTG        ++  
Sbjct: 175 AINPDAGEDDNPWDGLTENSIINALQTIVSNKSYPLLICCGMGRHRTGTVVGCLRRLM-G 233

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           +        +S  Y  F   +   +    E + + +   + K
Sbjct: 234 WN----LASVSEEYRRFTGSRGGRI--LVELLIEAFDTKLVK 269


>gi|321248739|ref|XP_003191224.1| hypothetical protein CGB_A1470C [Cryptococcus gattii WM276]
 gi|317457691|gb|ADV19437.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 159

 Score = 81.7 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 55/153 (35%), Gaps = 18/153 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V     YRSAQP+        ++  +KSI+ +  + P        +     GI+L 
Sbjct: 2   NFGLVEDG-FYRSAQPS-ELCFSFLEKLNLKSIIWVGAEEPSDIFLSFIE---SQGIKLY 56

Query: 103 NFPLSATRELNDE--------QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
           N       +             I+ L  +L+ +  P L+ C  G  RTG     Y  +  
Sbjct: 57  NLAPQTKTDHLPPLPPPPEPLIIQALTLLLRPSTFPTLLCCNMGRHRTGTVVGCYRKLQ- 115

Query: 155 HYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                 A   +   Y  +  +K   ++  F ++
Sbjct: 116 ----RWALSSILEEYRRYAGMKVRVLNEQFIEL 144


>gi|50288433|ref|XP_446646.1| hypothetical protein [Candida glabrata CBS 138]
 gi|74610046|sp|Q6FSZ8|OCA1_CANGA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|49525954|emb|CAG59573.1| unnamed protein product [Candida glabrata]
          Length = 217

 Score = 81.7 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 55/169 (32%), Gaps = 21/169 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+            +K+I+ L  + P+    E     + + +Q  
Sbjct: 51  NFCPV-ERYLYRSGQPSPVNF-PFLLNLNLKTIVWLANEEPQDSLLEFCDT-HKINLQFA 107

Query: 103 NFPLSATRELND-------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
                A  + N          I  L +I+     PLL+ C  G  RTG        I+  
Sbjct: 108 AINPDAGEDDNPWDGLTEHSIINVLQTIVTKENYPLLVCCGMGRHRTGTVIGCLRRIM-G 166

Query: 156 YPKEEAHRQLSMLYGHFPVLKTI------TMDITFEKITQLYPNNVSKG 198
           +        +S  Y  F   +         ++     + ++   N    
Sbjct: 167 WN----LASVSEEYRRFTGSRGGRILVELLIEAFDTALVEIDKKNAPDW 211


>gi|62202153|gb|AAH92774.1| Si:dkeyp-95d10.1 [Danio rerio]
          Length = 177

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 54/131 (41%), Gaps = 10/131 (7%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
               NF  V P ++   A+P          ++GIK +++L    P ++     +   +  
Sbjct: 24  AEPPNFSWVEPCKLAGLARPTMVHHYRYLLDHGIKHLVSLLEIKPPNY-----EKCPE-- 76

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAH 155
           + L    +      +  QI Q +SI++ A      + +HC  G  RTG   A YL    H
Sbjct: 77  LSLHQISIVDFTPPSRSQILQFLSIVEKANAKGEGVAVHCAHGHGRTGTMLACYLVKSRH 136

Query: 156 YPKEEAHRQLS 166
              EEA +++ 
Sbjct: 137 LSGEEAIKEIR 147


>gi|81097645|gb|AAI09415.1| Si:dkeyp-95d10.1 protein [Danio rerio]
          Length = 181

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/131 (22%), Positives = 54/131 (41%), Gaps = 10/131 (7%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
               NF  V P ++   A+P          ++GIK +++L    P ++     +   +  
Sbjct: 28  AEPPNFSWVEPCKLAGLARPTMVHHYRYLLDHGIKHLVSLLEIKPPNY-----EKCPE-- 80

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAH 155
           + L    +      +  QI + +SI++ A      + +HC  G  RTG   A YL    H
Sbjct: 81  LSLHQISIVDFTPPSRSQILRFLSIVEKANAKGEGVAVHCAHGHGRTGTMLACYLVKSRH 140

Query: 156 YPKEEAHRQLS 166
              EEA +++ 
Sbjct: 141 LSGEEAIKEIR 151


>gi|261206472|ref|XP_002627973.1| tyrosine phosphatase [Ajellomyces dermatitidis SLH14081]
 gi|239593032|gb|EEQ75613.1| tyrosine phosphatase [Ajellomyces dermatitidis SLH14081]
          Length = 231

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 50/124 (40%), Gaps = 12/124 (9%)

Query: 78  LRGKLPESWHKEEEKAANDLGIQLINFPLSATR-----ELNDEQIKQLISILKTAPKPLL 132
           LR    E W ++  +   + GI+    P+ A +        +  I+ L+ IL     P+L
Sbjct: 53  LRPLFDEEWSRDYGEFIQENGIKSYVIPILANKNPLVFTPYETVIEVLMLILNPMNHPVL 112

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
           IHC  G  RTG   A +   V  +    A ++    Y      K+  +D     I    P
Sbjct: 113 IHCNKGKHRTGCVIACFR-RVQGWSLMAALQE----YQKHSTPKSRVLDR--NYIEGFDP 165

Query: 193 NNVS 196
           N++S
Sbjct: 166 NSLS 169


>gi|50424373|ref|XP_460773.1| DEHA2F09482p [Debaryomyces hansenii CBS767]
 gi|74601445|sp|Q6BLZ8|OCA1_DEBHA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|49656442|emb|CAG89114.1| DEHA2F09482p [Debaryomyces hansenii]
          Length = 196

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 63/179 (35%), Gaps = 21/179 (11%)

Query: 36  TITTFTQ-NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEE---- 90
           T+      NF  V   ++YRS QP+    +   ++  +K+IL L  + P+    +     
Sbjct: 25  TVRIIPPLNFCPV-EKQLYRSGQPSIIN-QSFLQDLNLKTILWLASEEPQEDFLDYCSMN 82

Query: 91  --EKAANDLGIQLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASA 147
                   L  +     ++    L+++ IK+ + ++      PLL+ C  G  RTG    
Sbjct: 83  NIAVEFVGLMNEYSYQNVNPWDALSEDTIKKALELICNKENYPLLVCCGMGRHRTGTVIG 142

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTI------TMDITFEKITQLYPNNVSKGDT 200
               +   +        +S  Y  F   +         ++       Q+ P  +    T
Sbjct: 143 CLRRL-QGWN----LASVSEEYRRFTGSRGGRIMVELLIESFDINSVQIDPTKMPGWLT 196


>gi|254242576|ref|ZP_04935898.1| hypothetical protein PA2G_03330 [Pseudomonas aeruginosa 2192]
 gi|126195954|gb|EAZ60017.1| hypothetical protein PA2G_03330 [Pseudomonas aeruginosa 2192]
          Length = 218

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA PN   +  L +   ++++++       +W            ++++
Sbjct: 48  NLYRMSP-TLYRSALPNAQSVA-LLQRLQVRTVVSFIKDDDRAWL-------GQAPVRVL 98

Query: 103 NFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + P  A R  + E +  L  +       P+L+HCK G +RTGL +A+Y  +V  + K+ A
Sbjct: 99  SLPTHADRVDDAEVLSVLRQLQAAEREGPVLMHCKHGNNRTGLFAAMYRIVVQGWDKQAA 158

Query: 162 HRQL 165
             ++
Sbjct: 159 LEEM 162


>gi|50553744|ref|XP_504283.1| YALI0E22880p [Yarrowia lipolytica]
 gi|74633417|sp|Q6C4X9|OCA1_YARLI RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|49650152|emb|CAG79882.1| YALI0E22880p [Yarrowia lipolytica]
          Length = 253

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/165 (18%), Positives = 54/165 (32%), Gaps = 16/165 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V  + +YRS QP         ++  +++IL L  + P          A+D  I + 
Sbjct: 93  NFGPVERN-LYRSGQPEPISF-PFLEKLRLRTILWLAVEDPS---DNFLAFADDHEIVVH 147

Query: 103 NFPLSATRELNDE------QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +  L        +       +  L  I+     PLL+ C  G  RTG        +   +
Sbjct: 148 HLGLVTEGTNPWDQLTESSIVAALQIIMDRDSYPLLVCCGMGRHRTGTIVGCLRRL-QGW 206

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDIT--FEKITQL-YPNNVSKG 198
                  +    Y      + +       F+    + YP +  + 
Sbjct: 207 NLASVSEEYR-RYAGSRGGRALIELHIEAFDTSRIIVYPESAPEW 250


>gi|320580846|gb|EFW95068.1| Putative protein tyrosine phosphatase [Pichia angusta DL-1]
          Length = 208

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 54/140 (38%), Gaps = 11/140 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK---EEEKAANDLGI 99
           NF  V  H +YRS QP+        ++  +KS++ L  + P+       EE        +
Sbjct: 47  NFCPVEKH-LYRSGQPSAIN-HSFLQQLHLKSVIWLATEEPQDTFLRFMEENDINLFCNL 104

Query: 100 QLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
              +   ++   L++  IKQ + I+      PLL+ C  G  RTG        +   +  
Sbjct: 105 GYDSIDSNSWDGLSESSIKQALEIISDKRHYPLLVCCGMGRHRTGTVIGCLRKL-QGWN- 162

Query: 159 EEAHRQLSMLYGHFPVLKTI 178
                 +S  Y  F  ++  
Sbjct: 163 ---LASVSEEYRRFTGVRGG 179


>gi|121997594|ref|YP_001002381.1| dual specificity protein phosphatase [Halorhodospira halophila SL1]
 gi|121588999|gb|ABM61579.1| dual specificity protein phosphatase [Halorhodospira halophila SL1]
          Length = 182

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 32/159 (20%), Positives = 64/159 (40%), Gaps = 10/159 (6%)

Query: 7   PRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTF-TQNFHAVVPHEIYRSAQPNGTFIEY 65
            ++   +++  + L    L    L  +     T        + P  +YR+ +     +  
Sbjct: 1   MKRIRKLWHATVDL----LEGAFLNGWQAFFQTVGYYRLIPIEPGVLYRTTEMPPQRLVA 56

Query: 66  LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK 125
           L +  G++++++LR        + E  A    GI+ ++ P  + +  +   +   + ++ 
Sbjct: 57  LCRAQGVRTVIDLR--RKAHRAEAEAAALEPAGIRHVHLP--SAQVPDASTVAAFLELMD 112

Query: 126 T-APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
             A  P++IHC  G  RTG   AVYL        E A R
Sbjct: 113 DPANGPVVIHCVHGVGRTGALMAVYLMEYRGLDNESARR 151


>gi|45187623|ref|NP_983846.1| ADL250Wp [Ashbya gossypii ATCC 10895]
 gi|44982361|gb|AAS51670.1| ADL250Wp [Ashbya gossypii ATCC 10895]
          Length = 181

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 53/138 (38%), Gaps = 11/138 (7%)

Query: 43  NFHAVVPH--EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           NF  VV     +YRS  P      ++K      +++ +     +   +E +       I+
Sbjct: 7   NFALVVSRDVSLYRSGYPMPLNYPFIKTRLQAGTVIYV---GDKDISEEYKAFLESEQIR 63

Query: 101 LINFPLSATRE--LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             +  + + R+  + +   + L  +L     P+LIH   G  R G+   +   ++  +  
Sbjct: 64  YHHIYMQSCRDDNIQESMEQVLRLVLNVDNYPILIHSNKGKHRVGVVVGIIRKLLQGWSV 123

Query: 159 EEAHRQLSMLYGHFPVLK 176
              +++    YG F   +
Sbjct: 124 TGIYQE----YGIFSGGQ 137


>gi|209730520|gb|ACI66129.1| Dual specificity protein phosphatase 23 [Salmo salar]
          Length = 124

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 51/125 (40%), Gaps = 10/125 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P ++   A P  T       + GI+ ++ L  + P ++           G++L
Sbjct: 7   PNFSWVEPTKLAGLAFPRMTAHYQYLLDNGIQHLVCLCERKPPNYD-------TVPGVKL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPK 158
            +  +        EQI++ +SI++ +      + +HC  G  RTG   A YL        
Sbjct: 60  HHINIIDFTPPTPEQIQRFLSIVEESNAKGEGVAVHCMHGHGRTGTMLACYLVKTRKISG 119

Query: 159 EEAHR 163
            +A +
Sbjct: 120 IDAIK 124


>gi|224168487|ref|XP_002190472.1| PREDICTED: similar to dual specificity phosphatase 23 [Taeniopygia
           guttata]
          Length = 183

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/140 (23%), Positives = 57/140 (40%), Gaps = 11/140 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   +   A P         ++ G++ +++L  + P               I+L
Sbjct: 7   PNFSWVVEGRLAGLAMPREPGHYRYLRDLGVRHLVSLSERAPP-------HHGCCPQIRL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYLYIVAHYPK 158
             FP++     + EQI+  +SI++ A      + +HC  G  RTG   A YL    H P 
Sbjct: 60  HRFPVADFTPPSPEQIRSFLSIVEEANGRGEAVAVHCMLGHGRTGTLLACYLCQERHLPA 119

Query: 159 EEAHRQL-SMLYGHFPVLKT 177
            +A R++  +  G     + 
Sbjct: 120 ADAIREIRRLRPGSIETPEQ 139


>gi|158338681|ref|YP_001519858.1| dual specificity protein phosphatase [Acaryochloris marina
           MBIC11017]
 gi|158308922|gb|ABW30539.1| dual specificity protein phosphatase, putative [Acaryochloris
           marina MBIC11017]
          Length = 153

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 51/138 (36%), Gaps = 12/138 (8%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  ++P+++   + P+ T      +  GI +IL L  +  +    +        G     
Sbjct: 5   FSWIIPNQLAVGSFPHQTTSASQLRREGITAILCLNEEGEQPVPDD-----IQHGFLWQR 59

Query: 104 FPLSA---TRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYP 157
            P+         ++EQ  Q + IL    +    + +HC +G  R+     +Y+       
Sbjct: 60  VPIPDGFTGGVPSEEQFDQALKILNRWQRKGHVVYVHCLAGVGRSASVCCLYVAQKQGLG 119

Query: 158 KEEAHRQLSMLYGHFPVL 175
            E+A   +   + H+   
Sbjct: 120 LEDAIAFVKEQH-HYASP 136


>gi|198415750|ref|XP_002120903.1| PREDICTED: similar to protein tyrosine phosphatase, mitochondrial 1
           [Ciona intestinalis]
          Length = 190

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 59/182 (32%), Gaps = 13/182 (7%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           L        ++ L  +T   +       +   +   A P  +  + L +  G+K ++ + 
Sbjct: 8   LSFYPTLVYNVLLEKVTSRAWYTR----IDGTVLVGALPFRSMTKTLVENEGVKGVVTMN 63

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA--TRELNDEQIKQLISILKTAPKP--LLIHC 135
                       +   + G+  +              +  K +  IL+   +   + +HC
Sbjct: 64  EDYELKRFVNTPEEWKESGVTQLKLTTVDLIAAPSQVDLKKGVDFILEHRARSESVYVHC 123

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNV 195
           K+G  R+   +  YL    ++   EA  +L     H  + K        + I   Y  N 
Sbjct: 124 KAGRTRSATVAVCYLMTAYNWTPTEAINKLKSQRPHVWLRKP-----QLDSIDCFYKENF 178

Query: 196 SK 197
            K
Sbjct: 179 DK 180


>gi|330503207|ref|YP_004380076.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina NK-01]
 gi|328917493|gb|AEB58324.1| protein tyrosine/serine phosphatase [Pseudomonas mendocina NK-01]
          Length = 232

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 59/122 (48%), Gaps = 10/122 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N + + P  +YRSA P         +  GI +++N   +  E W  +         +  +
Sbjct: 62  NLYRMTPD-LYRSALPAARD-WPQLQALGIATVINFYQRGDEQWLGDPR-------VHQV 112

Query: 103 NFPLSATRELNDEQIKQLISILK-TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           + PL   R  + + I+ L SI +  +   +LIHCK G +RTGL +A+Y  I  ++ KE+A
Sbjct: 113 HLPLRTDRIDDTDVIEVLRSIRQAQSRGTVLIHCKHGQNRTGLIAALYRVIYQNWSKEQA 172

Query: 162 HR 163
             
Sbjct: 173 LA 174


>gi|190572508|ref|YP_001970353.1| hypothetical protein Smlt0440 [Stenotrophomonas maltophilia K279a]
 gi|190010430|emb|CAQ44038.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 166

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 54/120 (45%), Gaps = 4/120 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
            + V P  +Y   QP+           G++++++LR    +     E + A  LG++ + 
Sbjct: 26  LNEVRPG-LYAGGQPSAAQ-LQALAAQGVRTVIDLRQPGEDRGFD-ETRVAESLGLRYVR 82

Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
            P++    L+   ++ +   L+ +  P+L+HC SG +R G    +      H   E+A +
Sbjct: 83  IPVAGADGLDTANVRAVHLALQQSQGPVLLHCASG-NRAGAVLGLVNARYEHASPEQALQ 141


>gi|50539984|ref|NP_001002462.1| dual specificity protein phosphatase 23 [Danio rerio]
 gi|49904610|gb|AAH76357.1| Zgc:92902 [Danio rerio]
          Length = 152

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 56/159 (35%), Gaps = 17/159 (10%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P ++   A P  T         GIK ++ L  + P            D  + L
Sbjct: 7   PNFSWVDPGKVAGLAMPRMTAHYQYLLNSGIKHLVTLTERKPPDH-----DTCPD--LTL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
            +  ++       EQI + ++I++ A    + + +HC  G  RTG   A YL        
Sbjct: 60  HHIKINDFCAPTFEQINRFLTIVEEANASGQAVAVHCLHGFGRTGTMLACYLVKSRKISG 119

Query: 159 EEAHRQL-SMLYGHFPVLKTITMDITFEKITQLYPNNVS 196
            +A  ++  +  G              + I Q Y  N  
Sbjct: 120 IDAINEIRRIRRGSIETR------EQEQMIVQFYQQNKV 152


>gi|259089293|ref|NP_001158684.1| Dual specificity protein phosphatase 23 [Oncorhynchus mykiss]
 gi|225705814|gb|ACO08753.1| Dual specificity protein phosphatase 23 [Oncorhynchus mykiss]
          Length = 151

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 61/151 (40%), Gaps = 12/151 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P ++   A P  T       + GI+ ++ L  K P ++           G++L
Sbjct: 7   PNFSWVEPKKLAGLALPRMTAHYQYLLDNGIQHLVCLCEKKPPNYD-------TVPGVKL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPK 158
            +  +        EQI++ +SI++ +      + +HC  G  RTG   A YL        
Sbjct: 60  HHIKIIDFTPPTPEQIQRFLSIVEESNAKGEGVAVHCMHGHGRTGTMLACYLVKTRQISG 119

Query: 159 EEAHRQL-SMLYGHF-PVLKTITMDITFEKI 187
            +A  ++  + +G      +   +   +++I
Sbjct: 120 IDAISEVRRLRHGSIETHDQEKAVVQFYQRI 150


>gi|146419788|ref|XP_001485854.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 185

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 53/151 (35%), Gaps = 16/151 (10%)

Query: 37  ITTFTQ-NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE------ 89
           +      NF  V   ++YRS QP     +   ++  +K+I+ L  + P+    +      
Sbjct: 11  LRIIPPLNFCPV-EKQLYRSGQPLIIN-QSFLQDLNLKTIIWLASEEPQEEFLDYCSMNS 68

Query: 90  -EEKAANDLGIQLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASA 147
              +    +        ++    LN+  IK+ + ++      P+L+ C  G  RTG    
Sbjct: 69  INIEFVGMINDDYSYQNVNPWDSLNETTIKKALELICDRNNYPMLVCCGMGRHRTGTVIG 128

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTI 178
               +   +        +S  Y  F   +  
Sbjct: 129 CLRRL-QGWN----LASVSEEYRRFTGARGG 154


>gi|226502498|ref|NP_001142818.1| hypothetical protein LOC100275198 [Zea mays]
 gi|195610178|gb|ACG26919.1| hypothetical protein [Zea mays]
          Length = 149

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/146 (26%), Positives = 63/146 (43%), Gaps = 5/146 (3%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            +    +Y S QP+   ++  K++ GI S+LNLR    +++ KEE   A  LG+Q  N  
Sbjct: 9   EITKDLLYAS-QPDAESLKQTKEQKGIASVLNLRDTEEQTFMKEEGDVAQQLGLQYKNVC 67

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
           + +  EL      Q+I  ++T PKP+LIHC  G  R  +   +          E+     
Sbjct: 68  VKSLGEL-KNAASQIIEAIETMPKPILIHCIQG-QRAAVGGLLVEAKKQKMSYEQILEWG 125

Query: 166 SMLYGHFPVLKTITMDITFEKITQLY 191
                HF       +    ++ +  Y
Sbjct: 126 KAHNFHFD-THEG-LAAFLKEYSTTY 149


>gi|148235807|ref|NP_001088481.1| dual specificity phosphatase 23 [Xenopus laevis]
 gi|54311237|gb|AAH84811.1| LOC495348 protein [Xenopus laevis]
          Length = 151

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 49/135 (36%), Gaps = 11/135 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P  +   A P          E GI+ ++ L    P  +H          GI L
Sbjct: 7   HNFSWVEPGLLAGMAMPRLPAHYEYLYENGIRHLITLTEHKP-PYHDTCP------GITL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +      + EQIK  + I+  A    + + +HC  G  RTG   A YL  V     
Sbjct: 60  HRIRIQDFCAPSLEQIKNFLKIVDDAKSKGEAVGVHCLHGFGRTGTMLACYLVKVRKITG 119

Query: 159 EEAHRQLS-MLYGHF 172
            +A  ++  +  G  
Sbjct: 120 VDAINEIRCLRRGSI 134


>gi|58258917|ref|XP_566871.1| phosphoprotein phosphatase [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134106899|ref|XP_777991.1| hypothetical protein CNBA4600 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260691|gb|EAL23344.1| hypothetical protein CNBA4600 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57223008|gb|AAW41052.1| phosphoprotein phosphatase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 761

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/200 (15%), Positives = 66/200 (33%), Gaps = 27/200 (13%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------ 55
           +  L      I  G+L L +     Y         + + + P   + S            
Sbjct: 154 QDILYGVEKAIGNGLLDLSSFDADEYQYYEMVENGDLNILGPFIPFASPTENSWIEGVLQ 213

Query: 56  ----AQPNGTFIEYLKKEYGIKSIL------NLRGKLPESWHKEEEKAANDLGIQLINFP 105
                    T ++     + ++ +L      N+      +    + +   D+GI+ I   
Sbjct: 214 SPSNGHIIHTPVKSKTISHQLRCVLDIFQRENVGLVARLNDELYDRRHFLDMGIEHIEMF 273

Query: 106 LSATRELNDEQIKQLISI----LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
                   D+ +++ I +    ++   + + +HCK+G  RTG+    YL     +  +EA
Sbjct: 274 FDDGTNPPDDIVREFIRLAEYTIEHKRQKVAVHCKAGLGRTGVLIGAYLVYKYQFTAQEA 333

Query: 162 HRQLSM-LYGHFPVLKTITM 180
              + +   G     +   M
Sbjct: 334 IGFMRIVRPGMVVGPQQQYM 353


>gi|47221282|emb|CAG13218.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 151

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 52/128 (40%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V   ++   A P          ++GIK ++ L  + P ++         D  ++L
Sbjct: 7   HNFSWVDQGKLAGLALPRMASEYQYLLDHGIKHLVCLCERKPPNY-----DTCPD--LKL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
            +  ++     +  QI++ + I++ A    + + +HC  G  RTG   A YL        
Sbjct: 60  HHIKITDFTPPSPSQIERFLGIVEEANAQGEGVAVHCMHGHGRTGTMLACYLVKTRQISG 119

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 120 VDAIEKIR 127


>gi|282901585|ref|ZP_06309504.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193511|gb|EFA68489.1| conserved hypothetical protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 150

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 53/120 (44%), Gaps = 6/120 (5%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +   + +   QP+   +  L  + G+KSI+NLR          E++ +    ++ +
Sbjct: 3   NFRQISE-KFWAGGQPSPEDLAQLAHQ-GVKSIVNLRSPDETGSLSNEQELSKSNSLEYV 60

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           N PL +     ++    L  I+   P P+  HC +G  R  + + + L    ++  E+A 
Sbjct: 61  NLPLESNSSNGEKIDYLLTEIVD-LPTPIYFHCGAG-GRASVTALIALADQENW--EDAV 116


>gi|301108307|ref|XP_002903235.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
 gi|262097607|gb|EEY55659.1| tyrosine phosphatase, putative [Phytophthora infestans T30-4]
          Length = 172

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 54/151 (35%), Gaps = 13/151 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK-----EEEKAANDL 97
           N+  +    +YRS QPN        +   +++I+ L  + P    +     +E +     
Sbjct: 9   NYGMIEED-LYRSGQPNELNF-PFLERLSLRTIIYLALEEPNLQFQSFVEEQEIQLVFLG 66

Query: 98  GIQLINFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           G   +     A   L++E +   + I L  +  PL I C  G DRTG        I   +
Sbjct: 67  GNTRMESRRKAWEPLSEETVLAALDIILDRSNYPLYITCHLGRDRTGAVVGCLRKI-QGW 125

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                   +   Y  F   K    +  F ++
Sbjct: 126 H----LSSIFEEYRRFAGSKVRLQNEQFIEL 152


>gi|321249471|ref|XP_003191466.1| phosphoprotein phosphatase [Cryptococcus gattii WM276]
 gi|317457933|gb|ADV19679.1| Phosphoprotein phosphatase, putative [Cryptococcus gattii WM276]
          Length = 760

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/208 (13%), Positives = 61/208 (29%), Gaps = 43/208 (20%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEY-- 65
           +  L      I  G+L L +     Y         + + + P      A P  +      
Sbjct: 154 QDILYGVEKAIGNGLLDLASFDADEYQYYEMVENGDLNILGP--FIPFASPTESSWIEGA 211

Query: 66  ----------------------------LKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
                                       + +   +  +  L  +        + +   D+
Sbjct: 212 LQSASNEHIVHTPAKSRAISHQLHCVLDIFQRENVGLVARLNDE------LYDRRHFLDV 265

Query: 98  GIQLINFPLSATRELNDEQIKQLISI----LKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
           GI+ I           D  +++ I +    ++   + + +HCK+G  RTG+    YL   
Sbjct: 266 GIEHIEMFFDDGTNPPDNIVREFIRLAEHTIENKRQKVAVHCKAGLGRTGVLIGAYLVYK 325

Query: 154 AHYPKEEAHRQLSM-LYGHFPVLKTITM 180
             +  +EA   + +   G     +   M
Sbjct: 326 YQFTAQEAIGFMRIVRPGMVVGPQQQYM 353


>gi|298705736|emb|CBJ49044.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 167

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/166 (19%), Positives = 61/166 (36%), Gaps = 17/166 (10%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES-----WHKEEEKAANDLG 98
           F  V    +YRSA PN        +  G+K+I+ L            + ++++     LG
Sbjct: 8   FGLVEEG-LYRSALPNEINY-PFLERLGLKTIIYLYPDDDIDAQLVSFLEDQDVTLVSLG 65

Query: 99  IQLINFPLSATRELNDEQI-KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            +  +    +   + +E +   L  I+ +   P+LI C +G  RTG   A    +   + 
Sbjct: 66  -EHDDKRNKSWAPVGEEIVLAALERIVDSVHYPVLITCNTGKHRTGTVVACLRKL-QRWN 123

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
                  +   Y  F   K        E+  +L+  ++     E P
Sbjct: 124 ----LTSIFEEYRRFTKHKVRV---QNEQFIELFDTDLVHLPPEAP 162


>gi|300797313|ref|NP_001178759.1| dual specificity protein phosphatase 23 [Rattus norvegicus]
          Length = 150

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 47/128 (36%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P           +  G+ L
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSD-------SCPGLTL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        EQI Q + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPAPEQIDQFVKIVDEANARGEAVGVHCALGFGRTGTMLACYLVKEQGLAA 118

Query: 159 EEAHRQLS 166
            EA  ++ 
Sbjct: 119 GEAIAEIR 126


>gi|209733308|gb|ACI67523.1| Dual specificity protein phosphatase 23 [Salmo salar]
          Length = 151

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 62/151 (41%), Gaps = 12/151 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P ++   A P  T       + GI+ ++ L  + P ++           G++L
Sbjct: 7   PNFPWVEPTKLTGLAFPRMTAHYQYLLDNGIQHLVCLCERKPPNYD-------TVPGVKL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPK 158
            +  +        EQI++L+SI++ +      + +HC  G  RTG   A YL        
Sbjct: 60  HHINIIDFTPPTPEQIQRLLSIVEESNAKGEGVAVHCMHGHGRTGTMLACYLVKTRKISG 119

Query: 159 EEAHRQL-SMLYGHF-PVLKTITMDITFEKI 187
            +A  ++  + +G      +   +   +++I
Sbjct: 120 IDAINEIRRLRHGSIETHDQEKAVVQFYQRI 150


>gi|322817672|gb|EFZ25329.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 852

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/233 (11%), Positives = 62/233 (26%), Gaps = 60/233 (25%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP-------NGT 61
             +      + LG   +    +  Y         +   VVP+ +   + P       +  
Sbjct: 289 DVISGLEKAVTLGWYNVRTFDIAEYE---RLRRHDCSWVVPNALLALSSPNSHVPGRSAE 345

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
               L  +  ++ ++ L             +     G+Q            ND+ IK+  
Sbjct: 346 VYVKLFHQLKVRHLVRLNES------LYRREIFLANGVQHFELEFPDGSAPNDDIIKRFF 399

Query: 122 SILKTA-------------------------------------------PKPLLIHCKSG 138
            I++                                                + +HC++G
Sbjct: 400 KIVEPIVLPSSRATNKGKEKGRPPLLQLHQHQSESPRWGQQRAKKVKSGGGAVALHCRAG 459

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQL 190
             RTG    VY+         E+   + +   G    ++   ++    + +Q+
Sbjct: 460 LGRTGTLICVYMMRHFGMTARESIGWIRLCRPGSVIGVQQEFLERIERRFSQM 512


>gi|307594224|ref|YP_003900541.1| dual specificity protein phosphatase [Vulcanisaeta distributa DSM
           14429]
 gi|307549425|gb|ADN49490.1| dual specificity protein phosphatase [Vulcanisaeta distributa DSM
           14429]
          Length = 166

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 48/126 (38%), Gaps = 7/126 (5%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP---ESW-HKEEEKAANDLGIQ 100
           + V+   +  S+ P       +     I++++ L  +     E W   E        G+ 
Sbjct: 6   YWVIEGALAGSSMPLDEDTVAMWHRMRIRAVVILVEEWEFAMEGWDFNEYINTLRKFGMD 65

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            ++ P        ++ +  +++ +  +    KP+L+HC +G  R+    A YL       
Sbjct: 66  YLHVPTRDGYAPPEDVLYNIVTWIDRSIMSGKPVLVHCHAGIGRSPTVIAAYLMYRRGLS 125

Query: 158 KEEAHR 163
            ++A  
Sbjct: 126 ADDAIE 131


>gi|290994647|ref|XP_002679943.1| predicted protein [Naegleria gruberi]
 gi|284093562|gb|EFC47199.1| predicted protein [Naegleria gruberi]
          Length = 167

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 56/145 (38%), Gaps = 16/145 (11%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK----LPESWHKEEEKAANDLGI 99
           F  V    IYRS+ P         K   +K+IL L  +       S+ +EE+    +LG+
Sbjct: 27  FGMVEDG-IYRSSVPKAEKQFQYLKTLNLKTILFLSQEIILKSFTSFLEEEKIDLIELGL 85

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 L + R LND   + L  ++  +  P+++ C SG   TG        +      +
Sbjct: 86  ------LISNRTLNDLIKEALEILMDKSYHPIMVVCSSGIHLTGTLIGCLRKLQ-----D 134

Query: 160 EAHRQLSMLYGHFPVLKTITMDITF 184
            +   +   Y  F    +  +D  F
Sbjct: 135 WSLTSIFTEYECFAGNNSRHIDQQF 159


>gi|50305669|ref|XP_452795.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74606830|sp|Q6CTE4|OCA1_KLULA RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|49641928|emb|CAH01646.1| KLLA0C13343p [Kluyveromyces lactis]
          Length = 210

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 51/145 (35%), Gaps = 19/145 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+            +K+I+ L  + P+       +  +D  IQL 
Sbjct: 44  NFCPV-ERYLYRSGQPSNVNF-PFLLNLKLKTIIWLANEEPQDALL---EFCDDHNIQLQ 98

Query: 103 NFPLSATRELNDE---------QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++     +D              L +I+ +   PLL+ C  G  RTG        ++
Sbjct: 99  FAAINPDGGEDDNPWDGLTEHSIRNALHTIVNSESYPLLVCCGMGRHRTGTVIGCLRRLM 158

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTI 178
             +        +S  Y  F   +  
Sbjct: 159 -GWN----LASVSEEYRRFTGSRGG 178


>gi|325181330|emb|CCA15745.1| tyrosine phosphatase putative [Albugo laibachii Nc14]
          Length = 173

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 50/151 (33%), Gaps = 13/151 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL----- 97
           N+  +    +YRS QPN        +   ++ I+ L  + P    +   +          
Sbjct: 9   NYGMIEED-LYRSGQPNELNF-PFLERLNLRKIIYLAAEEPNLQFQSFVEEQEIELICLG 66

Query: 98  GIQLINFPLSATRELNDE-QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           G   +     A   L++E  +  L  IL  +  PL I C  G DRTG        +    
Sbjct: 67  GNAHLETRRKAWEPLSEETVLAALQIILDRSNYPLYITCHLGRDRTGAVVGCLRKMQQ-- 124

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                   +   Y  F   K    +  F ++
Sbjct: 125 ---WHLSLIFEEYRRFAGSKVRLQNEQFIEL 152


>gi|118369296|ref|XP_001017853.1| hypothetical protein TTHERM_00440590 [Tetrahymena thermophila]
 gi|89299620|gb|EAR97608.1| hypothetical protein TTHERM_00440590 [Tetrahymena thermophila
           SB210]
          Length = 606

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/209 (11%), Positives = 67/209 (32%), Gaps = 30/209 (14%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP---------- 58
             L        L  + +   ++  Y         +   V+P+++     P          
Sbjct: 127 DCLKGLEYAHKLKWVEIQNFNIKAYQALKKF---DITVVIPNKLIAFQNPELFSQQETLC 183

Query: 59  --NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQ 116
                    + K+ G+K ++ L             +     GI+ ++         ++  
Sbjct: 184 ELTVDQSINIFKQMGVKLVIRLNKSSYSP------QLYERNGIKHVDLIFPDGTSPSE-- 235

Query: 117 IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVL 175
                 ++++    + +HCK+G  RTG     Y     H+P ++    + +   G     
Sbjct: 236 ------LVESVDGMVAVHCKAGRGRTGTLIGCYAIKHYHFPAKDFIGYIRIMRPGSIHGP 289

Query: 176 KTITMDITFEKITQLYPNNVSKGDTEQPM 204
           +   ++   + + +   +N    ++ + +
Sbjct: 290 QQPFLNHIQKTLIEQQGSNSQIWESVRHL 318


>gi|154417107|ref|XP_001581574.1| Tyrosine phosphatase family protein [Trichomonas vaginalis G3]
 gi|121915803|gb|EAY20588.1| Tyrosine phosphatase family protein [Trichomonas vaginalis G3]
          Length = 202

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 54/167 (32%), Gaps = 15/167 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V P  +YRSA P+        +   +K+++ L    P        +   +  I+L
Sbjct: 7   PNFGYVEPD-LYRSAVPSDMNF-PFLQTLHLKTVIYLSLDAPSVLFL---EFLKEHNIEL 61

Query: 102 INF-----PLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
                      A R      +  L S+L     P+++ C  G  RTG        +   +
Sbjct: 62  KQISGAETTGFAQRVSEQLVLDALHSLLNPNAYPIIVMCNLGRHRTGTVIGCLRRL-QKW 120

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
                   +   +  F   K+      F ++       + +   + P
Sbjct: 121 S----LSAIFDEFRRFTNAKSSPQHEQFIELFDTELVEIPEKVDQLP 163


>gi|77361300|ref|YP_340875.1| hypothetical protein PSHAa2384 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876211|emb|CAI87433.1| conserved protein of unknown function; putative membrane protein
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 177

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 66/162 (40%), Gaps = 11/162 (6%)

Query: 7   PRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQ----NFHAVVPHEIYRSAQPNGTF 62
            R   L      +  +L   A       + IT        N   +  ++   +AQP    
Sbjct: 1   MRHIKLFANALFITALLTTGAAFAKEQSINITAVKTSDVRNL-VIHENQTLSAAQPTSEQ 59

Query: 63  IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           ++      G+K ++NLRG+  + W  +E +    LG+Q    P++  ++++ E  + L  
Sbjct: 60  LKQ-LANAGVKHVINLRGENEQDW--DEAQLVASLGMQYHALPIAGAQDVSVENAQNLAK 116

Query: 123 ILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           I+      P+L+HC S ++R G   A+  +       E A  
Sbjct: 117 IMAELNGEPVLLHCAS-SNRVGALMAISAHA-EGLDIESALA 156


>gi|242044034|ref|XP_002459888.1| hypothetical protein SORBIDRAFT_02g013070 [Sorghum bicolor]
 gi|241923265|gb|EER96409.1| hypothetical protein SORBIDRAFT_02g013070 [Sorghum bicolor]
          Length = 129

 Score = 77.9 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 47/119 (39%), Gaps = 12/119 (10%)

Query: 76  LNLRGKL--PESWHKEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAP 128
           + LR +   PE + +   +     GI+L  F +  ++E       D   + L  IL  + 
Sbjct: 1   MRLRPRCLCPEPYPEANLEFLRAHGIKLFQFGIDGSKEPFVNIPEDRIREALKVILDASN 60

Query: 129 KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
            P+LIHCK G  RTG     +  +            +   Y  F   KT   D+ F ++
Sbjct: 61  HPVLIHCKRGKHRTGCVVGCFRKLQ-----RWCLTSIFDEYQRFAAAKTRVSDLRFMEL 114


>gi|258568280|ref|XP_002584884.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237906330|gb|EEP80731.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 262

 Score = 77.5 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 53/148 (35%), Gaps = 19/148 (12%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P     E   K+  +K+IL L   +     ++  K   D GI  
Sbjct: 56  PNFAEVVKG-IYRSSFPLPDHFES-IKKLNLKTILTL---VDFEHSRQFRKFIKDNGIVS 110

Query: 102 INFPLSATREL-----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              P+ A ++       +  +  L  +      P+L+HC  G        +        +
Sbjct: 111 HVIPIIANKDPKIFTPQNTVLDVLKILFNPKNHPILVHCNKGK-----VFSSNAEDSRGW 165

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITF 184
               A  +    Y  +   K+  +D  F
Sbjct: 166 SNAAAVAE----YIKYSTPKSRVLDRKF 189


>gi|255319421|ref|ZP_05360637.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SK82]
 gi|262380885|ref|ZP_06074036.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SH164]
 gi|255303557|gb|EET82758.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SK82]
 gi|262297520|gb|EEY85438.1| protein tyrosine/serine phosphatase [Acinetobacter radioresistens
           SH164]
          Length = 134

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 20/146 (13%)

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
            L K+  IK+++NLR    +S   E         IQ+I+ P+     +N E +  ++  L
Sbjct: 2   PLLKQKNIKTVINLRTHDRDSSILE------GENIQVIHLPIRTW-AMNREHLLGIMQYL 54

Query: 125 KTAPK---PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL-SMLYGHFPVLKTITM 180
           K A      +LIHC  G+DRTG + A+Y  +  ++  E+A  ++    YG+         
Sbjct: 55  KQAQHSGQKVLIHCYHGSDRTGASIAMYRIVFENWSTEQALLEMKHGGYGYHV------- 107

Query: 181 DITFEKITQLYPNNVSKGDTEQPMNA 206
              ++ I +L+     +   +Q  + 
Sbjct: 108 --IWKNIERLFSTENIQWTRQQLQSP 131


>gi|221109808|ref|XP_002160979.1| PREDICTED: similar to protein tyrosine phosphatase, mitochondrial 1
           [Hydra magnipapillata]
          Length = 184

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/168 (15%), Positives = 59/168 (35%), Gaps = 14/168 (8%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
            L FY  ++ G L                        + +++   A P     + L    
Sbjct: 17  RLAFYPTLVYGCLRTSPNRRWYDR-------------IDNKVILGALPFYKTAKALVSIE 63

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP-LSATRELNDEQIKQLISILKTAPK 129
            I +++ L       +   ++   N LG+Q ++ P +  +   +  +I+  +  +  +  
Sbjct: 64  NISAVITLNEPYELRYFCPKKTEWNLLGVQQLHIPTVEYSDAPSISKIESALDFINKSSS 123

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
            + +HCK+G  R+      YL        ++A + +     H    +T
Sbjct: 124 SVYVHCKAGRSRSATVVVCYLIKQYKMSSDDAIQFVREKRPHIAFSET 171


>gi|71409853|ref|XP_807250.1| tyrosine phosphatase [Trypanosoma cruzi strain CL Brener]
 gi|70871210|gb|EAN85399.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 849

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/233 (11%), Positives = 60/233 (25%), Gaps = 60/233 (25%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP-------NGT 61
             +      + LG   +    +  Y         +   VVP+ +   + P       +  
Sbjct: 289 DVISGLEKAVTLGWYNVRTFDIAEYE---RLRRHDCSWVVPNALLALSSPNSHVPGRSAE 345

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
               L  +  +  ++ L             +     G+Q            ND+ IK+  
Sbjct: 346 VYVKLFHQLKVTHLVRLNES------LYRREIFLANGVQHFELEFPDGSAPNDDIIKRFF 399

Query: 122 SILKTA-------------------------------------------PKPLLIHCKSG 138
            I++                                                + +HC++G
Sbjct: 400 KIVEPILLPSSRATNKEEEKGRPPLLQLHQHQSGSPRCGQQRVKKVKSGGGAVALHCRAG 459

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQL 190
             RTG    VY+         E+   + +   G    ++   ++    + + +
Sbjct: 460 LGRTGTLICVYMMRHFGMTARESIGWIRLCRPGSVIGVQQEFLERIERRFSHM 512


>gi|320167291|gb|EFW44190.1| tyrosine phosphatase [Capsaspora owczarzaki ATCC 30864]
          Length = 166

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/167 (19%), Positives = 65/167 (38%), Gaps = 19/167 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QPN        ++  +K+I+ L  + P    +     A+D  I+++
Sbjct: 10  NFGMVEED-LYRSGQPNELNF-PFLEKLHLKTIVFLAAEDPSQALRN---FADDHDIEVL 64

Query: 103 NFPLSATRELN------DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
           +   +    L       +  I+ L  +L     PL + C  G+ RTG        +   +
Sbjct: 65  HLGKAQASALTWAPLAEETVIEALNVVLNPEHYPLHVMCNLGSHRTGTLIGCLRKL-QRW 123

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
                   +   Y    + K   ++   E+  + +  ++ +  T++P
Sbjct: 124 N----LTSIFEEYRRHAMGKVRLLN---EQFIEFFDTDLVRIPTQRP 163


>gi|290991013|ref|XP_002678130.1| predicted protein [Naegleria gruberi]
 gi|284091741|gb|EFC45386.1| predicted protein [Naegleria gruberi]
          Length = 180

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 52/163 (31%), Gaps = 28/163 (17%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V  + ++RS QP             +K+I+ L    P    +E    A D  I LI
Sbjct: 9   NFGYVQEN-VFRSGQPTSVNF-PHLATLNLKTIIYLAPDQP---TQEFVNFAKDQNINLI 63

Query: 103 NFPLSATREL------------------NDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144
           +    +T+                     +  ++ L  IL     PL I C  G  RTG 
Sbjct: 64  HLTNQSTKMKKSGTSSSHTGMAQLGLISEEIVVEALEIILNRENLPLAIMCNLGRHRTGT 123

Query: 145 ASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  I   +       +    Y  +   K    +  F ++
Sbjct: 124 VVGCLRKI-QRWNLTSILDE----YRRYAGSKVRLQNEQFIEL 161


>gi|71659279|ref|XP_821363.1| tyrosine phosphatase [Trypanosoma cruzi strain CL Brener]
 gi|70886740|gb|EAN99512.1| tyrosine phosphatase, putative [Trypanosoma cruzi]
          Length = 850

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/233 (11%), Positives = 60/233 (25%), Gaps = 60/233 (25%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP-------NGT 61
             +      + LG   +    +  Y         +   VVP+ +   + P       +  
Sbjct: 289 DVISGLEKAVTLGWYNVRTFDIAEYE---RLRRHDCSWVVPNTLLALSSPNSHVPGRSAE 345

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
               L  +  +  ++ L             +     G+Q            ND+ IK+  
Sbjct: 346 VYVKLFHQLKVTHLVRLNES------LYRREIFLANGVQHFELEFPDGSAPNDDIIKRFF 399

Query: 122 SILKTA-------------------------------------------PKPLLIHCKSG 138
            I++                                                + +HC++G
Sbjct: 400 KIVEPIVLPSSRATNKGEEKGRPPLLQLHQHQSGSPRWGEQRVKKVKSGGGAVALHCRAG 459

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQL 190
             RTG    VY+         E+   + +   G    ++   ++    + + +
Sbjct: 460 LGRTGTLICVYMMRHFGMTARESIGWIRLCRPGSVIGVQQEFLERIERRFSHM 512


>gi|296229335|ref|XP_002760206.1| PREDICTED: dual specificity protein phosphatase 23-like [Callithrix
           jacchus]
          Length = 150

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 47/128 (36%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P           +  G+ L
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSD-------SCPGLTL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        EQI + + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPAPEQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKEQGLAA 118

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 119 GDAIAEIR 126


>gi|119188179|ref|XP_001244696.1| hypothetical protein CIMG_04137 [Coccidioides immitis RS]
          Length = 251

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 43/113 (38%), Gaps = 10/113 (8%)

Query: 77  NLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL-----NDEQIKQLISILKTAPKPL 131
           ++R  +     ++ +K   D GI     P+ A ++       +  ++ L  +      P+
Sbjct: 69  DVRTLVENEHSRQFKKFIKDNGITSYVMPIIANKDPKIFTSQNTVLEVLRILFNPDNHPV 128

Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           L+HC  G  RTG   A +      +    A  +    Y  +   KT  +D  F
Sbjct: 129 LVHCNKGKHRTGCIIACFRRA-QGWSNTAAVAE----YIKYSAPKTRVLDRKF 176


>gi|126136825|ref|XP_001384936.1| protein tyrosine/serine phosphatase [Scheffersomyces stipitis CBS
           6054]
 gi|189029254|sp|A3LW52|OCA1_PICST RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|126092158|gb|ABN66907.1| protein tyrosine/serine phosphatase [Scheffersomyces stipitis CBS
           6054]
          Length = 212

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/160 (18%), Positives = 58/160 (36%), Gaps = 26/160 (16%)

Query: 37  ITTFTQ-NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
           +      NF  V   ++YRS QP+    +   ++  +K+IL L  + P+     E    +
Sbjct: 33  LRIIPPLNFCPV-ERQLYRSGQPSAIN-QSFLEQLNLKTILWLASEEPQDDF-LEFSNDH 89

Query: 96  DLGIQL----------------INFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSG 138
           ++ I+                     ++    LN++ IK+ + ++      PLL+ C  G
Sbjct: 90  NINIEFVGIINEFSNYQNYNTNQTLTVNPWDALNEQTIKRALELIVNRENYPLLVCCGMG 149

Query: 139 ADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTI 178
             RTG        +   +        +S  Y  F   +  
Sbjct: 150 RHRTGTVIGCLRRL-QGWN----LASVSEEYRRFTGARGG 184


>gi|296827050|ref|XP_002851107.1| tyrosine-protein phosphatase SIW14 [Arthroderma otae CBS 113480]
 gi|238838661|gb|EEQ28323.1| tyrosine-protein phosphatase SIW14 [Arthroderma otae CBS 113480]
          Length = 252

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 56/174 (32%), Gaps = 33/174 (18%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  VV   IYRS+ P    +     +  +K+I+ L   + E W  E      D  I  
Sbjct: 55  NNFTEVVKG-IYRSSFPMPVHLSS-LAQLKLKTIVTL---VDEKWSPEYIAFVRDNAITS 109

Query: 102 INFPLSATR-----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
              P+ A +           I+ L  +L+    P+L+HC  G                 +
Sbjct: 110 YVIPILANKQADVYTPISTIIEVLTILLEPRNHPVLVHCNKGK---------------GW 154

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDI-TFEKITQLYPNNVSKG---DTEQPMNA 206
               A  +    Y      KT  +D    +   +    ++ K    D   P   
Sbjct: 155 TCVAALAE----YIQHASPKTRVLDRNYIQNFDETLVADLVKKVGADKWLPTFP 204


>gi|325096669|gb|EGC49979.1| tyrosine-protein phosphatase CDC14 [Ajellomyces capsulatus H88]
          Length = 411

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 42/136 (30%), Gaps = 11/136 (8%)

Query: 51  EIYRSAQPNG-TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
           E+  S  P     +        I  ++ L  +L    H         +GI  ++      
Sbjct: 41  EVLISDLPVPFKNVLSHFSSRNIGLVVRLNSELYSPSH------FTAMGISHMDMIFEDG 94

Query: 110 RELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
                  +++ I I   +    K + +HCK+G  RTG     YL     +   E    + 
Sbjct: 95  TCPPLPLVRRFIKIAHEMIHKKKGIAVHCKAGLGRTGCLIGAYLIYRHGFTANEVIAFMR 154

Query: 167 M-LYGHFPVLKTITMD 181
               G     +   + 
Sbjct: 155 FMRPGMVVGPQQHWLH 170


>gi|332222799|ref|XP_003260557.1| PREDICTED: protein tyrosine phosphatase domain-containing protein 1
           [Nomascus leucogenys]
          Length = 806

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 55/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 136 SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 194

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF       ++   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 195 LPEAFMEAGIYFYNFGWKDYGVVSLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 254

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 255 CYLVFATRMTADQAITSVRAKRPNSIQARGQLL 287


>gi|194224963|ref|XP_001492231.2| PREDICTED: protein tyrosine phosphatase domain containing 1 [Equus
           caballus]
          Length = 794

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 56/153 (36%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYL-----KKEYGIKSILNLRGKLP----------ESWHKE 89
             V   +I   A+P+   +E        + +GIK+I+NL+              ES    
Sbjct: 128 SWVT-DKILAMARPSTELLERYCIIEQFRTHGIKTIINLQRPGEHASCGNPLEQESGFTY 186

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 187 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 246

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 247 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 279


>gi|45187613|ref|NP_983836.1| ADL260Wp [Ashbya gossypii ATCC 10895]
 gi|74694601|sp|Q75B37|OCA1_ASHGO RecName: Full=Putative tyrosine-protein phosphatase OCA1
 gi|44982351|gb|AAS51660.1| ADL260Wp [Ashbya gossypii ATCC 10895]
          Length = 225

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 48/143 (33%), Gaps = 15/143 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+            +++I+ L  + P+          +D+ ++  
Sbjct: 42  NFCPV-ERYLYRSGQPSTVNF-PFLLNLNLRTIIWLANEEPQDALLAFCD-MHDIRLRFA 98

Query: 103 NFPLSATRELND-------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
                   + N          +  L +I+     PLL+ C  G  RTG        I+  
Sbjct: 99  AINPEGGEDDNPWDGLTEHSIVSALQTIVHRDNYPLLVCCGMGRHRTGTVIGCLRRIM-G 157

Query: 156 YPKEEAHRQLSMLYGHFPVLKTI 178
           +        +S  Y  F   +  
Sbjct: 158 WN----LASVSEEYRRFTGSRGG 176


>gi|73947148|ref|XP_533558.2| PREDICTED: similar to protein tyrosine phosphatase domain
           containing 1 protein isoform 1 [Canis familiaris]
          Length = 789

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 55/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        +    + +GIK+I+NL+              ES    
Sbjct: 126 SWVTEN-ILAMARPSTELLEKYHLIEQFQSHGIKTIINLQRPGEHASCGNPLEQESGFTY 184

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 185 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 244

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 245 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 277


>gi|225076125|ref|ZP_03719324.1| hypothetical protein NEIFLAOT_01157 [Neisseria flavescens
           NRL30031/H210]
 gi|224952544|gb|EEG33753.1| hypothetical protein NEIFLAOT_01157 [Neisseria flavescens
           NRL30031/H210]
          Length = 110

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 2/99 (2%)

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYI 152
               G+ L+N PL +      E  + L  I  +     +LIHC  GADRTGL + +Y  I
Sbjct: 1   MKAYGLTLLNRPLLSWSIKPKEITEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRII 60

Query: 153 VAHYPKEEAHRQL-SMLYGHFPVLKTITMDITFEKITQL 190
              +P EEA  ++    YG+  + K I    T EK+ Q+
Sbjct: 61  YQGWPVEEAKAEMQHGPYGYHSIWKNIANLFTEEKVKQV 99


>gi|326926561|ref|XP_003209467.1| PREDICTED: LOW QUALITY PROTEIN: dual specificity protein
           phosphatase 23-like [Meleagris gallopavo]
          Length = 264

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 43/131 (32%), Gaps = 10/131 (7%)

Query: 39  TFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
               NF  V    +   A P            G++ +++L    P               
Sbjct: 40  VEPPNFSWVAEGRLAGLAMPREPGHYRFLLGRGVRHLVSLSEXGPP-------HHGCCPA 92

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYLYIVAH 155
           +QL  F +         QI+  + +++ A      + +HC  G  RTG   A YL     
Sbjct: 93  LQLHRFRVPDFTPPTLGQIQSFLQLVEEANGRGEAVAVHCMLGHGRTGTMLACYLVKTQK 152

Query: 156 YPKEEAHRQLS 166
               +A R++ 
Sbjct: 153 MSGSDAIREIR 163


>gi|260941936|ref|XP_002615134.1| hypothetical protein CLUG_05150 [Clavispora lusitaniae ATCC 42720]
 gi|238851557|gb|EEQ41021.1| hypothetical protein CLUG_05150 [Clavispora lusitaniae ATCC 42720]
          Length = 202

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 53/143 (37%), Gaps = 14/143 (9%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL----G 98
           NF  V   ++YRS QP+    +   ++  +K+IL L  + P     +   A N      G
Sbjct: 32  NFCPV-EKQLYRSGQPSIIN-QSFLQQLHLKTILWLASEEPMEDFLDYCSAQNINIEFVG 89

Query: 99  I--QLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           +        ++    L++  I+  + ++      PLL+ C  G  RTG        +   
Sbjct: 90  MINDYNYTNINPWDSLDERTIQNALELICNKENYPLLVCCGMGRHRTGAVIGCLRRL-QG 148

Query: 156 YPKEEAHRQLSMLYGHFPVLKTI 178
           +        +S  Y  F   +  
Sbjct: 149 WN----LASVSEEYRRFSGARGG 167


>gi|126336540|ref|XP_001378862.1| PREDICTED: similar to protein tyrosine phosphatase domain
           containing 1 protein [Monodelphis domestica]
          Length = 789

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 56/153 (36%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGK----------LPESWHKE 89
             V  + I   A+P+        I    + YGIK+I+NL+             PES    
Sbjct: 128 SWVTDN-ILAMARPSTELIEKYNIIEQFQSYGIKTIINLQRPGEHASCGNTLEPESGFTY 186

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 187 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 246

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 247 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 279


>gi|241765587|ref|ZP_04763545.1| dual specificity protein phosphatase [Acidovorax delafieldii 2AN]
 gi|241364615|gb|EER59664.1| dual specificity protein phosphatase [Acidovorax delafieldii 2AN]
          Length = 342

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 50/132 (37%), Gaps = 13/132 (9%)

Query: 42  QNFHAVVPHEIYRSAQP---NGTFIEYLK-KEYGIKSILNLRGKLPESWHKEEEKAANDL 97
             FH ++P ++    +P        +       GI  ++ L  +        +E+A    
Sbjct: 190 HGFHWIIPGKLAGCGEPGAMAPIDYDMQLLSTLGISHLVTLTER------DIDEEALLRN 243

Query: 98  GIQLINFPLSATRELNDEQIKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVA 154
            ++ I+ P+      +  Q   L   + +L      + +HC++G  RTG   A +L    
Sbjct: 244 QLRNIHLPIFDREAPSISQAYMLVRRMQLLLDQGHVIAVHCRAGIGRTGTILAAWLIREG 303

Query: 155 HYPKEEAHRQLS 166
               EEA  +L 
Sbjct: 304 GLSSEEAIARLR 315


>gi|325968476|ref|YP_004244668.1| dual specificity protein phosphatase [Vulcanisaeta moutnovskia
           768-28]
 gi|323707679|gb|ADY01166.1| dual specificity protein phosphatase [Vulcanisaeta moutnovskia
           768-28]
          Length = 174

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 51/132 (38%), Gaps = 8/132 (6%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP---ESW-HKEEEKAANDLGIQ 100
           + V+   +  S+ P       +     I++++ L  +     E W   E   A     + 
Sbjct: 12  YWVIEGALAGSSMPLDEDTVAMWHRMRIRAVVILVEEWEFAMEGWDFHEYINALRKFNMD 71

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
            ++ P        ++ +  +++ +  +    KP+L+HC +G  R+    A YL       
Sbjct: 72  YLHVPTRDGYSPPEDVLYNIVTWIDKSIMSGKPVLVHCHAGIGRSPTVIAAYLMYRRGLS 131

Query: 158 KEEAHRQLSMLY 169
            ++A  ++   Y
Sbjct: 132 ADDAI-EIVSRY 142


>gi|301790373|ref|XP_002930392.1| PREDICTED: protein tyrosine phosphatase domain-containing protein
           1-like isoform 1 [Ailuropoda melanoleuca]
          Length = 748

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 55/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        +    + +GIK+++NL+              ES    
Sbjct: 84  SWVTEN-ILAMARPSTELLEKYHLIEQFQSHGIKTVINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|301790375|ref|XP_002930393.1| PREDICTED: protein tyrosine phosphatase domain-containing protein
           1-like isoform 2 [Ailuropoda melanoleuca]
 gi|281349243|gb|EFB24827.1| hypothetical protein PANDA_020829 [Ailuropoda melanoleuca]
          Length = 790

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 55/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        +    + +GIK+++NL+              ES    
Sbjct: 126 SWVTEN-ILAMARPSTELLEKYHLIEQFQSHGIKTVINLQRPGEHASCGNPLEQESGFTY 184

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 185 LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 244

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 245 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 277


>gi|56786144|ref|NP_060293.2| dual specificity protein phosphatase 23 [Homo sapiens]
 gi|109017530|ref|XP_001117253.1| PREDICTED: dual specificity protein phosphatase 23-like isoform 1
           [Macaca mulatta]
 gi|114560586|ref|XP_001170819.1| PREDICTED: dual specificity protein phosphatase 23 isoform 1 [Pan
           troglodytes]
 gi|114560588|ref|XP_001170835.1| PREDICTED: dual specificity phosphatase 23 isoform 2 [Pan
           troglodytes]
 gi|297663037|ref|XP_002809981.1| PREDICTED: dual specificity protein phosphatase 23-like [Pongo
           abelii]
 gi|73620828|sp|Q9BVJ7|DUS23_HUMAN RecName: Full=Dual specificity protein phosphatase 23; AltName:
           Full=Low molecular mass dual specificity phosphatase 3;
           Short=LDP-3; AltName: Full=VH1-like phosphatase Z
 gi|12654609|gb|AAH01140.1| Dual specificity phosphatase 23 [Homo sapiens]
 gi|44916998|dbj|BAD12141.1| low-molecular-mass dual-specificity phosphatase 3 [Homo sapiens]
 gi|55665709|emb|CAH71101.1| dual specificity phosphatase 23 [Homo sapiens]
 gi|119573160|gb|EAW52775.1| dual specificity phosphatase 23 [Homo sapiens]
 gi|325464585|gb|ADZ16063.1| dual specificity phosphatase 23 [synthetic construct]
          Length = 150

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 47/128 (36%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P           +  G+ L
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSD-------SCPGLTL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        +QI + + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAA 118

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 119 GDAIAEIR 126


>gi|163845827|ref|YP_001633871.1| hypothetical protein Caur_0229 [Chloroflexus aurantiacus J-10-fl]
 gi|163667116|gb|ABY33482.1| protein of unknown function DUF442 [Chloroflexus aurantiacus
           J-10-fl]
          Length = 169

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           VV   +  +AQP     +    E G +++LN+R     +   ++   A   G++ I+ P 
Sbjct: 27  VVTENVLLAAQPQPEDWQRFV-EAGYQTVLNIRSDPERAA--QQAANARAAGLRYIHAPW 83

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
            A     +   +    +   A   L+ HC+S A R GL   +Y  +   + +E+A  +L 
Sbjct: 84  PAYELEPEHLAEFARIVEDPATGKLVFHCRS-ATRVGLIWMLYRMVHQGWSREQAEAELR 142


>gi|149045052|gb|EDL98138.1| protein tyrosine phosphatase domain containing 1 (predicted),
           isoform CRA_b [Rattus norvegicus]
          Length = 799

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 132 SWVTDN-ILAMARPSSELLEKYHIIEQFLSHGIKTIINLQRPGEHASCGNSLEQESGFTY 190

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 191 LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 250

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 251 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 283


>gi|7020545|dbj|BAA91172.1| unnamed protein product [Homo sapiens]
          Length = 150

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 47/128 (36%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P           +  G+ L
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSD-------SCPGLTL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        +QI + + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAA 118

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 119 GDAIAEIR 126


>gi|328717172|ref|XP_001950488.2| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like
           protein-like isoform 2 [Acyrthosiphon pisum]
          Length = 187

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/182 (12%), Positives = 61/182 (33%), Gaps = 13/182 (7%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                  ++ +  +T   +       +   +   A P     + L  E  ++ ++++   
Sbjct: 7   FYPTLLYNVFMEKVTQRNWYDR----IDENVILGALPFRNISQKLIDEENVRCVISMNES 62

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK---TAPKPLLIHCKS 137
                   + +    +G++             + E++ Q +S+++      K + +HCK+
Sbjct: 63  YELEHFTPQPEEWKKMGVEHCQLSTKDIFETPSHEKLIQGVSVMESVSKDGKTVYVHCKA 122

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           G  R+      YL    ++  E+A   +     H         +   E + + Y   V +
Sbjct: 123 GRTRSATLVGCYLMSKHNWTPEQAIENIVSKRPHIW-----LRNQQLESLKKYYDAVVKE 177

Query: 198 GD 199
             
Sbjct: 178 KF 179


>gi|296189454|ref|XP_002742784.1| PREDICTED: protein tyrosine phosphatase domain-containing protein 1
           isoform 2 [Callithrix jacchus]
          Length = 754

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+++NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIEQFLSHGIKTVINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIMFVRAKRPNSIQTRGQLL 235


>gi|296189452|ref|XP_002742783.1| PREDICTED: protein tyrosine phosphatase domain-containing protein 1
           isoform 1 [Callithrix jacchus]
          Length = 814

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+++NL+              ES    
Sbjct: 144 SWVTDN-ILAMARPSSELLEKYHIIEQFLSHGIKTVINLQRPGEHASCGNPLEQESGFTY 202

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 203 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 262

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 263 CYLVFATRMTADQAIMFVRAKRPNSIQTRGQLL 295


>gi|222523538|ref|YP_002568008.1| hypothetical protein Chy400_0244 [Chloroflexus sp. Y-400-fl]
 gi|222447417|gb|ACM51683.1| protein of unknown function DUF442 [Chloroflexus sp. Y-400-fl]
          Length = 165

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           VV   +  +AQP     +    E G +++LN+R     +   ++   A   G++ I+ P 
Sbjct: 23  VVTENVLLAAQPQPEDWQRFV-EAGYQTVLNIRSDPERAA--QQAANARAAGLRYIHAPW 79

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
            A     +   +    +   A   L+ HC+S A R GL   +Y  +   + +E+A  +L 
Sbjct: 80  PAYELEPEHLAEFARIVEDPATGKLVFHCRS-ATRVGLIWMLYRMVHQGWSREQAEAELR 138


>gi|157821683|ref|NP_001099574.1| protein tyrosine phosphatase domain-containing protein 1 [Rattus
           norvegicus]
 gi|149045051|gb|EDL98137.1| protein tyrosine phosphatase domain containing 1 (predicted),
           isoform CRA_a [Rattus norvegicus]
          Length = 751

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIEQFLSHGIKTIINLQRPGEHASCGNSLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|119472119|ref|ZP_01614350.1| hypothetical protein ATW7_11085 [Alteromonadales bacterium TW-7]
 gi|119445139|gb|EAW26432.1| hypothetical protein ATW7_11085 [Alteromonadales bacterium TW-7]
          Length = 175

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/152 (25%), Positives = 68/152 (44%), Gaps = 7/152 (4%)

Query: 13  IFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGI 72
             +I  L G  V     L    +      +NF A   + +Y +AQP+   ++    +  +
Sbjct: 10  SLFIIALSGGYVTATEPLNNTEVVKKADIKNFAAH-SNLVYSAAQPSKEQLKQ-LSKADV 67

Query: 73  KSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPK-PL 131
           K ++NLRG   + W  +E +    LG+     P+S  +++  E  + L S+LK     P+
Sbjct: 68  KHVINLRGANEQDW--DEGEFVQALGMDYHALPISGAQDITVENARNLASLLKKLNGEPV 125

Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           L+HC S ++R G   A+  +       +EA  
Sbjct: 126 LVHCAS-SNRVGALIAISAHE-DGLSVDEALE 155


>gi|291235004|ref|XP_002737435.1| PREDICTED: dual specificity phosphatase 23-like [Saccoglossus
           kowalevskii]
          Length = 153

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 45/128 (35%), Gaps = 11/128 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V   ++   A P+     +   E G+  ++ L    P               ++ 
Sbjct: 7   GNFSWVDKGKVAGLAFPHTAEHLHYIHEQGVHHLVTLTMNSPP------MDTCPM--LKW 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +      + +QI + + I++ +    + + +HC  G  RTG   A YL        
Sbjct: 59  HRIKMPDFTAPSMDQIYKYLKIVEESNAKGEAVAVHCAHGNGRTGTMLACYLVKTRKISG 118

Query: 159 EEAHRQLS 166
           ++A   + 
Sbjct: 119 QDAINLIR 126


>gi|302773928|ref|XP_002970381.1| hypothetical protein SELMODRAFT_231635 [Selaginella moellendorffii]
 gi|300161897|gb|EFJ28511.1| hypothetical protein SELMODRAFT_231635 [Selaginella moellendorffii]
          Length = 164

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 52/145 (35%), Gaps = 9/145 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    IYRS  PN T +     +  +KSI+++R     S  +     +    ++  
Sbjct: 18  NFAVVDRG-IYRSGYPNITNL-PFLGKRRLKSIISIRTTSSSSSARTRSLFSTSALMETR 75

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
             P        D     L ++L     P+LIHC  G  RTG        +   +      
Sbjct: 76  REPFVD--IPEDVIRLALKNLLDPGNHPVLIHCNKGKHRTGCLVGCLRKL-QRWS----L 128

Query: 163 RQLSMLYGHFPVLKTITMDITFEKI 187
             +   Y  F   K   +D  F ++
Sbjct: 129 TAIFDEYRRFAGTKVRMLDQQFMEL 153


>gi|326927851|ref|XP_003210102.1| PREDICTED: LOW QUALITY PROTEIN: protein tyrosine phosphatase
           domain-containing protein 1-like [Meleagris gallopavo]
          Length = 781

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             +  + I   A+P+        I    +  GIK+I+NL+              ES    
Sbjct: 128 SWITDN-ILAMARPSTELIEKYNIIEQFERCGIKTIINLQRPGEHASCGNPLEQESGFTY 186

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 187 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMAFALQEGRVAVHCHAGLGRTGVLVA 246

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 247 CYLVFATRMTADQAILFVRAKRPNSIQTRGQLL 279


>gi|171688968|ref|XP_001909424.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944446|emb|CAP70557.1| unnamed protein product [Podospora anserina S mat+]
          Length = 294

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 38/102 (37%), Gaps = 8/102 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VVP  +YRS+ P         +   +K+I+ L  K     +    K     GI   
Sbjct: 133 NFGVVVPG-VYRSSFPQSEDY-GFIEGLKLKTIVTLVQKEFPQGYD---KFIERNGINHC 187

Query: 103 NFPLSATR---ELNDEQIKQLISILKTAPKPLLIHCKSGADR 141
            F +  T+            L  +L     PLLIHC  G  R
Sbjct: 188 VFDMKGTKKQAIPIATMRSILRLVLDRRNHPLLIHCNHGKVR 229


>gi|115622037|ref|XP_001200325.1| PREDICTED: similar to RE13143p [Strongylocentrotus purpuratus]
 gi|115630616|ref|XP_001188241.1| PREDICTED: similar to RE13143p [Strongylocentrotus purpuratus]
          Length = 192

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/141 (18%), Positives = 53/141 (37%), Gaps = 9/141 (6%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQ 119
                  KE  +K +++L        H    +   + GI+ +  P    T   + E +++
Sbjct: 42  RSYIDQLKEENVKGVISLNEDHELRRHAPTVEEWKNHGIEHLQLPTVDFTEAPSLEYLER 101

Query: 120 LISILK---TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLK 176
            +  ++        + +HCK+G  R+      YL ++ H   +EA   +     H     
Sbjct: 102 GVEFIQQHANDGSSVYVHCKAGRTRSATLVGCYLMMMNHCTPQEAQTFMEAKRPHI---- 157

Query: 177 TITMDITFEKITQLYPNNVSK 197
            +  D  F  + + Y  +V K
Sbjct: 158 -LLKDRHFRALYRYYDKHVKK 177


>gi|262368392|ref|ZP_06061721.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316070|gb|EEY97108.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 174

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 54/126 (42%), Gaps = 6/126 (4%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +  H ++ S QP    +    KEYG+ +++NL      ++   E++   +LG+  I
Sbjct: 13  NFQFIHEH-LFTSGQPTAEQL-QQIKEYGVNTVINLALSNSNNYLANEDQICLELGLNYI 70

Query: 103 NFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           + P+ +    +D+Q   ++ ++      + + +HC     R      +Y     +     
Sbjct: 71  HVPI-SWDTPSDDQCLLVLDMIDHLVQEQTIWVHCSENY-RVSSLMYLYRQYYMNIDMPT 128

Query: 161 AHRQLS 166
           AH  + 
Sbjct: 129 AHEAMH 134


>gi|75909256|ref|YP_323552.1| hypothetical protein Ava_3047 [Anabaena variabilis ATCC 29413]
 gi|75702981|gb|ABA22657.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 127

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           + +E+  + Q      + + ++ G KS+LNLR          E++    LG++ INFP+ 
Sbjct: 7   INNELAIAGQITPDQFQKITED-GYKSVLNLRSPDERGLLDNEQEKLEFLGLRYINFPMK 65

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
              E+N+    Q++  +   PKPLLIHC   + R+ + + +Y+        E+A  
Sbjct: 66  -FEEINNRTTLQILQTINELPKPLLIHCD-NSIRSSVLALLYVATKQGITFEKALE 119


>gi|255713638|ref|XP_002553101.1| KLTH0D08976p [Lachancea thermotolerans]
 gi|238934481|emb|CAR22663.1| KLTH0D08976p [Lachancea thermotolerans]
          Length = 205

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 51/145 (35%), Gaps = 19/145 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS QP+         +  +K+I+ L  + P+       +  +   IQL 
Sbjct: 40  NFCPV-ERYLYRSGQPSTVNF-PFLLDLKLKTIIWLANEEPQDALL---EFCDAHAIQLQ 94

Query: 103 NFPLSATRELNDE---------QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
              ++     +D           I  L +I+     PLL+ C  G  RTG        I+
Sbjct: 95  FATINPDGGEDDNPWDGLTEHSIISALRTIVNVESYPLLVCCGMGRHRTGTVIGCLRRIM 154

Query: 154 AHYPKEEAHRQLSMLYGHFPVLKTI 178
             +        +S  Y  F   +  
Sbjct: 155 -GWN----LASVSEEYRRFTGSRGG 174


>gi|26343481|dbj|BAC35397.1| unnamed protein product [Mus musculus]
          Length = 525

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 53/151 (35%), Gaps = 17/151 (11%)

Query: 47  VVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKEEE 91
           VV   I   A+P+        I       GIK+I+NL+              ES      
Sbjct: 10  VVTDNILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTYLP 69

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVY 149
           +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A Y
Sbjct: 70  EAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIACY 129

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           L        ++A   +     +    +   +
Sbjct: 130 LVFATRMTADQAIIFVRAKRPNSIQTRGQLL 160


>gi|300114244|ref|YP_003760819.1| hypothetical protein Nwat_1611 [Nitrosococcus watsonii C-113]
 gi|299540181|gb|ADJ28498.1| protein of unknown function DUF442 [Nitrosococcus watsonii C-113]
          Length = 147

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK---EEEKAANDLGIQLINFPLSATRE 111
             QP    +    K+ G ++++NLR    +       +E    ++LG++  + P+ +   
Sbjct: 14  GGQPFKEDL-QQLKQEGFQTVINLRATGEKDQPLSPSDEGAIVSELGMEYAHLPV-SMDA 71

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           LN+  + Q    L+ APKP+ +HC SG  R G  + +   +      E A +
Sbjct: 72  LNETLVDQFRERLEAAPKPVFVHCASGK-RAGAFAMMATAVEQGMNGETALQ 122


>gi|118096838|ref|XP_414322.2| PREDICTED: similar to protein tyrosine phosphatase domain
           containing 1 protein [Gallus gallus]
          Length = 781

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 55/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             +  + I   A+P+        I    ++ GIK+I+NL+              ES    
Sbjct: 128 SWITDN-ILAMARPSTELIEKYNIIEQFEKCGIKTIINLQRPGEHASCGNPLEQESGFTY 186

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 187 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMAFALQEGRVAVHCHAGLGRTGVLVA 246

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 247 CYLVFATRMTADQAILFVRAKRPNSIQTRGQLL 279


>gi|291397655|ref|XP_002715321.1| PREDICTED: dual specificity phosphatase 23 [Oryctolagus cuniculus]
          Length = 150

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 46/128 (35%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          E G++ +++L  + P           +  G+ +
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLLELGVRHLVSLTERGPPHSD-------SCPGLTV 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +         QI + + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPAPNQIDRFVQIVDEANARGEAVGVHCALGYGRTGTMLACYLVKEKGLAA 118

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 119 GDAIAEIR 126


>gi|320583554|gb|EFW97767.1| tyrosine phosphatase, putative [Pichia angusta DL-1]
          Length = 240

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/165 (16%), Positives = 51/165 (30%), Gaps = 22/165 (13%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P     E       +K+I+ +        +   +  A   G + I
Sbjct: 75  NFATVESD-LYRSGHPQPINFE-FLDTLNLKTIIYI--GDKTDNYDYYKWIAGHAGEKTI 130

Query: 103 NFPLSATRELN-----------DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
           +F     +  +                 L  +      P+LIH   G  R G+   +   
Sbjct: 131 SFRFFKMKPPSTFGTSHMFNDEVALNTVLNLVANRENYPILIHSNKGKHRVGVLVGLIRK 190

Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLK-TITMDIT--FEKITQLYPN 193
            +  +       +    Y  F   K    ++    F+ I ++ P 
Sbjct: 191 FLQGWSLSGTFDE----YAKFAREKGEGDLEFIETFKPIIKIDPE 231


>gi|291383464|ref|XP_002708339.1| PREDICTED: protein tyrosine phosphatase domain containing 1 protein
           [Oryctolagus cuniculus]
          Length = 804

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 53/153 (34%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V    I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 132 SWVT-DSILAMARPSSELLEKYQIIEQFLSHGIKTIINLQRPGEHASCGSSLEQESGFTY 190

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 191 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 250

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 251 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 283


>gi|255725660|ref|XP_002547759.1| hypothetical protein CTRG_02066 [Candida tropicalis MYA-3404]
 gi|240135650|gb|EER35204.1| hypothetical protein CTRG_02066 [Candida tropicalis MYA-3404]
          Length = 227

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 33/166 (19%), Positives = 56/166 (33%), Gaps = 33/166 (19%)

Query: 36  TITTFTQ-NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAA 94
            +      NF  V   ++YRS QP+    E    +  +K+I+ L  + P     E ++  
Sbjct: 44  NLRIIPPLNFCPV-EKQLYRSGQPSMIN-ESFLNQLNLKTIIWLANEEPS---DEFQEYC 98

Query: 95  NDLGIQLINFPL---------------------SATRELNDE-QIKQLISILKTAPKPLL 132
           +D  I +    +                     +    LND    K L  I+  +  P+L
Sbjct: 99  SDSNINIEYIGMINDFQSQFESNYNNVNRSTMANPWDALNDTTIKKSLEVIVDKSNYPIL 158

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTI 178
           I C  G  RTG        +  ++        +S  Y  F   +  
Sbjct: 159 ICCGMGRHRTGTVIGCLRRL-QNWN----LNSVSEEYRRFTGARGG 199


>gi|189233706|ref|XP_968287.2| PREDICTED: similar to Protein tyrosine phosphatase
           domain-containing protein 1 [Tribolium castaneum]
          Length = 593

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 50/141 (35%), Gaps = 17/141 (12%)

Query: 45  HAVVPHEIYRSAQPN-----GTFIEYLKKEYGIKSILNLRGKLP---------ESWHKEE 90
           H +    I   A+P+        I    +  GIKSI+NL+             ES    +
Sbjct: 65  HWITDD-ILAMARPSTMVIVQKNIIQQFESLGIKSIINLQSPREHASCGQPLEESGFSYD 123

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAV 148
                +  I   NF      +     +  ++ +L  A     + IHC +G  RTG+  A 
Sbjct: 124 PNIFMEHNIFYYNFAWKDYGDATLVGLLNMVKVLAFAVTEGRVAIHCHAGLGRTGVLIAC 183

Query: 149 YLYIVAHYPKEEAHRQLSMLY 169
           YL         +A R + +  
Sbjct: 184 YLVYSLRVSANDAIRYVRLKR 204


>gi|186683839|ref|YP_001867035.1| hypothetical protein Npun_R3702 [Nostoc punctiforme PCC 73102]
 gi|186466291|gb|ACC82092.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
          Length = 159

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 41/138 (29%), Positives = 68/138 (49%), Gaps = 10/138 (7%)

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS-ATRELND 114
            Q     +E   +E G KS+LNLR      + K+E+K A  LG+   N PL    + LN+
Sbjct: 15  GQVIPKQLEQAIQE-GFKSVLNLRSPDELGFSKDEQKVAEALGLHYKNVPLKVDLKNLNE 73

Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH-RQLSMLYGHF- 172
           E I ++++ L+  PKP ++HC +G   TG  + + + I      EE   R  ++ +G F 
Sbjct: 74  EAITKILTTLEEIPKPAVVHCAAGMRSTG-IALLSIAIQEGLTPEETLARAKNLGFGFFE 132

Query: 173 -----PVLKTITMDITFE 185
                P L+ + +D   +
Sbjct: 133 HAGVSPRLRQLFVDYVNK 150


>gi|148709109|gb|EDL41055.1| expressed sequence AW456874, isoform CRA_c [Mus musculus]
          Length = 550

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 53/151 (35%), Gaps = 17/151 (11%)

Query: 47  VVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKEEE 91
           VV   I   A+P+        I       GIK+I+NL+              ES      
Sbjct: 35  VVTDNILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTYLP 94

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVY 149
           +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A Y
Sbjct: 95  EAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIACY 154

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           L        ++A   +     +    +   +
Sbjct: 155 LVFATRMTADQAIIFVRAKRPNSIQTRGQLL 185


>gi|134107882|ref|XP_777323.1| hypothetical protein CNBB1250 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260013|gb|EAL22676.1| hypothetical protein CNBB1250 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 178

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 32/172 (18%), Positives = 56/172 (32%), Gaps = 37/172 (21%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V     YRSAQP+        ++  +KSI+ +  + P        +     GI+L 
Sbjct: 2   NFGLVEDG-FYRSAQPS-ELCFSFLEKLNLKSIIWVGAEEPSDIFLSFIE---SQGIKLY 56

Query: 103 NFPLSATRELN---------------------------DEQIKQLISILKTAPKPLLIHC 135
           N     +   +                              I+ L  +L+ +  P L+ C
Sbjct: 57  NLAPQTSLNPHFPPPYTDSGVVPISGQYHLPPLPPPPEPLIIQALTLLLRPSTFPTLLCC 116

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
             G  RTG     Y  +        A   +   Y  +  +K   ++  F ++
Sbjct: 117 NMGRHRTGTVVGCYRKLQ-----RWALSSILEEYRRYAGMKVRVLNEQFIEL 163


>gi|163744309|ref|ZP_02151669.1| hypothetical protein OIHEL45_01960 [Oceanibulbus indolifex HEL-45]
 gi|161381127|gb|EDQ05536.1| hypothetical protein OIHEL45_01960 [Oceanibulbus indolifex HEL-45]
          Length = 152

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 58/135 (42%), Gaps = 15/135 (11%)

Query: 58  PNGTFIEYLKKEYGIKSILNLRGKLPES--WHKEEEKAANDLGIQLINFPLSATRELNDE 115
           P+   +E      G+K+++N R    +      EE   A  LG+  ++ P++    L  E
Sbjct: 22  PDAKALEQ-AASAGMKTVINFRAADEKGGLSPDEERLVAEKLGLNYLHHPVTP-DTLGPE 79

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL 175
            + +    L   P+P+ +HC SG  R G  + + L     +  + A ++           
Sbjct: 80  TVDEFRRSLDDLPQPVFLHCASGK-RAGAMTLMALAADKGWDGDTALQE----------G 128

Query: 176 KTITMDITFEKITQL 190
           KT  +D+T EKI Q 
Sbjct: 129 KTRGIDLTEEKIGQF 143


>gi|119583279|gb|EAW62875.1| protein tyrosine phosphatase domain containing 1, isoform CRA_a
           [Homo sapiens]
          Length = 749

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|27497737|gb|AAO13168.1| protein tyrosine phosphatase [Homo sapiens]
          Length = 754

 Score = 74.8 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|123407126|ref|XP_001302937.1| Tyrosine phosphatase family protein [Trichomonas vaginalis G3]
 gi|121884273|gb|EAX90007.1| Tyrosine phosphatase family protein [Trichomonas vaginalis G3]
          Length = 210

 Score = 74.8 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 51/151 (33%), Gaps = 14/151 (9%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V  +++YRSA P  +      +   +K+++ L    P S      +   +  +  
Sbjct: 7   PNFGFV-ENDLYRSALPTQSNF-SFLQTLRLKTVVFLSQDQPSSIFL---EFIKEQNVNF 61

Query: 102 INFPLSATRELNDEQIKQL-----ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
                S T        +QL       IL     P+L+ C  G  RTG         V  +
Sbjct: 62  CALASSDTMAAGQRFSEQLALDALKIILNPDSYPVLVCCNLGIHRTGSVIGCLR-KVQRW 120

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
                  +    YG+    K   +   F ++
Sbjct: 121 ALSAIFDEFRRYYGN---GKPSGIHEQFIEL 148


>gi|30089950|ref|NP_818931.1| protein tyrosine phosphatase domain-containing protein 1 isoform 2
           [Homo sapiens]
 gi|162416031|sp|A2A3K4|PTPC1_HUMAN RecName: Full=Protein tyrosine phosphatase domain-containing
           protein 1
 gi|119583280|gb|EAW62876.1| protein tyrosine phosphatase domain containing 1, isoform CRA_b
           [Homo sapiens]
 gi|123228273|emb|CAM20720.1| protein tyrosine phosphatase domain containing 1 [Homo sapiens]
          Length = 754

 Score = 74.8 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|30089952|ref|NP_689635.3| protein tyrosine phosphatase domain-containing protein 1 isoform 1
           [Homo sapiens]
 gi|123228274|emb|CAI14621.2| protein tyrosine phosphatase domain containing 1 [Homo sapiens]
          Length = 806

 Score = 74.8 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 136 SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 194

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 195 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 254

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 255 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 287


>gi|323331976|gb|EGA73388.1| Oca2p [Saccharomyces cerevisiae AWRI796]
          Length = 172

 Score = 74.8 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 58/147 (39%), Gaps = 11/147 (7%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE--LNDEQI 117
                ++K +  +K+I+ +     +   +E +       I+  +  + ++R+  + +   
Sbjct: 2   PLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN 59

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           + L  +L     P+L+H   G  R G+   +   ++  +     +++    YG F     
Sbjct: 60  QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGIYQE----YGLFSGGMK 115

Query: 178 ITMDITFEKITQLY---PNNVSKGDTE 201
             +D+ F  + +     P NV  G  +
Sbjct: 116 DGVDLEFITMFETNLKIPRNVIPGFAK 142


>gi|37519575|ref|NP_922952.1| hypothetical protein glr0006 [Gloeobacter violaceus PCC 7421]
 gi|35210566|dbj|BAC87947.1| glr0006 [Gloeobacter violaceus PCC 7421]
          Length = 148

 Score = 74.8 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 48/131 (36%), Gaps = 11/131 (8%)

Query: 36  TITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN 95
              + T+N   V+P ++    +P    I  L+   G+  I+++                 
Sbjct: 1   MEQSITENLWWVIPGKLGGVRKPTEAEIAELQAS-GVGGIVSVMDD------PGNLDLYE 53

Query: 96  DLGIQLINFPLSATRELNDEQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYLYI 152
             G+     P+        EQI QL   ++        + +HC SG  RTG   A YL  
Sbjct: 54  RAGLPYRWLPVKGGTAPTREQITQLQDFVEEQNALGAGVAVHCTSGRRRTGTFLAAYLIA 113

Query: 153 VAHYPKEEAHR 163
              +  EEA +
Sbjct: 114 -QSHSSEEALQ 123


>gi|58268464|ref|XP_571388.1| cytoplasm protein [Cryptococcus neoformans var. neoformans JEC21]
 gi|134112698|ref|XP_774892.1| hypothetical protein CNBF0570 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257540|gb|EAL20245.1| hypothetical protein CNBF0570 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227623|gb|AAW44081.1| cytoplasm protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 190

 Score = 74.8 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 58/167 (34%), Gaps = 11/167 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  IYRS  PN        K   +K I+ + G  P      +   + +L +   
Sbjct: 24  NFSLVAPG-IYRSGHPNRKNF-PFLKRLNLKGIIYVEGSDPYRQDSLDFVQSQNLELYRF 81

Query: 103 NFPLSA---TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +F   +   T E  +     L  +L     PLL+H  +G     L  A+       +   
Sbjct: 82  DFSNESDLYTPEGQERMEALLKVLLDKRNYPLLVHDDTGKGSCTLVCALIR-RFQSWSLT 140

Query: 160 E--AHRQLSMLYGHFPVLKTITMDIT-FEKITQLYPNNVSKGDTEQP 203
              A   +    G     + + +  T  E I    P  V+   T +P
Sbjct: 141 GLFAEGDMFA--GPAGGAEGVGLGETGMEFIAAFQPKLVAYDRTWRP 185


>gi|297684837|ref|XP_002820020.1| PREDICTED: protein tyrosine phosphatase domain-containing protein
           1-like isoform 1 [Pongo abelii]
          Length = 808

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+++NL+              ES    
Sbjct: 138 SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTVINLQRPGEHASCGNPLEQESGFTY 196

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 197 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 256

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 257 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 289


>gi|114625585|ref|XP_001147844.1| PREDICTED: protein tyrosine phosphatase domain containing 1 protein
           isoform 2 [Pan troglodytes]
          Length = 754

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|297271379|ref|XP_001104435.2| PREDICTED: protein tyrosine phosphatase domain-containing protein 1
           isoform 1 [Macaca mulatta]
          Length = 808

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 138 SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 196

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 197 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 256

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 257 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 289


>gi|114625587|ref|XP_520702.2| PREDICTED: protein tyrosine phosphatase domain-containing protein 1
           isoform 3 [Pan troglodytes]
          Length = 806

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 136 SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 194

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 195 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 254

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 255 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 287


>gi|114625589|ref|XP_001147770.1| PREDICTED: protein tyrosine phosphatase domain containing 1 protein
           isoform 1 [Pan troglodytes]
          Length = 703

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 33  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 91

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 92  LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 151

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 152 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 184


>gi|45501280|gb|AAH67120.1| Protein tyrosine phosphatase domain containing 1 [Homo sapiens]
          Length = 754

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|118138468|pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase
           23 From Homo Sapiens In Complex With Ligand Malate Ion
          Length = 151

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 47/128 (36%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P           +  G+ L
Sbjct: 7   PNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSD-------SCPGLTL 59

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        +QI + + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 60  HRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTXLACYLVKERGLAA 119

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 120 GDAIAEIR 127


>gi|320104939|ref|YP_004180530.1| hypothetical protein Isop_3423 [Isosphaera pallida ATCC 43644]
 gi|319752221|gb|ADV63981.1| hypothetical protein Isop_3423 [Isosphaera pallida ATCC 43644]
          Length = 231

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 49/123 (39%), Gaps = 3/123 (2%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL---RGKLPESWHKEEEKAANDLGIQLIN 103
           + P  + R A      +  L +  GI+SI+ L       P+   +    A     I+ I 
Sbjct: 55  IEPGGLVRGAWQKPGPLRRLLEREGIRSIVTLTAINPDDPKYVGQANALAGVGRPIRWIQ 114

Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
                +    ++  +    +   + +P+  HC +G  RTGLA A YL     +   +A  
Sbjct: 115 LDWRGSTATLEQMAQAADLLADQSLRPIFFHCVAGHHRTGLAHAAYLIRHRGFTAAQAWD 174

Query: 164 QLS 166
           QLS
Sbjct: 175 QLS 177


>gi|299769695|ref|YP_003731721.1| hypothetical protein AOLE_07275 [Acinetobacter sp. DR1]
 gi|298699783|gb|ADI90348.1| hypothetical protein AOLE_07275 [Acinetobacter sp. DR1]
          Length = 174

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL      ++ + E++   DLG+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSAEQLK-LIKEYGCSTVINLALSNAPNYIENEDRICLDLGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + EQ   ++ ++      + + IHC    DR+     VY     +     +   
Sbjct: 75  -DWETPSAEQCLLVLDLIDHLVQNEIVWIHCSKN-DRSSCLMYVYRQFYMNMDMPTSQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|323346914|gb|EGA81193.1| Oca2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 172

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 58/147 (39%), Gaps = 11/147 (7%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE--LNDEQI 117
                ++K +  +K+I+ +     +   +E +       I+  +  + ++R+  + +   
Sbjct: 2   PLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN 59

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           + L  +L     P+L+H   G  R G+   +   ++  +     +++    YG F     
Sbjct: 60  QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGIYQE----YGLFSGGMK 115

Query: 178 ITMDITFEKITQLY---PNNVSKGDTE 201
             +D+ F  + +     P NV  G  +
Sbjct: 116 DGVDLEFITMFETNLKIPRNVIPGFAK 142


>gi|297684839|ref|XP_002820021.1| PREDICTED: protein tyrosine phosphatase domain-containing protein
           1-like isoform 2 [Pongo abelii]
          Length = 754

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+++NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTVINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|297271381|ref|XP_002800240.1| PREDICTED: protein tyrosine phosphatase domain-containing protein 1
           isoform 2 [Macaca mulatta]
          Length = 754

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|323352586|gb|EGA85085.1| Oca2p [Saccharomyces cerevisiae VL3]
          Length = 172

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 58/147 (39%), Gaps = 11/147 (7%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE--LNDEQI 117
                ++K +  +K+I+ +     +   +E +       I+  +  + ++R+  + +   
Sbjct: 2   PLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN 59

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           + L  +L     P+L+H   G  R G+   +   ++  +     +++    YG F     
Sbjct: 60  QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGIYQE----YGLFSGGMK 115

Query: 178 ITMDITFEKITQLY---PNNVSKGDTE 201
             +D+ F  + +     P NV  G  +
Sbjct: 116 DGVDLEFITMFETNLKIPRNVIPGFAK 142


>gi|148709108|gb|EDL41054.1| expressed sequence AW456874, isoform CRA_b [Mus musculus]
          Length = 696

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 53/153 (34%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I       GIK+I+NL+              ES    
Sbjct: 33  SWVTDN-ILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTY 91

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 92  LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 151

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 152 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 184


>gi|74182958|dbj|BAE20451.1| unnamed protein product [Mus musculus]
          Length = 845

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 53/153 (34%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I       GIK+I+NL+              ES    
Sbjct: 182 SWVTDN-ILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTY 240

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 241 LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 300

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 301 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 333


>gi|46402213|ref|NP_997115.1| protein tyrosine phosphatase domain-containing protein 1 [Mus
           musculus]
 gi|81911198|sp|Q6NZK8|PTPC1_MOUSE RecName: Full=Protein tyrosine phosphatase domain-containing
           protein 1
 gi|41945488|gb|AAH66081.1| Protein tyrosine phosphatase domain containing 1 [Mus musculus]
 gi|148709107|gb|EDL41053.1| expressed sequence AW456874, isoform CRA_a [Mus musculus]
          Length = 747

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 53/153 (34%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I       GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|74187050|dbj|BAE20543.1| unnamed protein product [Mus musculus]
          Length = 747

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 53/153 (34%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I       GIK+I+NL+              ES    
Sbjct: 84  SWVTDN-ILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|331028547|ref|NP_001193525.1| protein tyrosine phosphatase domain-containing protein 1 [Bos
           taurus]
          Length = 816

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 56/153 (36%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIE-----YLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+   +E        + +GIKSI+NL+              ES    
Sbjct: 148 SWVTDN-ILAMARPSTEVLEKFCIIEQFRSHGIKSIINLQRPGEHASCGNPLEQESGFTY 206

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 207 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 266

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 267 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 299


>gi|296484453|gb|DAA26568.1| protein tyrosine phosphatase domain containing 1 [Bos taurus]
          Length = 816

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 56/153 (36%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIE-----YLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+   +E        + +GIKSI+NL+              ES    
Sbjct: 148 SWVTDN-ILAMARPSTEVLEKFCIIEQFRSHGIKSIINLQRPGEHASCGNPLEQESGFTY 206

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 207 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 266

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 267 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 299


>gi|162416201|sp|A7E379|PTPC1_BOVIN RecName: Full=Protein tyrosine phosphatase domain-containing
           protein 1
          Length = 796

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 56/153 (36%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIE-----YLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+   +E        + +GIKSI+NL+              ES    
Sbjct: 128 SWVTDN-ILAMARPSTEVLEKFCIIEQFRSHGIKSIINLQRPGEHASCGNPLEQESGFTY 186

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 187 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 246

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 247 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 279


>gi|154757384|gb|AAI51751.1| PTPDC1 protein [Bos taurus]
          Length = 787

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 56/153 (36%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIE-----YLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+   +E        + +GIKSI+NL+              ES    
Sbjct: 128 SWVTDN-ILAMARPSTEVLEKFCIIEQFRSHGIKSIINLQRPGEHASCGNPLEQESGFTY 186

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 187 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 246

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 247 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 279


>gi|74210171|dbj|BAE21357.1| unnamed protein product [Mus musculus]
          Length = 878

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 53/153 (34%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I       GIK+I+NL+              ES    
Sbjct: 215 SWVTDN-ILAMARPSSELLEKYRIIEQFLGQGIKTIINLQRPGEHASCGSALEQESGFTY 273

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 274 LPEAFMEAGIYFYNFGWKDYGVASLTAILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 333

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 334 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 366


>gi|307153431|ref|YP_003888815.1| hypothetical protein Cyan7822_3599 [Cyanothece sp. PCC 7822]
 gi|306983659|gb|ADN15540.1| protein of unknown function DUF442 [Cyanothece sp. PCC 7822]
          Length = 155

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 53/145 (36%), Gaps = 9/145 (6%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +N++ V P+ I  S QP       + K  G ++++NL     +     E      LG+  
Sbjct: 6   KNYYQVNPN-IATSGQPTSEQF-QVIKNAGYETVINLALPTSDQALANEAAIVTGLGMPY 63

Query: 102 INFPLSATRELNDEQIKQLISILKTA-PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            N P+        + ++   S+++    + + +HC     R      +Y     +  +++
Sbjct: 64  FNIPVV-WEAPKLDDVRWFFSVMEALKERKVWVHCAVNK-RVSCFVYLYQKYGLNLSEKD 121

Query: 161 AHRQLSMLYGHFPVLKTITMDITFE 185
           A   +     +      I     FE
Sbjct: 122 ARYPM----YNIWQPNEIWQHFIFE 142


>gi|9280136|dbj|BAB01622.1| unnamed protein product [Macaca fascicularis]
          Length = 683

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 33  SWVTDN-ILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 91

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 92  LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIA 151

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 152 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 184


>gi|327278547|ref|XP_003224023.1| PREDICTED: protein tyrosine phosphatase domain-containing protein
           1-like [Anolis carolinensis]
          Length = 715

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   ++P+        I    +  GIK+++NL+              ES    
Sbjct: 85  SWVTDN-ILAMSRPSTELIEKYNIIEQFQRCGIKTVINLQRPGEHASCGNPLEQESGFTY 143

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 144 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGRVAVHCHAGLGRTGVLIA 203

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 204 CYLVFATRMTADQAILFVRAKRPNSIQTRGQLL 236


>gi|323307448|gb|EGA60722.1| Oca2p [Saccharomyces cerevisiae FostersO]
          Length = 172

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 57/147 (38%), Gaps = 11/147 (7%)

Query: 60  GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRE--LNDEQI 117
                ++K +  +K+I+ +     +   +E +       I+  +  + ++R+  + +   
Sbjct: 2   PLNYSFIKHQLHLKTIIYI--GDKDRPLEEYQSFLESEKIKYYHIFMDSSRDEGIQERMN 59

Query: 118 KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           + L  +L     P+L+H   G  R G+   +   ++  +     +++    YG F     
Sbjct: 60  QVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRKLLQGWSTAGIYQE----YGLFSGGMK 115

Query: 178 ITMDITFEKITQLY---PNNVSKGDTE 201
             +D+ F    +     P NV  G  +
Sbjct: 116 DGVDLEFITXFETNLKIPRNVIPGFAK 142


>gi|321455462|gb|EFX66593.1| hypothetical protein DAPPUDRAFT_93684 [Daphnia pulex]
          Length = 183

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/171 (14%), Positives = 61/171 (35%), Gaps = 10/171 (5%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                A ++ +  ++   +  +    V + +   A P       L ++  + +I++L   
Sbjct: 10  FFPSLAYNVMMEKISSRQWYNH----VDNHVILGALPLRYKTRELVEQEKVNAIVSLNED 65

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSAT-RELNDEQIKQLISILKTA---PKPLLIHCKS 137
               +   + +    LG++ I F +         + + + +  +         + +HCK+
Sbjct: 66  YEVRYLTNQPEEWKKLGVENIRFSVVDMFEAPPQKMLLEGVEFMNNTVSKGGVVYVHCKA 125

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL--KTITMDITFEK 186
           G  R+    A YL     +   +A   L  +  H  +   K   +D  ++ 
Sbjct: 126 GRSRSAALVACYLMKKHGWTPVQAILHLKSVRPHILLPPNKVEALDTFYKN 176


>gi|253568944|ref|ZP_04846354.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251840963|gb|EES69044.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 356

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 61/177 (34%), Gaps = 35/177 (19%)

Query: 50  HEIYRSAQPNGTFI--EYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDL-----GI 99
             +YRSAQ +          K  GI++I++LR +          +E+     L      +
Sbjct: 134 GMLYRSAQIDSIPFCSRRELKNMGIRTIIDLRSEEERHNYPQFHDEDFNVLHLPIATGNM 193

Query: 100 QLINFPLSATRELND-------------------EQIKQLISILKTAPKPLLIHCKSGAD 140
           + I   +   +   D                   E  +    +L     P++IHC SG  
Sbjct: 194 EHILQDIRDKKIETDTIYRLVERMNRQLVTNYRKEYKELFTLLLDRNNYPVVIHCTSGKG 253

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF-----EKITQLYP 192
           RTG+ SA+ L       +E   +   +   +F + K             E IT +Y 
Sbjct: 254 RTGIVSALVLAA-LGVNEEAIMKDYRLSNDYFNIPKASRYAYKLPINSQEAITTIYS 309


>gi|224065377|ref|XP_002192098.1| PREDICTED: similar to Protein tyrosine phosphatase
           domain-containing protein 1 [Taeniopygia guttata]
          Length = 778

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             +  + I   A+P+        I    +  GIK+I+NL+              ES    
Sbjct: 128 SWITDN-ILAMARPSTEVIEKYNIIEQFERCGIKTIINLQRPGEHASCGNPLEQESGFTY 186

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 187 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMSFALQEGRVAVHCHAGLGRTGVLIA 246

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 247 CYLVFATRMSADQAILFVRAKRPNSIQTRGQLL 279


>gi|72111445|ref|XP_789793.1| PREDICTED: similar to LOC495348 protein [Strongylocentrotus
           purpuratus]
 gi|115948870|ref|XP_001197446.1| PREDICTED: similar to LOC495348 protein [Strongylocentrotus
           purpuratus]
          Length = 155

 Score = 74.0 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 43/126 (34%), Gaps = 11/126 (8%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  V  + +     P+         + GI+ +++L  +               +GI    
Sbjct: 10  FTWVSSN-LAAHGMPSSPDQMRYLADNGIRYLISLTTECRPPVEATPNVTWVPIGI---- 64

Query: 104 FPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
                      EQ+ + + +++ A    + + +HC  G  RTG   A Y   +      E
Sbjct: 65  ---DDYHPPTLEQVVEFMRVMEEAEEKNEAVSVHCLRGRGRTGTMVACYFIKMQKMSAAE 121

Query: 161 AHRQLS 166
           A  ++ 
Sbjct: 122 AIAEVR 127


>gi|163793454|ref|ZP_02187429.1| hypothetical protein BAL199_03064 [alpha proteobacterium BAL199]
 gi|159181256|gb|EDP65771.1| hypothetical protein BAL199_03064 [alpha proteobacterium BAL199]
          Length = 153

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 4/110 (3%)

Query: 56  AQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINFPLSATRELN 113
           A P          + G  SI+NLR   +  E     E + A + G+  ++ P+ +  +L+
Sbjct: 15  ALPLDRTDIQQAAQNGFGSIVNLRTTAEKQELAPDAEGRIAKNQGLAYLHHPV-SGDDLS 73

Query: 114 DEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           ++ +++    + + P P+L+HC +G  R+G    ++L I      E+A  
Sbjct: 74  EDAVERFRQKINSLPGPILVHCATG-RRSGALVMMHLAIEQGLSGEQAVE 122


>gi|158260407|dbj|BAF82381.1| unnamed protein product [Homo sapiens]
          Length = 808

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I      +GIK+I+NL+              ES    
Sbjct: 138 SWVTDN-ILPMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTY 196

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + IHC +G  RTG+  A
Sbjct: 197 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGRGRTGVLIA 256

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 257 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 289


>gi|29348713|ref|NP_812216.1| hypothetical protein BT_3304 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29340619|gb|AAO78410.1| possible protein-tyrosine-phosphatase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 356

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 64/177 (36%), Gaps = 35/177 (19%)

Query: 50  HEIYRSAQPNGTFI--EYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLG-------I 99
             +YRSAQ +          K  GI++I++LR +    ++ +  ++  N L        +
Sbjct: 134 GMLYRSAQIDSIPFCSRRELKNMGIRTIIDLRSEEERHNYPQLHDEDFNVLHLPIATGNM 193

Query: 100 QLINFPLSATRELND-------------------EQIKQLISILKTAPKPLLIHCKSGAD 140
           + I   +   +   D                   E  +    +L     P++IHC SG  
Sbjct: 194 EHILQDIRDKKIETDTIYRLVERMNRQLVTNYRKEYKELFTLLLDRNNYPVVIHCTSGKG 253

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF-----EKITQLYP 192
           RTG+ SA+ L       +E   +   +   +F + K             E IT +Y 
Sbjct: 254 RTGIVSALVLAA-LGVNEEAIMKDYRLSNDYFNIPKASRYAYKLPINSQEAITTIYS 309


>gi|55926215|ref|NP_081001.1| dual specificity protein phosphatase 23 [Mus musculus]
 gi|73620830|sp|Q6NT99|DUS23_MOUSE RecName: Full=Dual specificity protein phosphatase 23; AltName:
           Full=Low molecular mass dual specificity phosphatase 3;
           Short=LDP-3
 gi|46621317|gb|AAH69187.1| Dual specificity phosphatase 23 [Mus musculus]
 gi|49614936|dbj|BAD26711.1| low-molecular-mass dual-specificity phosphatase [Mus musculus]
 gi|148707057|gb|EDL39004.1| dual specificity phosphatase 23 [Mus musculus]
          Length = 150

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 48/128 (37%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P           +  G+ L
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLLDQGVRHLVSLTERGPPHSD-------SCPGLTL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +      + EQI Q + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRMRIPDFCPPSPEQIDQFVKIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERALAA 118

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 119 GDAIAEIR 126


>gi|146304131|ref|YP_001191447.1| dual specificity protein phosphatase [Metallosphaera sedula DSM
           5348]
 gi|145702381|gb|ABP95523.1| dual specificity protein phosphatase [Metallosphaera sedula DSM
           5348]
          Length = 147

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 53/131 (40%), Gaps = 7/131 (5%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESW--HKEEEKAANDLGI 99
            + V  + I  S  P+        K  G++ IL L     + E+W   +       + G 
Sbjct: 1   MYWVRRNRIGGSHMPSHLEEIRDWKRKGVRKILVLAEDWEIEEAWGNPEYYFSQLREEGF 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           Q ++ P+        EQ ++++  L T     ++HC +G  RTG   A YL +      +
Sbjct: 61  QFLHVPVPDGYAPTMEQFQEIMKWLDT--GSNVVHCVAGMGRTGTVLAGYLVLREAMSPD 118

Query: 160 EAHRQLSMLYG 170
           +A  ++   Y 
Sbjct: 119 QAVEEVR-RYR 128


>gi|241680574|ref|XP_002412690.1| dual specificity phosphatase, putative [Ixodes scapularis]
 gi|215506492|gb|EEC15986.1| dual specificity phosphatase, putative [Ixodes scapularis]
          Length = 198

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/191 (12%), Positives = 62/191 (32%), Gaps = 15/191 (7%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                  ++ +  ++   +       +   ++  A P  +    L +E  ++ ++++   
Sbjct: 15  FYPTLVYNVVMERVSTRRWYDR----IDDTVFLGALPFRSITPKLLEEENVRGVVSMNED 70

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATRELN----DEQIKQLISILKTAPKPLLIHCKS 137
               +    +      G++ +    +   E       E+  Q I   +   K + +HCK+
Sbjct: 71  FELRYWVTSKAEWEKNGVKFLQLSTTDIFETPCLEKLERGVQFIRSFENTDKTVYVHCKA 130

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDI-TFEKITQLYPNNVS 196
           G  R+      YL     +  + A   L     H        +    +E +   +  +V+
Sbjct: 131 GRTRSATLVGCYLMQRYTWTPQRAVELLREKRPHI------LLHYAQWEALHTYFNKHVA 184

Query: 197 KGDTEQPMNAT 207
            G     +  +
Sbjct: 185 SGTGNGQVLGS 195


>gi|162453365|ref|YP_001615732.1| putative protein tyrosine/serine phosphatase [Sorangium cellulosum
           'So ce 56']
 gi|161163947|emb|CAN95252.1| putative Protein tyrosine/serine phosphatase [Sorangium cellulosum
           'So ce 56']
          Length = 346

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 9/124 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V+P E+   A P+         E G +S+++L  + P          A    +  +
Sbjct: 6   NFSFVIPGELAGMAYPHAPQAVEELAELGFRSLVSLSRRAPPP--------ATVGPLIHL 57

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           + PL+    +    + + ++ L  AP+P+ +H + G  RTG+  A    +       EA 
Sbjct: 58  HCPLADFTRIPSVDLLRAVAFLGRAPRPIAVHGEGGVGRTGVVLAC-RLVSLGRSAAEAI 116

Query: 163 RQLS 166
            ++ 
Sbjct: 117 AEVR 120



 Score = 61.7 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 49/126 (38%), Gaps = 9/126 (7%)

Query: 56  AQPNGTFIE-----YLKKEYGIKSILNLRGKLPESWHKEEEK-AANDLGIQLINFPLSAT 109
           A P+ +             +G++ +L L  +   + H+           +++ + PL   
Sbjct: 197 AHPDPSDAPVEAWLAFMARHGMREVLCLLDEGELALHRIPLLGRYQREFLRVTHVPLDGG 256

Query: 110 RELNDEQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
              + E +++ +  L+ A     P ++HC SGA R G+  A +L        E A   + 
Sbjct: 257 ALPSPEALERALDALRRAESSGAPAVVHCASGAGRAGVVLAAWLRARHGLAPEAAIGAVR 316

Query: 167 MLYGHF 172
               HF
Sbjct: 317 DHARHF 322


>gi|311251921|ref|XP_003124836.1| PREDICTED: protein tyrosine phosphatase domain-containing protein
           1-like isoform 2 [Sus scrofa]
          Length = 789

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 55/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYL-----KKEYGIKSILNLRGKLPESW----------HKE 89
             V  + I   A+P+   +E        + +GIKSI+NL+     +              
Sbjct: 127 SWVTDN-ILAMARPSTELLEKYCIIEQFQSHGIKSIINLQRPGEHASCGNPLEQKSGFTY 185

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 186 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 245

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 246 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 278


>gi|311251919|ref|XP_003124835.1| PREDICTED: protein tyrosine phosphatase domain-containing protein
           1-like isoform 1 [Sus scrofa]
          Length = 746

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 55/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYL-----KKEYGIKSILNLRGKLPESW----------HKE 89
             V  + I   A+P+   +E        + +GIKSI+NL+     +              
Sbjct: 84  SWVTDN-ILAMARPSTELLEKYCIIEQFQSHGIKSIINLQRPGEHASCGNPLEQKSGFTY 142

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 143 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAVHCHAGLGRTGVLIA 202

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 203 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 235


>gi|320165669|gb|EFW42568.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 186

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/171 (16%), Positives = 66/171 (38%), Gaps = 14/171 (8%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP----ESWHKEEEKA 93
                + + +V   +YRS   + +      K  G++++L L    P      + ++    
Sbjct: 3   QVSPPDVYGIVEPNVYRSNFWHPSNF-PFLKSLGLRTLLVLSPDKPLRPIADFCEDNSVN 61

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYI 152
              LG+       S+ + ++DE +K+ + I L     P+++ C SG  +TG        +
Sbjct: 62  VIHLGLSAWKLDASSWKPVSDELVKEALEITLDVTTHPVMLMCSSGIHQTGTIVGCLRRL 121

Query: 153 VAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
             ++       +    Y  +   K+     T E+  +L+  ++ +     P
Sbjct: 122 -QNWNLTSILNE----YRLYAGSKSR---YTNEQFIELFDLDLVRVPLSPP 164


>gi|66814094|ref|XP_641226.1| hypothetical protein DDB_G0280073 [Dictyostelium discoideum AX4]
 gi|60469269|gb|EAL67263.1| hypothetical protein DDB_G0280073 [Dictyostelium discoideum AX4]
          Length = 397

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/170 (20%), Positives = 67/170 (39%), Gaps = 18/170 (10%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP----ESWHKEEEKAANDLGI 99
           F  + P  +YR+            K  G+K+++ L  ++P     S+ +E       LG+
Sbjct: 154 FGTIEP-LLYRTNSLYPANF-PFIKLLGLKTVVQLSPEVPIKAVSSFFQENNINLIHLGL 211

Query: 100 QLINFPLSATRELNDE-QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           +     + + + L DE   + L  +L     PL+I C SG  +TG+       +  ++  
Sbjct: 212 KSWKVDI-SWKPLTDELIKECLEIVLNYDYYPLMITCTSGVHQTGVLVGCLRRL-QNWN- 268

Query: 159 EEAHRQLSMLYGHFP-VLKTITMDITFEKITQL----YPNNVSKGDTEQP 203
                 + + Y  F     T  ++  F ++  +    +PN +     EQ 
Sbjct: 269 ---LTSILVEYKAFSGQSNTRYVNEQFIELFDVDLVTFPNKLPTWFIEQQ 315


>gi|238618737|ref|YP_002913562.1| dual specificity protein phosphatase [Sulfolobus islandicus M.16.4]
 gi|238379806|gb|ACR40894.1| dual specificity protein phosphatase [Sulfolobus islandicus M.16.4]
          Length = 161

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 49/128 (38%), Gaps = 4/128 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESW--HKEEEKAANDLGI 99
            + V    I  S  P         ++ G+K +L L     + ESW             G+
Sbjct: 1   MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGL 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           Q ++ P+      +D Q   ++  L +  +  L+HC  G  RTG   A YL +      E
Sbjct: 61  QPLHIPIQDGGVPSDSQFLTIMRWLLSEKEGNLVHCVGGIGRTGTILASYLILTEGLDVE 120

Query: 160 EAHRQLSM 167
            A  ++ +
Sbjct: 121 SAINEVRL 128


>gi|332219177|ref|XP_003258734.1| PREDICTED: dual specificity protein phosphatase 23-like [Nomascus
           leucogenys]
          Length = 150

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 46/128 (35%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P         +     + L
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPP-----HSDSCPS--LTL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        +QI + + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAA 118

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 119 GDAIAEIR 126


>gi|321259720|ref|XP_003194580.1| cytoplasm protein [Cryptococcus gattii WM276]
 gi|317461052|gb|ADV22793.1| Cytoplasm protein, putative [Cryptococcus gattii WM276]
          Length = 190

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 58/167 (34%), Gaps = 11/167 (6%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V P  IYRS  PN        K   +K I+ + G  P      +   + +L +   
Sbjct: 24  NFSLVAPG-IYRSGHPNRKNF-PFLKRLNLKGIIYVEGSDPYRQDSLDFVQSQNLKLYRF 81

Query: 103 NFPLSA---TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           +F   +   T E  +     L  +L     PLL+H  +G     L  A+       +   
Sbjct: 82  DFSNESDLYTSEGQERLEALLKVLLDRRNYPLLVHDDTGKGSCTLVCALIR-RFQSWSLT 140

Query: 160 E--AHRQLSMLYGHFPVLKTITMDIT-FEKITQLYPNNVSKGDTEQP 203
              A   +    G     + I +  T  E I    P  V+   T +P
Sbjct: 141 GLFAEGDMFA--GPAGGAEGIGLGETGMEFIASFQPKLVNYDRTWRP 185


>gi|149755834|ref|XP_001504453.1| PREDICTED: similar to dual specificity phosphatase 23 [Equus
           caballus]
          Length = 150

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 47/128 (36%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P           +  G+ L
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSD-------SCPGLTL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        EQI + + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPAPEQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERRLAA 118

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 119 GDAIAEIR 126


>gi|227826651|ref|YP_002828430.1| dual specificity protein phosphatase [Sulfolobus islandicus
           M.14.25]
 gi|229583815|ref|YP_002842316.1| dual specificity protein phosphatase [Sulfolobus islandicus
           M.16.27]
 gi|227458446|gb|ACP37132.1| dual specificity protein phosphatase [Sulfolobus islandicus
           M.14.25]
 gi|228018864|gb|ACP54271.1| dual specificity protein phosphatase [Sulfolobus islandicus
           M.16.27]
 gi|323473730|gb|ADX84336.1| dual specificity protein phosphatase [Sulfolobus islandicus REY15A]
 gi|323476382|gb|ADX81620.1| dual specificity protein phosphatase [Sulfolobus islandicus
           HVE10/4]
          Length = 161

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 49/128 (38%), Gaps = 4/128 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESW--HKEEEKAANDLGI 99
            + V    I  S  P         ++ G+K +L L     + ESW             G+
Sbjct: 1   MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGL 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           Q ++ P+      +D Q   ++  L +  +  L+HC  G  RTG   A YL +      E
Sbjct: 61  QPLHIPIQDGGVPSDSQFLTIMRWLLSEKEGNLVHCVGGIGRTGTILASYLILSEGLDVE 120

Query: 160 EAHRQLSM 167
            A  ++ +
Sbjct: 121 SAINEVRL 128


>gi|126307305|ref|XP_001379594.1| PREDICTED: similar to Dual specificity phosphatase 23 [Monodelphis
           domestica]
          Length = 150

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 43/128 (33%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P            G++ +++L  + P               + +
Sbjct: 6   PNFSWVLPGRLAGLALPRLPAHYQFLWAQGVRHLVSLTERGPP-----HSDTCP--NLTV 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        EQI   I I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPTPEQINNFIRIVDDANARGEAVGVHCALGFGRTGTMLACYLVKAKGLAG 118

Query: 159 EEAHRQLS 166
            EA  ++ 
Sbjct: 119 GEAVAEIR 126


>gi|301122867|ref|XP_002909160.1| tyrosine-protein phosphatase, putative [Phytophthora infestans
           T30-4]
 gi|262099922|gb|EEY57974.1| tyrosine-protein phosphatase, putative [Phytophthora infestans
           T30-4]
          Length = 109

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 38/99 (38%), Gaps = 10/99 (10%)

Query: 97  LGIQLINFPLSATRELNDEQIKQ-----LISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
            GI+L+ F +   +E   +  +      L ++L     P+LIHC  G  RTG        
Sbjct: 2   HGIKLLQFGVPGNKEPFVDIPEDGIVAALKAVLDKRNHPMLIHCNKGKHRTGCLVGSLRK 61

Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           +        A   +   Y  F   K   MD   +K+ Q+
Sbjct: 62  VQ-----RWAFSSIFDEYIRFSAPKPRMMDQQRKKVWQI 95


>gi|196229878|ref|ZP_03128742.1| protein tyrosine/serine phosphatase [Chthoniobacter flavus
           Ellin428]
 gi|196226204|gb|EDY20710.1| protein tyrosine/serine phosphatase [Chthoniobacter flavus
           Ellin428]
          Length = 301

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 46/117 (39%), Gaps = 7/117 (5%)

Query: 51  EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATR 110
           E+Y    P          + GIK+I+ + G  P          A+  G++ ++ P     
Sbjct: 41  ELYSGNAPEDDAGFRELAKLGIKTIVTVDGTKP------NVALAHRYGMRYVHLPFGYDG 94

Query: 111 ELNDEQIKQLISI-LKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
                 ++   ++ +  A  P+ +HC  G  R   A+AV    +  + KE+A   L 
Sbjct: 95  LPQKRGVELAKAVQVAEAEGPVYLHCHHGKHRAPTAAAVVCEALDGWSKEKAIDFLH 151


>gi|317418591|emb|CBN80629.1| Protein tyrosine phosphatase domain-containing protein 1
           [Dicentrarchus labrax]
          Length = 696

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 53/153 (34%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLPESW----------HKE 89
             +  + +   A+P+        I    +  G+K+++NL+     +              
Sbjct: 73  SWITDN-LLAMARPSTEIIEKYNIIEQFQRCGLKTVINLQRPGEHASCGNPLEQGSGFTY 131

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +   + GI   NF        +   I  ++ ++  A     L +HC +G  RTG+  A
Sbjct: 132 RPEIFMEAGIYYYNFGWKDYGVASLTTILDMVKVMSFAVQEGKLAVHCHAGLGRTGVLLA 191

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL   +    ++A   +     +    +   +
Sbjct: 192 CYLVFTSRMSADQAILFVRAKRPNSIQTRGQLL 224


>gi|186685041|ref|YP_001868237.1| hypothetical protein Npun_F4949 [Nostoc punctiforme PCC 73102]
 gi|186467493|gb|ACC83294.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
          Length = 127

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N    +  ++  + Q     ++    + G KS+LNLR         +E++    LG+  +
Sbjct: 2   NIVRKINDQLAIAGQITPDQLKQ-IADEGYKSVLNLRLPDETGLLADEQEKTEFLGLYYV 60

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           NFP   T ++N + + Q+   +   PKP LIHC   + R+     +Y+ I      E+A 
Sbjct: 61  NFPTK-TEDINHQSMLQIYQTIVELPKPTLIHCD-NSIRSAAIVLLYIAIKQGITFEKAL 118

Query: 163 R 163
           +
Sbjct: 119 Q 119


>gi|17228604|ref|NP_485152.1| hypothetical protein alr1109 [Nostoc sp. PCC 7120]
 gi|17130455|dbj|BAB73066.1| alr1109 [Nostoc sp. PCC 7120]
          Length = 130

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           + +E+  + Q      + + ++ G KS+LNLR    +     E+     LG++ INFP+ 
Sbjct: 10  INNELAIAGQITPIQFQKITED-GYKSVLNLRSPDEKGLLDNEQDKLEFLGLRYINFPMK 68

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
              E+N+    Q++  +   PKPLLIHC   + R+ + + +Y+        E+A  
Sbjct: 69  -FEEINNLTTLQILQTINELPKPLLIHCD-NSIRSSVLALLYVATKQGITFEKALE 122


>gi|260829319|ref|XP_002609609.1| hypothetical protein BRAFLDRAFT_125025 [Branchiostoma floridae]
 gi|229294971|gb|EEN65619.1| hypothetical protein BRAFLDRAFT_125025 [Branchiostoma floridae]
          Length = 154

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 50/126 (39%), Gaps = 11/126 (8%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  V+  ++   A P+         + G++ +++L  +LP           +   +  I+
Sbjct: 8   FSWVIQGKLCALAFPHRAENIRWLYKEGVRHLVSLTYRLPP--------VDSCPNLNSIH 59

Query: 104 FPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
             +        EQ+ + I I+++     + + +HC+ G  RTG   A Y         +E
Sbjct: 60  MKIEDFTPPTIEQVDRFIHIVESNSIIGEAVAVHCQWGRGRTGTMIACYFVKTRKISGQE 119

Query: 161 AHRQLS 166
           A  ++ 
Sbjct: 120 AIEEIR 125


>gi|195054671|ref|XP_001994248.1| GH23609 [Drosophila grimshawi]
 gi|193896118|gb|EDV94984.1| GH23609 [Drosophila grimshawi]
          Length = 194

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/201 (10%), Positives = 61/201 (30%), Gaps = 32/201 (15%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   T   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 5   VSFYPTLLYNVLMEKATSRNWYDR----IDDNVILGALPFRSQANDLIEKENMKAVVSMN 60

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +    +      LG+  +    +      N E++ + +  +              
Sbjct: 61  EDYELTAFSNDLPKWKALGVDFLQLATTDIFESPNQEKLFRGVEFINRFLPLSKRIAGLN 120

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A         H    +   +
Sbjct: 121 STQYPENNGSVYVHCKAGRTRSATLVGCYLMLKNGWTPDQAVD-------HMRQCRPHIL 173

Query: 181 DI--TFEKITQLYPNNVSKGD 199
                ++ +   Y NNV    
Sbjct: 174 LHTKQWDALRIFYANNVEPKS 194


>gi|261331380|emb|CBH14374.1| tyrosine phosphatase, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 481

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 48/132 (36%), Gaps = 13/132 (9%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V   +YR A P         +  G+++I++L     E  +     AA + GI + +  +
Sbjct: 89  IVEEGVYRGAYPTLRNF-PFLRSLGLRTIVSLTP--EEPTYDLSRFAAAE-GITIRHIQV 144

Query: 107 SATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
              +     +  +  + L  +      PL IHC  G   TGL       +  H+    + 
Sbjct: 145 EQNKGEAQLMPTDMSEVLQMLADAEQHPLYIHCLDGRHTTGLVVMGLRKL-QHWSVNCS- 202

Query: 163 RQLSMLYGHFPV 174
               M Y  F  
Sbjct: 203 ---HMEYQRFAW 211


>gi|71745060|ref|XP_827160.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70831325|gb|EAN76830.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 481

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 48/132 (36%), Gaps = 13/132 (9%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           +V   +YR A P         +  G+++I++L     E  +     AA + GI + +  +
Sbjct: 89  IVEEGVYRGAYPTLRNF-PFLRSLGLRTIVSLTP--EEPTYDLSRFAAAE-GITIRHIQV 144

Query: 107 SATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
              +     +  +  + L  +      PL IHC  G   TGL       +  H+    + 
Sbjct: 145 EQNKGEAQLMPTDMSEVLQMLADAEQHPLYIHCLDGRHTTGLVVMGLRKL-QHWSVNCS- 202

Query: 163 RQLSMLYGHFPV 174
               M Y  F  
Sbjct: 203 ---HMEYQRFAW 211


>gi|332797773|ref|YP_004459273.1| dual specificity protein phosphatase [Acidianus hospitalis W1]
 gi|332695508|gb|AEE94975.1| dual specificity protein phosphatase [Acidianus hospitalis W1]
          Length = 157

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 49/131 (37%), Gaps = 7/131 (5%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESW--HKEEEKAANDLGI 99
            + V    I  S  P         K  G+K ++ L  +  + E+W           + G+
Sbjct: 1   MYWVRKGIIGGSCLPYTVDEIKKWKASGVKKVVVLPEEWEIEEAWGSVDYYFSVLEENGL 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           + I+ P+         Q ++++  L+      LIHC  G  RTG   A YL +       
Sbjct: 61  KFIHVPIPDGYPPTLSQFEEIMEWLEGRGN--LIHCVGGIGRTGTVLAGYLMVTEGLNAN 118

Query: 160 EAHRQLSMLYG 170
           EA  ++   Y 
Sbjct: 119 EAVEEVR-KYR 128


>gi|294341211|emb|CAZ89612.1| putative (Phosphotyrosine protein) phosphatase II [Thiomonas sp.
           3As]
          Length = 163

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 49/144 (34%), Gaps = 9/144 (6%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +    +N  A     ++ S Q +   I  L    G+ +++NL           E +    
Sbjct: 7   LRFDAENTFAAFEG-LWCSGQLSVADIARLPA-LGVATVINLALPTSSKALSGEAEQVTS 64

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA-PKPLLIHCKSGADRTGLASAVYLYIVAH 155
           LG+  ++ P+         Q +Q   ++     +P+ +HC     R      +Y  ++  
Sbjct: 65  LGMNYVHIPVL-WDAPKPVQFEQFAGVMAALGQQPVWLHCAKNM-RASAFVYLYRLLIRG 122

Query: 156 YPKEEAHRQLSMLYGHFPVLKTIT 179
             +E+A    S           + 
Sbjct: 123 ETEEQA----SWPMLQIWTPNPVW 142


>gi|218440538|ref|YP_002378867.1| dual specificity protein phosphatase [Cyanothece sp. PCC 7424]
 gi|218173266|gb|ACK71999.1| dual specificity protein phosphatase [Cyanothece sp. PCC 7424]
          Length = 152

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 51/129 (39%), Gaps = 11/129 (8%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDL 97
            +  +N   V+P+++    +P    I    K+ GI +I+++                   
Sbjct: 7   QSIEKNLWWVIPNKLAGVRKPMQEEIAS-LKDAGISAIVSVMDD------PSNLDLYRSA 59

Query: 98  GIQLINFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVA 154
            I  +  P+        EQI+Q  + ++T       +++HC SG  RTG   A YL    
Sbjct: 60  NIPYLWLPIKGGTAPTAEQIEQFKNFVETQNGLGHGVVVHCTSGRRRTGTLLASYLIST- 118

Query: 155 HYPKEEAHR 163
           +   ++A  
Sbjct: 119 NLSYDQAIE 127


>gi|219848061|ref|YP_002462494.1| hypothetical protein Cagg_1148 [Chloroflexus aggregans DSM 9485]
 gi|219542320|gb|ACL24058.1| protein of unknown function DUF442 [Chloroflexus aggregans DSM
           9485]
          Length = 164

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 47/119 (39%), Gaps = 4/119 (3%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V   +  +AQP     +      G K++LN+R     +    +   A   G+  I+ P  
Sbjct: 23  VTDRVLLAAQPQPEDWQRFVA-AGYKTVLNIRSDPERAA--VQAANARAAGLHYIHVPWP 79

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
           A     +   +    +       L+ HC+S A R GL   +Y  +   + +E+A  +L 
Sbjct: 80  AYELEPEHLAEFARIVEAPETGKLVFHCRS-ATRVGLIWMLYRIVHQGWTREQAEAELR 137


>gi|87118863|ref|ZP_01074762.1| tyrosine-specific protein phosphatase, putative [Marinomonas sp.
           MED121]
 gi|86166497|gb|EAQ67763.1| tyrosine-specific protein phosphatase, putative [Marinomonas sp.
           MED121]
          Length = 165

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 57/158 (36%), Gaps = 16/158 (10%)

Query: 46  AVVPHEIYRSAQPNGTFIE-YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
            ++  +I   + PN         KE GI +IL++         + E       GI   N 
Sbjct: 6   WLIEGKIAGRSGPNLDTWNLAELKEQGIAAILSVNFSESVDSREME-----GAGIAHANI 60

Query: 105 PLSATRELNDEQIKQLISIL---------KTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
           P+S    +     +  ++ L         + A  P++IHC+SG DRTGL  A YL     
Sbjct: 61  PMSPNAPVQLGDKETCLANLPKAMAFIKAQKAAGPVMIHCRSGKDRTGLVMAAYLVQFEG 120

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPN 193
              +EA  ++              +    + +     N
Sbjct: 121 MTAKEAMDKV-FSVRSIAFSAEGWIPFALDVLESFEIN 157


>gi|149412689|ref|XP_001507604.1| PREDICTED: similar to protein tyrosine phosphatase domain
           containing 1 protein [Ornithorhynchus anatinus]
          Length = 808

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLP----------ESWHKE 89
             V  + I   A+P+        I    +  GIK+++NL+              ES    
Sbjct: 128 SWVTDN-ILAMARPSTEVIEKYNIIEQFQSSGIKTVINLQRPGEHASCGNPLEQESGFTY 186

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +A  + GI   NF        +   I  ++ ++  A     L IHC +G  RTG+  A
Sbjct: 187 LPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGRLAIHCHAGLGRTGVLIA 246

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            YL        ++A   +     +    +   +
Sbjct: 247 CYLVFATRMTADQAIIFVRAKRPNSIQTRGQLL 279


>gi|328779561|ref|XP_003249672.1| PREDICTED: hypothetical protein LOC410442 [Apis mellifera]
          Length = 1193

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 33/151 (21%), Positives = 54/151 (35%), Gaps = 15/151 (9%)

Query: 45  HAVVPHEIY--R--SAQPNGTFIEYLKKEYGIKSILNLR---------GKLPESWHKEEE 91
           H V    +   R  +AQ     I    + + IK+I+NL+         G L ES    + 
Sbjct: 629 HWVTDEVLAMARPNTAQIIKKDIIAQFQGWSIKTIINLQTPGEHASCGGPLEESGFTYDP 688

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISI--LKTAPKPLLIHCKSGADRTGLASAVY 149
                 GI   NF L    +    ++  ++ +         + IHC +G  RTG+  A Y
Sbjct: 689 NIFMKHGIYYYNFALKDYGDATMSKLLDMVKVVAFAVQEGRVAIHCHAGLGRTGVLIACY 748

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           L         +A R + M        +   +
Sbjct: 749 LIYSLRVRANDAIRFVRMKRPSAIQTRGQIL 779


>gi|115496614|ref|NP_001069821.1| protein-tyrosine phosphatase mitochondrial 1 [Bos taurus]
 gi|84708724|gb|AAI11307.1| Protein tyrosine phosphatase, mitochondrial 1 [Bos taurus]
 gi|296479668|gb|DAA21783.1| protein tyrosine phosphatase, mitochondrial 1 [Bos taurus]
          Length = 270

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 68/198 (34%), Gaps = 23/198 (11%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYR------------SAQP 58
               +  +  G L+   ++  LY+ T+      F   +P   +R             A P
Sbjct: 63  RRAGWAGMAAGTLLEAGLARVLYYPTL--LYTVFRGKMPGRAHRDWYHRIDSTVLLGALP 120

Query: 59  NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQI 117
             +    L ++  ++ ++ +  +    +     K     G++ +       T       +
Sbjct: 121 LRSMTRRLVQDENVRGVITMNEEYETRFLCNSSKEWEKAGVEQLRLSTVDMTGVPTLANL 180

Query: 118 K---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPV 174
           +   Q     ++    + +HCK+G  R+    A YL  V H+  EEA R ++ +  H   
Sbjct: 181 QKGVQFTIRHQSLGHSVYVHCKAGRSRSATMVAAYLIQVYHWTPEEAIRAITKIRSHI-- 238

Query: 175 LKTITMDITFEKITQLYP 192
                     E + + + 
Sbjct: 239 ---YIRPGQLEVLKEFHK 253


>gi|129277544|ref|NP_001076078.1| dual specificity protein phosphatase 23 [Bos taurus]
 gi|126717457|gb|AAI33449.1| DUSP23 protein [Bos taurus]
 gi|157279042|gb|AAI34732.1| Dual specificity phosphatase 23 [Bos taurus]
 gi|296489860|gb|DAA31973.1| dual specificity phosphatase 23 [Bos taurus]
          Length = 150

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 47/128 (36%), Gaps = 10/128 (7%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            NF  V+P  +   A P          + G++ +++L  + P           +  G+ L
Sbjct: 6   PNFSWVLPRRLAGLALPRLPAHYQFLLDQGVRHLVSLTERGPPHSD-------SCPGLTL 58

Query: 102 INFPLSATRELNDEQIKQLISILKTAP---KPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
               +        EQI + + I+  A    + + +HC  G  RTG   A YL        
Sbjct: 59  HRLRIPDFCPPGPEQIDRFVKIVDEANARGEAVAVHCALGFGRTGTMLACYLVKERGLAA 118

Query: 159 EEAHRQLS 166
            +A  ++ 
Sbjct: 119 GDAIAEIR 126


>gi|313220230|emb|CBY31089.1| unnamed protein product [Oikopleura dioica]
          Length = 438

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 15/134 (11%), Positives = 40/134 (29%), Gaps = 19/134 (14%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPN--------- 59
                    +    +    + +  Y         +F+ +VP++    + P+         
Sbjct: 151 DCFHGLKKALQHNFVDFATLDVEEYEYYERVENGDFNWIVPNKFLAFSGPHPKSKIENGY 210

Query: 60  ----GTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
                       +++ IK+++ L  K+  +          D G    +   +      D 
Sbjct: 211 PLHAPEAYFPYFRKHNIKTVIRLNKKIYPAS------RFTDGGFDHHDMFFTDGSCPPDH 264

Query: 116 QIKQLISILKTAPK 129
            +KQ + I++    
Sbjct: 265 ILKQFLHIVENMDG 278


>gi|283778166|ref|YP_003368921.1| hypothetical protein Psta_0371 [Pirellula staleyi DSM 6068]
 gi|283436619|gb|ADB15061.1| protein of unknown function DUF442 [Pirellula staleyi DSM 6068]
          Length = 335

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 50/115 (43%), Gaps = 7/115 (6%)

Query: 51  EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATR 110
            IY  ++P+         + GIK+I+++ G  P          A   G+  I+ P+    
Sbjct: 60  RIYSGSEPSTEEHFAELAKRGIKTIVSVDGAEP------NLALAQKYGLSYIHLPMGYGG 113

Query: 111 ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
            +  EQ  ++   ++ A  P+++HC  G  R   A+AV       +  ++A + L
Sbjct: 114 -MGREQTLKIARAMEIAQGPVMLHCHHGKHRGPSAAAVACIAEKKWTNDQAAQWL 167


>gi|195449904|ref|XP_002072277.1| GK22417 [Drosophila willistoni]
 gi|194168362|gb|EDW83263.1| GK22417 [Drosophila willistoni]
          Length = 201

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/202 (11%), Positives = 60/202 (29%), Gaps = 33/202 (16%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   T   +       +   +   A P  +    L  +  IK+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKATSRNWYDR----IDDNVVLGALPFRSEANDLIAKEDIKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                S          +LG++ +    +      +  ++ Q +  +              
Sbjct: 67  EDYELSAFSNNSVKWKNLGVEFLQLATTDIFESPDQNKLHQGVEFMNRFLPLSKRISGLS 126

Query: 126 ------TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTIT 179
                      + +HCK+G  R+      YL +   +  ++A         H    +   
Sbjct: 127 TSNDEKENVGSVYVHCKAGRTRSATLVGCYLMMKNGWSPDQAVS-------HMRQCRPHI 179

Query: 180 MDI--TFEKITQLYPNNVSKGD 199
           +     ++ +   Y NNV    
Sbjct: 180 LLHTKQWDALRIFYTNNVEAKS 201


>gi|307212693|gb|EFN88384.1| Protein tyrosine phosphatase domain-containing protein 1
           [Harpegnathos saltator]
          Length = 701

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 53/151 (35%), Gaps = 15/151 (9%)

Query: 45  HAVVPHEIY----RSAQPNGTFIEYLKKEYGIKSILNLR---------GKLPESWHKEEE 91
           H V    +      +AQ     I    + + IK+I+NL+         G L ES    + 
Sbjct: 137 HWVTDDVLAMARPSTAQIIKKDIIAQFQGWSIKTIINLQTSGEHASCGGPLEESGFTYDP 196

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISI--LKTAPKPLLIHCKSGADRTGLASAVY 149
                 GI   NF L    +    ++  ++ +         + IHC +G  RTG+  A Y
Sbjct: 197 NIFMKNGIYYYNFALKDYGDATMGKLLDMVKVVAFAVQEGRVAIHCHAGLGRTGVLIACY 256

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           L         +A R + M        +   +
Sbjct: 257 LIYSLRVRANDAIRFVRMKRPSAIQTRGQIL 287


>gi|15899198|ref|NP_343803.1| hypothetical protein SSO2453 [Sulfolobus solfataricus P2]
 gi|227829292|ref|YP_002831071.1| tyrosine specific protein phosphatase [Sulfolobus islandicus
           L.S.2.15]
 gi|229578062|ref|YP_002836460.1| dual specificity protein phosphatase [Sulfolobus islandicus
           Y.G.57.14]
 gi|284996649|ref|YP_003418416.1| tyrosine specific protein phosphatase [Sulfolobus islandicus
           L.D.8.5]
 gi|145579561|pdb|2I6I|A Chain A, Crystal Structures Of The Archaeal Sulfolobus Ptp-Fold
           Phosphatase
 gi|145579562|pdb|2I6J|A Chain A, Crystal Structure Of The Complex Of The Archaeal
           Sulfolobus Ptp-Fold Phosphatase With Phosphate Ion
 gi|145579563|pdb|2I6M|A Chain A, Crystal Structure Of The Complexes Of The Archaeal
           Sulfolobus Ptp-Fold Phosphatase With Tungstate
 gi|13815756|gb|AAK42593.1| Conserved hypothetical protein [Sulfolobus solfataricus P2]
 gi|227455739|gb|ACP34426.1| tyrosine specific protein phosphatase [Sulfolobus islandicus
           L.S.2.15]
 gi|228008776|gb|ACP44538.1| dual specificity protein phosphatase [Sulfolobus islandicus
           Y.G.57.14]
 gi|284444544|gb|ADB86046.1| tyrosine specific protein phosphatase [Sulfolobus islandicus
           L.D.8.5]
          Length = 161

 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 49/128 (38%), Gaps = 4/128 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESW--HKEEEKAANDLGI 99
            + V    I  S  P         ++ G+K +L L     + ESW             G+
Sbjct: 1   MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGL 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           Q ++ P+      +D Q   ++  L +  +  L+HC  G  RTG   A YL +      E
Sbjct: 61  QPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHCVGGIGRTGTILASYLILTEGLEVE 120

Query: 160 EAHRQLSM 167
            A  ++ +
Sbjct: 121 SAIDEVRL 128


>gi|330834729|ref|YP_004409457.1| dual specificity protein phosphatase [Metallosphaera cuprina Ar-4]
 gi|329566868|gb|AEB94973.1| dual specificity protein phosphatase [Metallosphaera cuprina Ar-4]
          Length = 149

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 53/127 (41%), Gaps = 6/127 (4%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESWHKEE--EKAANDLGI 99
            + V  + +  S  P+        K  G++ +L L     + E+W       +   + G+
Sbjct: 1   MYWVRRNRLGGSHLPSHLEEIRDWKRKGVEKVLILAEDWEIEETWGDSNYYFQQLKNEGL 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
             ++ P+   +  +   + ++++ LK      ++HC +G  RTG   A YL +      +
Sbjct: 61  NFLHVPIPDGQPPSMGDLDKIMNWLK--DGTNVVHCVAGKGRTGTVLAAYLIMNEGLSPD 118

Query: 160 EAHRQLS 166
           +A  ++ 
Sbjct: 119 QAVDEVR 125


>gi|207341642|gb|EDZ69639.1| YNL032Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 219

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 9/101 (8%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  VV  EIYRS+ P      +L +   +KSIL L   +PE + +E        GI+L 
Sbjct: 121 NFSHVV-GEIYRSSFPRQENFSFLHERLKLKSILVL---IPEEYPQENLNFLKLTGIKLY 176

Query: 103 NFPLSATRELNDEQIKQLI-----SILKTAPKPLLIHCKSG 138
              +S  +E        L+      +L  A +P+LIHC  G
Sbjct: 177 QVGMSGNKEPFVNIPSHLLTKALEIVLNPANQPILIHCNRG 217


>gi|158333878|ref|YP_001515050.1| hypothetical protein AM1_0690 [Acaryochloris marina MBIC11017]
 gi|158304119|gb|ABW25736.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 154

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 49/135 (36%), Gaps = 5/135 (3%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA 108
              +  + QP     + ++   G +SI+NL          +E +    LG++ ++ P+  
Sbjct: 16  SDRVGTAGQPTAAQFKDIQA-AGYQSIVNLALVNSTDAIPKEGEIVAQLGMEYVHIPV-D 73

Query: 109 TRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM 167
             E   E + +   ++       + +HC     R      +Y  +      EEA   L  
Sbjct: 74  WEEPTLEDLTRFFEVMDQRSHDQVFVHCAKNM-RVSAFMYLYRVLRLQMAPEEAQPALLQ 132

Query: 168 LYGHFPVLKTITMDI 182
           ++   P  +   MD 
Sbjct: 133 IWQPIPHWQA-FMDR 146


>gi|255725068|ref|XP_002547463.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240135354|gb|EER34908.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 213

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 46/151 (30%), Gaps = 31/151 (20%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH--------------- 87
           NF  V  + IYRS  P         ++  +K+I+ L     E                  
Sbjct: 29  NFSLV-ENGIYRSGFPMPINY-PFLQQLNLKTIIYLGDLGNEELKSSSKSKKKKDKHGTA 86

Query: 88  ----KEEEKAANDLGIQLINFPLSATREL----------NDEQIKQLISILKTAPKPLLI 133
                  +   ND  IQ  N    +++E                  L  IL     P+LI
Sbjct: 87  EIMNNYLDWIKNDTDIQFHNLYFESSQEPFNKPQDIEQATKSLTIALQLILNKQNHPILI 146

Query: 134 HCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           H   G  RTG+   +   ++  +       +
Sbjct: 147 HSNKGKHRTGVLIGLMRKVLQGWCLSGIFEE 177


>gi|126642026|ref|YP_001085010.1| hypothetical protein A1S_1981 [Acinetobacter baumannii ATCC 17978]
 gi|126387910|gb|ABO12408.1| hypothetical protein A1S_1981 [Acinetobacter baumannii ATCC 17978]
          Length = 174

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSTEQLK-LIKEYGCSTVINLALSNSPDSIKNEDQVCLEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + +Q   ++ ++      + + IHC     R      VY     +         
Sbjct: 75  -DWETPSSDQCLLVLDLIDHLVQNEIVWIHCAKNK-RVSCLMYVYRQFYMNMDMSTCQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|194910255|ref|XP_001982099.1| GG11227 [Drosophila erecta]
 gi|190656737|gb|EDV53969.1| GG11227 [Drosophila erecta]
          Length = 200

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 20/201 (9%), Positives = 58/201 (28%), Gaps = 32/201 (15%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDEHVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-----------TRELNDEQIKQLISILK--- 125
                +      +    LGI+ +    +                   +   +   +    
Sbjct: 67  EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPVKQRIDGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A         H    +   +
Sbjct: 127 SSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVD-------HMRQCRPHIL 179

Query: 181 DI--TFEKITQLYPNNVSKGD 199
                ++ +   Y NNV    
Sbjct: 180 LHTKQWDALRLFYTNNVQAKS 200


>gi|262279369|ref|ZP_06057154.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259720|gb|EEY78453.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 173

 Score = 71.7 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           V+   ++ SAQP+   ++ L KEYG  +++NL      +  + E++   DLG+  I+ P+
Sbjct: 16  VIHEHLFSSAQPSIEQLK-LIKEYGCSTVINLALSNAPNHIENEDRICLDLGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + EQ   ++ ++      + + IHC    DR+     VY     +     +   
Sbjct: 75  -DWETPSAEQCLLVLDLIDHLVQNEIVWIHCTKN-DRSSCLMYVYRQFYMNMDMPTSQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|289742745|gb|ADD20120.1| mitochondrial protein-tyrosine phosphatase 1-like protein precursor
           [Glossina morsitans morsitans]
          Length = 201

 Score = 71.7 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 22/198 (11%), Positives = 62/198 (31%), Gaps = 28/198 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   T   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLFYNVLMEKFTRRNWYDR----IDDNVILGALPFRSQANELIQKENMKAVISMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-----------------TRELNDEQIKQLIS 122
                +           LG++ +    +                   + L  +   + +S
Sbjct: 67  EDYELTVFSNNLTKWQLLGVEFLQLATTDIFESPCQEKLHKGVEFINKFLPRDNRIKGLS 126

Query: 123 ILKTAP--KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
              +      + +HCK+G  R+      YL +   +  E+A   +     H  +      
Sbjct: 127 TTDSPENVGTVYVHCKAGRTRSATLVGCYLILKNGWTPEQAVEHMRHCRPHIWLHT---- 182

Query: 181 DITFEKITQLYPNNVSKG 198
              +E + + Y N++   
Sbjct: 183 -QQWEALREFYKNHIDSK 199


>gi|325918698|ref|ZP_08180796.1| hypothetical protein XVE_4827 [Xanthomonas vesicatoria ATCC 35937]
 gi|325535090|gb|EGD06988.1| hypothetical protein XVE_4827 [Xanthomonas vesicatoria ATCC 35937]
          Length = 144

 Score = 71.7 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 5/113 (4%)

Query: 53  YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
           Y S QP    +        +++++NLR    E    EE   A+ LG++ +  P++   +L
Sbjct: 12  YASGQPTRLQLAE-LASKDVRTVINLRPP-EEPVDYEEAGEADRLGLRYVTLPIANAGDL 69

Query: 113 NDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           +  +++    +L  A     +LIHC S A+R G   A+   +    P   A  
Sbjct: 70  DHARVQTFGRLLDQARTEGAVLIHCAS-ANRVGAMVALDQVLNRGTPLATALE 121


>gi|320101897|ref|YP_004177488.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
 gi|319749179|gb|ADV60939.1| tyrosine phosphatase [Isosphaera pallida ATCC 43644]
          Length = 506

 Score = 71.7 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 57/145 (39%), Gaps = 6/145 (4%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK---LPESWHKEEEKAANDLG 98
             F  V    +Y SA P    +E     +G K+I+NL  +         + E++ A   G
Sbjct: 286 GRFKEVEAGRLYMSAMPTAEGLELAHARHGFKTIINLFPEATLGRHPDSEAEQRFARTHG 345

Query: 99  IQLINFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           I+ +  P     ELN   +++ + +    A  P+L+HC +  DRT      + Y    + 
Sbjct: 346 IRYLESP--GRVELNGAFLRETLDLTRDPAAWPILVHCHACMDRTPAWVGFFRYREKGWE 403

Query: 158 KEEAHRQLSMLYGHFPVLKTITMDI 182
            +E  + +    G  P      +  
Sbjct: 404 LKEVWKAIEQHRGLRPKATVFLLYH 428


>gi|319638663|ref|ZP_07993423.1| hypothetical protein HMPREF0604_01047 [Neisseria mucosa C102]
 gi|317400047|gb|EFV80708.1| hypothetical protein HMPREF0604_01047 [Neisseria mucosa C102]
          Length = 103

 Score = 71.7 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 103 NFPLSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           N PL +      E  + L  I  +     +LIHC  GADRTGL + +Y  I   +P EEA
Sbjct: 3   NRPLLSWSIKPKEIAEILYLIEKQQQNGAVLIHCYHGADRTGLIAGMYRIIYQGWPVEEA 62

Query: 162 HRQL-SMLYGHFPVLKTITMDITFEKITQL 190
             ++    YG+  + K I    T EK+ Q+
Sbjct: 63  KAEMQHGPYGYHSIWKNIAKLFTEEKVKQV 92


>gi|262376560|ref|ZP_06069789.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262308699|gb|EEY89833.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 174

 Score = 71.7 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 51/126 (40%), Gaps = 6/126 (4%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +  H ++ S QP  T +  L KEYG+ +++N+     E +   E+K   +LG+  I
Sbjct: 13  NFQFIHEH-LFSSGQPTTTQL-QLMKEYGVSTVINVALTDSEQYLPHEDKICLELGLNYI 70

Query: 103 NFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
             P+ +    +D Q   ++ ++      + + +HC            +Y           
Sbjct: 71  QVPI-SWETPSDNQCLLVLDLIDHLVKEQMVWVHCSQNYH-VSCLMYLYRQYYMDMDLPT 128

Query: 161 AHRQLS 166
           A   L 
Sbjct: 129 AQEHLH 134


>gi|238883787|gb|EEQ47425.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 216

 Score = 71.3 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 50/147 (34%), Gaps = 27/147 (18%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN------- 95
           NF  V  + IYRS  P         K+  +K+I+ L     ++  K ++K  +       
Sbjct: 36  NFSLV-ENGIYRSGFPMPINY-PFLKQLRLKTIIYLGDLGNQTSKKGKKKDKHGTAEIMN 93

Query: 96  --------DLGIQLINFPLSATREL----------NDEQIKQLISILKTAPKPLLIHCKS 137
                   D  I+  N    +++E                  L  IL     P+LIH   
Sbjct: 94  NYLDWIKNDTEIRFYNLLFESSQEPFNKPDDIQQATQSLTFALQLILNKENYPILIHSNK 153

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQ 164
           G  RTG+   +   ++  +       +
Sbjct: 154 GKHRTGVLIGIMRKVLQGWCLSGIFEE 180


>gi|68483608|ref|XP_714257.1| hypothetical protein CaO19.4086 [Candida albicans SC5314]
 gi|68483881|ref|XP_714119.1| hypothetical protein CaO19.11567 [Candida albicans SC5314]
 gi|46435653|gb|EAK95030.1| hypothetical protein CaO19.11567 [Candida albicans SC5314]
 gi|46435810|gb|EAK95184.1| hypothetical protein CaO19.4086 [Candida albicans SC5314]
          Length = 216

 Score = 71.3 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 50/147 (34%), Gaps = 27/147 (18%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN------- 95
           NF  V  + IYRS  P         K+  +K+I+ L     ++  K ++K  +       
Sbjct: 36  NFSLV-ENGIYRSGFPMPINY-PFLKQLRLKTIIYLGDLGNQTSKKGKKKDKHGTAEIMN 93

Query: 96  --------DLGIQLINFPLSATREL----------NDEQIKQLISILKTAPKPLLIHCKS 137
                   D  I+  N    +++E                  L  IL     P+LIH   
Sbjct: 94  NYLDWIKNDTEIRFYNLLFESSQEPFNKPDDIQQATQSLTFALQLILNKENYPILIHSNK 153

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQ 164
           G  RTG+   +   ++  +       +
Sbjct: 154 GKHRTGVLIGIMRKVLQGWCLSGIFEE 180


>gi|91200697|emb|CAJ73748.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 155

 Score = 71.3 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 30/131 (22%), Positives = 52/131 (39%), Gaps = 11/131 (8%)

Query: 43  NFHAVVPHEIYRSAQP-NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           NF  ++  EI   A+P +        +E GI  I+ L      S     +    + G   
Sbjct: 6   NFSWLLKGEIAGMARPISVVSDFEFLRENGIDVIVTL------SEWPLHKILLEEFGFVN 59

Query: 102 INFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
            + P++       EQI++ I  +  A    K +++HC +G  RTG   A YL     +  
Sbjct: 60  KHIPIADLTPPTQEQIEEFIFFVNEAVSSSKKVVVHCDAGIGRTGTMLACYLVNK-GFSA 118

Query: 159 EEAHRQLSMLY 169
            +A  ++    
Sbjct: 119 IDAIVEVRKKR 129


>gi|194745847|ref|XP_001955396.1| GF16260 [Drosophila ananassae]
 gi|190628433|gb|EDV43957.1| GF16260 [Drosophila ananassae]
          Length = 200

 Score = 71.3 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/197 (11%), Positives = 58/197 (29%), Gaps = 32/197 (16%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDENVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-----------TRELNDEQIKQLISILK--- 125
                +      +    LGI+ +    +                   Q   L   +    
Sbjct: 67  EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLYRGVEFINQFLPLTKRINGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A         H    +   +
Sbjct: 127 TTKSPENIGSVYVHCKAGRTRSATLVGCYLMLKNGWTPDQAVE-------HMRQCRPHIL 179

Query: 181 DI--TFEKITQLYPNNV 195
                ++ +   Y NNV
Sbjct: 180 LHTKQWDALRLFYTNNV 196


>gi|268608316|ref|ZP_06142043.1| protein tyrosine/serine phosphatase [Ruminococcus flavefaciens
           FD-1]
          Length = 274

 Score = 71.3 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 58/152 (38%), Gaps = 9/152 (5%)

Query: 45  HAVVPHEIYRSAQPNGTFI------EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLG 98
             +    +YRS+ P   ++      +   + +GI+++LN       + +          G
Sbjct: 5   GRIKEGILYRSSSPVNRWLGRNTYADEAARAHGIRTVLNFADSKDRAEYNTGYSDTYYSG 64

Query: 99  --IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             I   +  L  + +   + +   +  +     P LIHC  G  RTG+ SA+   ++   
Sbjct: 65  CDIYFGDMTLDFSSQDFRDSLSGGLHFMCEHEGPYLIHCMEGKYRTGVTSALIESLM-GA 123

Query: 157 PKEEAHRQLSMLYGHFPVLKTITMDITFEKIT 188
             +E     ++ + +F  ++        ++I 
Sbjct: 124 DIDEIKDDFTLTFKNFYDVQNGMQQPFSDEIA 155


>gi|85373734|ref|YP_457796.1| hypothetical protein ELI_04535 [Erythrobacter litoralis HTCC2594]
 gi|84786817|gb|ABC62999.1| hypothetical protein ELI_04535 [Erythrobacter litoralis HTCC2594]
          Length = 150

 Score = 71.3 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 51/121 (42%), Gaps = 5/121 (4%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES---WHKEEEKAANDLGIQLI 102
            ++      S  P          E G K+++NLR +           E +    LG++  
Sbjct: 5   KILNGRFAVSTAPPSEGDLRALAEDGYKAVVNLRCQDEADQPLAPDREGEVVASLGLEYC 64

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           + P+ A   ++DE + +  + ++  PKP+L+HC SG  R G  + ++L        +   
Sbjct: 65  HLPV-AGGTISDELVDEFRASVEALPKPVLVHCASGK-RAGAFTIMHLASQQGMSGDATL 122

Query: 163 R 163
           +
Sbjct: 123 Q 123


>gi|301628967|ref|XP_002943618.1| PREDICTED: protein tyrosine phosphatase domain-containing protein
           1-like, partial [Xenopus (Silurana) tropicalis]
          Length = 1253

 Score = 71.3 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 51/150 (34%), Gaps = 17/150 (11%)

Query: 48  VPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNL----------RGKLPESWHKEEEK 92
           +   I   A+P+        I    K   IK+++NL              PES      +
Sbjct: 101 ITDNILAMARPSSEIIDKYDIIRQFKSCSIKTVINLQRPGEHASCGNPLEPESGFTYLPE 160

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYL 150
           A  +  I   NF        +   I  ++ ++  A     + IHC +G  RTG+  A YL
Sbjct: 161 AFMEAEIYFYNFGWKDYGVASLTTILDMVKVMAFALQEGKVAIHCHAGLGRTGVLIACYL 220

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                   ++A   +     +    +   +
Sbjct: 221 IFATRMTADQAILLVRARRHNAIQTRVQLL 250


>gi|328860709|gb|EGG09814.1| hypothetical protein MELLADRAFT_30357 [Melampsora larici-populina
           98AG31]
          Length = 136

 Score = 71.3 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 51/133 (38%), Gaps = 12/133 (9%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  V P  IYRS  PN        +   + SI+ L               A D G+++ +
Sbjct: 10  FAMVSPG-IYRSGHPNYRNFA-FLEGLKLTSIMYLCADNYRPHT---FNWAQDRGLKIFH 64

Query: 104 FPLSATRELNDEQI------KQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           + +  +++ N          + L  IL T   P+LIHC  G +R G   A+       + 
Sbjct: 65  YRIDLSKDPNSPITPHSIYSEALTDILDTRNHPILIHCNKGKNRVGTICAILR-RYQAWN 123

Query: 158 KEEAHRQLSMLYG 170
            +    + +  +G
Sbjct: 124 LDSIQDEWNKFFG 136


>gi|296137034|ref|YP_003644276.1| protein of unknown function DUF442 [Thiomonas intermedia K12]
 gi|295797156|gb|ADG31946.1| protein of unknown function DUF442 [Thiomonas intermedia K12]
          Length = 163

 Score = 71.3 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/144 (15%), Positives = 49/144 (34%), Gaps = 9/144 (6%)

Query: 37  ITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAND 96
           +    +N  A     ++ S Q +   +  L    G+ +++NL           E +    
Sbjct: 7   LRFDAENTFAAFEG-LWCSGQLSVADMARLPA-LGVATVINLALPTSSKALSGEAEQVTS 64

Query: 97  LGIQLINFPLSATRELNDEQIKQLISILKTA-PKPLLIHCKSGADRTGLASAVYLYIVAH 155
           LG+  ++ P+         Q +Q   ++     +P+ +HC     R      +Y  ++  
Sbjct: 65  LGMNYVHIPVL-WDAPKPVQFEQFAGVMAALGQQPVWLHCAKNM-RASAFVYLYRLLIRG 122

Query: 156 YPKEEAHRQLSMLYGHFPVLKTIT 179
             +E+A    S           + 
Sbjct: 123 ETEEQA----SWPMSQIWAPNPVW 142


>gi|195503008|ref|XP_002098472.1| GE10393 [Drosophila yakuba]
 gi|194184573|gb|EDW98184.1| GE10393 [Drosophila yakuba]
          Length = 200

 Score = 71.3 bits (173), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 62/199 (31%), Gaps = 28/199 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDEHVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +      +    LGI+ +    +      N E++ + +  +              
Sbjct: 67  EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A   +     H  +      
Sbjct: 127 SSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRQCRPHILLHT---- 182

Query: 181 DITFEKITQLYPNNVSKGD 199
              ++ +   Y NNV    
Sbjct: 183 -KQWDALRIFYTNNVQAKS 200


>gi|149176007|ref|ZP_01854624.1| hypothetical protein PM8797T_04110 [Planctomyces maris DSM 8797]
 gi|148845161|gb|EDL59507.1| hypothetical protein PM8797T_04110 [Planctomyces maris DSM 8797]
          Length = 149

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 6/122 (4%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHK---EEEKAANDLGIQL 101
           +  +  E+    QP+   I     + G KS++N R +  +        E++  ND  ++ 
Sbjct: 4   NMKINDEVTVGPQPSAEEI-NQLSQQGFKSVVNFRTEGEDEQPLSPTAEKEKVNDAEMEY 62

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           ++ P+ + + +  E + +        PKP+  HCKSG  R G    ++L +      EE 
Sbjct: 63  LHIPV-SMKAMGPELVDEFREKYPQLPKPVFAHCKSGK-RAGAMVMMHLAVEEGMGGEET 120

Query: 162 HR 163
            +
Sbjct: 121 LQ 122


>gi|281202086|gb|EFA76291.1| hypothetical protein PPL_10054 [Polysphondylium pallidum PN500]
          Length = 483

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 45/124 (36%), Gaps = 9/124 (7%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP- 105
           ++   +YR + P    +    K   +K+I++L  K P                   +FP 
Sbjct: 16  IIEEGLYRGSYPTEKNL-RFLKRLKLKTIVSLTPKPPLKPFLN---FCERYNTTSKHFPV 71

Query: 106 --LSATRELNDEQIKQLISIL-KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
                   ++  Q+ QL+ ++   A  PL  HC  GA+ TG         V ++      
Sbjct: 72  SKFKDDVTIDASQVVQLLELMIDPANLPLYCHCLDGANVTGTIFMCLR-KVQNWNLSAII 130

Query: 163 RQLS 166
            + +
Sbjct: 131 SEFT 134


>gi|294654978|ref|XP_457063.2| DEHA2B02200p [Debaryomyces hansenii CBS767]
 gi|199429597|emb|CAG85049.2| DEHA2B02200p [Debaryomyces hansenii]
          Length = 276

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 43/165 (26%), Gaps = 45/165 (27%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNL------------------------ 78
           NF  V    IYRS  P         ++ GIK+I+ L                        
Sbjct: 78  NFSLVEDG-IYRSGFPMPINY-PFLEQLGIKTIIYLGDLGEKKKDEKSKKKNKKNKEEGD 135

Query: 79  ---------RGKLPESWHKEEEKAANDLGIQLINFPLSATRELN----------DEQIKQ 119
                                +K      I+  +  + +  E            +     
Sbjct: 136 KTPKEKEKKDKHGTAEIMDNYKKWIETTDIKFHDLFIKSASEPFTLEEDRTQALETIKTA 195

Query: 120 LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           L  I+     P+LIH   G  R G+   +   ++  +       +
Sbjct: 196 LQLIVNKQNFPILIHSNKGKHRIGVLVGLMRKLLQGWCLSGIFEE 240


>gi|218441339|ref|YP_002379668.1| hypothetical protein PCC7424_4436 [Cyanothece sp. PCC 7424]
 gi|218174067|gb|ACK72800.1| protein of unknown function DUF442 [Cyanothece sp. PCC 7424]
          Length = 157

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 52/145 (35%), Gaps = 9/145 (6%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +N++ V    +  S QP     + + ++ G   ++NL     +     E      LG+  
Sbjct: 12  KNYYWVNQ-YLATSGQPTPEQFK-IIQDAGYDVVINLALPTSDYAIVNEGAIVTGLGMVY 69

Query: 102 INFPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
           ++ P+        E I+    ++++     + +HC     R      +Y  +  + P+E+
Sbjct: 70  VHIPVV-WEAPKLEDIRLFFGVMESLSGRKVWVHCALNM-RVSCFVYLYQKLKLNLPEEQ 127

Query: 161 AHRQLSMLYGHFPVLKTITMDITFE 185
           A   +S           +      +
Sbjct: 128 ASYPMSE----IWQPNEVWTQFIED 148


>gi|164661079|ref|XP_001731662.1| hypothetical protein MGL_0930 [Malassezia globosa CBS 7966]
 gi|159105563|gb|EDP44448.1| hypothetical protein MGL_0930 [Malassezia globosa CBS 7966]
          Length = 670

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 54/133 (40%), Gaps = 8/133 (6%)

Query: 45  HAVVPHEIY-RSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
             +VP E+Y  S     + +E   ++ GIK++LN   ++P   H       +   ++  +
Sbjct: 474 STIVPGEVYLGSGVQKPSDMEK-LEQLGIKAVLNTAAEVPY-LHDASPLRHHPHIVEYKH 531

Query: 104 FPLSA-----TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
            P+         + + E+    +  + +   P  +HC++G  R+      YL     +  
Sbjct: 532 IPMRDVVEAVGVQQHLEEACCFLEQMCSRGLPTFVHCRAGKSRSATCVIAYLIKTRRWSF 591

Query: 159 EEAHRQLSMLYGH 171
           ++A+  ++     
Sbjct: 592 KQAYAFVAARRPR 604


>gi|169795675|ref|YP_001713468.1| hypothetical protein ABAYE1570 [Acinetobacter baumannii AYE]
 gi|184158424|ref|YP_001846763.1| hypothetical protein ACICU_02104 [Acinetobacter baumannii ACICU]
 gi|213158381|ref|YP_002319678.1| hypothetical protein AB57_2328 [Acinetobacter baumannii AB0057]
 gi|215483161|ref|YP_002325368.1| hypothetical protein ABBFA_001465 [Acinetobacter baumannii
           AB307-0294]
 gi|301346289|ref|ZP_07227030.1| hypothetical protein AbauAB0_08590 [Acinetobacter baumannii AB056]
 gi|301512084|ref|ZP_07237321.1| hypothetical protein AbauAB05_10902 [Acinetobacter baumannii AB058]
 gi|301595684|ref|ZP_07240692.1| hypothetical protein AbauAB059_07727 [Acinetobacter baumannii
           AB059]
 gi|332852493|ref|ZP_08434232.1| hypothetical protein HMPREF0021_01807 [Acinetobacter baumannii
           6013150]
 gi|332871304|ref|ZP_08439853.1| hypothetical protein HMPREF0020_03508 [Acinetobacter baumannii
           6013113]
 gi|332873916|ref|ZP_08441856.1| hypothetical protein HMPREF0022_01468 [Acinetobacter baumannii
           6014059]
 gi|169148602|emb|CAM86468.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|183210018|gb|ACC57416.1| hypothetical protein ACICU_02104 [Acinetobacter baumannii ACICU]
 gi|213057541|gb|ACJ42443.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213988963|gb|ACJ59262.1| hypothetical protein ABBFA_001465 [Acinetobacter baumannii
           AB307-0294]
 gi|322508750|gb|ADX04204.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323518353|gb|ADX92734.1| hypothetical protein ABTW07_2310 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332729195|gb|EGJ60538.1| hypothetical protein HMPREF0021_01807 [Acinetobacter baumannii
           6013150]
 gi|332731588|gb|EGJ62874.1| hypothetical protein HMPREF0020_03508 [Acinetobacter baumannii
           6013113]
 gi|332737902|gb|EGJ68789.1| hypothetical protein HMPREF0022_01468 [Acinetobacter baumannii
           6014059]
          Length = 174

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSIEQLK-LIKEYGCSTVINLALSNSPDSIKNEDQVCLEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + +Q   ++ ++      + + IHC     R      VY     +         
Sbjct: 75  -DWETPSSDQCLLVLDLIDHLVQNEIVWIHCAKNK-RVSCLMYVYRQFYMNMDMPTCQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|241952178|ref|XP_002418811.1| tyrosine phosphatase, putative [Candida dubliniensis CD36]
 gi|223642150|emb|CAX44117.1| tyrosine phosphatase, putative [Candida dubliniensis CD36]
          Length = 216

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 50/147 (34%), Gaps = 27/147 (18%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAAN------- 95
           NF  V  + IYRS  P         K+  +K+I+ L     ++  K ++K  +       
Sbjct: 36  NFSLV-ENGIYRSGFPMPINY-PFLKQLRLKTIIYLGDLGNQTSSKSKKKDKHGTAEIMN 93

Query: 96  --------DLGIQLINFPLSATREL----------NDEQIKQLISILKTAPKPLLIHCKS 137
                   D  I+  N    +++E                  L  IL     P+LIH   
Sbjct: 94  NYLDWIKNDTEIRFYNLLFESSQEPFNKPEDIQQATQSLTFALQLILNKENYPILIHSNK 153

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQ 164
           G  RTG+   +   ++  +       +
Sbjct: 154 GKHRTGVLIGIMRKVLQGWCLSGIFEE 180


>gi|224536830|ref|ZP_03677369.1| hypothetical protein BACCELL_01706 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224521552|gb|EEF90657.1| hypothetical protein BACCELL_01706 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 392

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 63/185 (34%), Gaps = 44/185 (23%)

Query: 46  AVVPHEIYRSAQPNGTFI--EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
            V    +YRSAQ +          K  GIK+I++LR +     H          G  +I+
Sbjct: 167 RVRWGMLYRSAQIDSLECYSRRELKNIGIKTIIDLRSESELKGH-----TPLQQGFNVIH 221

Query: 104 FPLSATRELN-------------------------------DEQIKQLISILKTAPKPLL 132
            P+      +                                E  +    +L +   P++
Sbjct: 222 VPIKTGDMEDILKGIQEQKIKSDTVYRMVERMNRELVMHYHKEYRQIFDILLNSTNYPVV 281

Query: 133 IHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ--LSMLYGHFPVLKTITMD---ITFEKI 187
           IHC SG  RTG+ASA+ L        +       LS  Y + P   +   +    + E I
Sbjct: 282 IHCSSGKGRTGIASALILAS-LGVNSDIIMEDYRLSNDYFNIPSASSYAYNLPTRSQEAI 340

Query: 188 TQLYP 192
           T +Y 
Sbjct: 341 TTIYS 345


>gi|292626793|ref|XP_699554.4| PREDICTED: protein tyrosine phosphatase domain-containing protein 1
           [Danio rerio]
          Length = 658

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/162 (16%), Positives = 51/162 (31%), Gaps = 20/162 (12%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNL-------- 78
                I         +    +   A+P+        I       G+K+I+NL        
Sbjct: 50  EEQQAIRGIYS--SWITDDML-AMARPSTETIEKFNIIDQFLRCGLKTIINLQCPGEHAS 106

Query: 79  --RGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIH 134
                 P+S      +   + GI   NF        +   I  ++ ++  A     + +H
Sbjct: 107 CGNPLDPDSGFTYRPETFMEAGIYFYNFRWIDYGVASLTSILDMVKVMSFAIQEGKMAVH 166

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLK 176
           C +G  RTG+  A YL        ++A   +     +    +
Sbjct: 167 CHAGLGRTGVLLACYLLFTTQMTADQAILLIRNKRPNSIQTR 208


>gi|239501615|ref|ZP_04660925.1| hypothetical protein AbauAB_04826 [Acinetobacter baumannii AB900]
          Length = 174

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSIEQLK-LIKEYGCSTVINLALSNSPDSIKNEDQVCLEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + +Q   ++ ++      + + IHC     R      VY     +         
Sbjct: 75  -DWETPSSDQCLLVLDLIDHLVQNEIVWIHCAKNK-RVSCLMYVYRQFYMNMDMPTCQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|302813786|ref|XP_002988578.1| hypothetical protein SELMODRAFT_447369 [Selaginella moellendorffii]
 gi|300143685|gb|EFJ10374.1| hypothetical protein SELMODRAFT_447369 [Selaginella moellendorffii]
          Length = 774

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 49/113 (43%), Gaps = 7/113 (6%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           +A+V   +YR A P         K   +K+I++L  +   +  K+      D GI L +F
Sbjct: 596 YAIVEESLYRGAYPTMKNF-RFLKRLHLKTIVSLTPEAQPN--KDLRSFCQDQGIHLQHF 652

Query: 105 PLSATREL----NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIV 153
            +   +++    +++ ++ L  I+     P  +HC  GA  TGL       + 
Sbjct: 653 HVDKFQDVVTLSHNQVVEILHRIISVENLPAYLHCLDGAHVTGLVVMCLRKLQ 705


>gi|222616506|gb|EEE52638.1| hypothetical protein OsJ_34986 [Oryza sativa Japonica Group]
          Length = 495

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 53/148 (35%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            Y   +        A++   +   +QP     I++LK E  +  IL L+      +   +
Sbjct: 73  EYHHDLGMNY----AIISDSLIVGSQPQKPEDIDHLKDEEKVAFILCLQQDKDIEYWGID 128

Query: 91  EKA----ANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +       +LGI+ I  P       +      + +  L   +      + +HC +G  R
Sbjct: 129 FQTVVNRCKELGIKHIRRPAVDFDPDSLRTQLPKAVASLEWAISEGKGRVYVHCTAGLGR 188

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               +  Y++   +   + A+ +L+   
Sbjct: 189 APAVAIAYMFWFENMNLKTAYEKLTSKR 216


>gi|159041139|ref|YP_001540391.1| dual specificity protein phosphatase [Caldivirga maquilingensis
           IC-167]
 gi|157919974|gb|ABW01401.1| dual specificity protein phosphatase [Caldivirga maquilingensis
           IC-167]
          Length = 162

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 58/154 (37%), Gaps = 10/154 (6%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPES----WHKEEEKAANDLGIQ 100
           + V+  ++  S  P G          GIK++++L  +   +           A     I+
Sbjct: 5   YWVIKGKLAGSCAPRGVKDIEAWGRMGIKAVVSLIEEFEFNEIGFPFNNYVDALRRFNIR 64

Query: 101 LINFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYP 157
           L+  P         ++   ++  +       +P+L+HC +G  R+      YL     Y 
Sbjct: 65  LLYSPTKDGESPPLDEFMAILRWIDERIHENEPVLVHCNAGVGRSPTVIIGYLM-YKGYS 123

Query: 158 KEEAHRQLS--MLYGHFPVLKTITMDITFEKITQ 189
            +EA+R +S           + + ++   + I++
Sbjct: 124 LKEAYRFVSNVNDKVSLSFTQALALEELEKLISR 157


>gi|169633322|ref|YP_001707058.1| hypothetical protein ABSDF1673 [Acinetobacter baumannii SDF]
 gi|169152114|emb|CAP01013.1| conserved hypothetical protein [Acinetobacter baumannii]
          Length = 174

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 48/122 (39%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   +  L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSIEQL-RLIKEYGCSTVINLALSNSPDSIKNEDQVCIEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + +Q   ++ ++      + + IHC     R      VY     +         
Sbjct: 75  -DWETPSSDQCLLVLDLIDHLVQNEIVWIHCAKNK-RVSCLMYVYRQFYMNMDMPTCQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|242019130|ref|XP_002430018.1| conserved hypothetical protein [Pediculus humanus corporis]
 gi|212515080|gb|EEB17280.1| conserved hypothetical protein [Pediculus humanus corporis]
          Length = 178

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/180 (14%), Positives = 58/180 (32%), Gaps = 13/180 (7%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                  ++ +   T   +       +   +   A P       L  +  IK ++++   
Sbjct: 7   FYPSLLYNIFMERFTDRRWYDR----IDETVILGALPFQKMTNQLLNDENIKGVVSMNEN 62

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK----QLISILKTAPKPLLIHCKS 137
               +    EK  N  G++ +    +   E   ++        I+  K     + +HCK+
Sbjct: 63  YELLFFSNSEKEWNKYGVEFLQLSTTDIFETPCQEKLLKGVNFINKYKKLNGSVYVHCKA 122

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           G  R+      YL     +  E+A   +     H      +     +E +   + NN+ +
Sbjct: 123 GRTRSATLVGCYLMKEHSWSPEQAVSFMKSKRPHI-----LLRTAQWEALKLFHLNNIKE 177


>gi|28571841|ref|NP_651180.3| PTEN-like phosphatase, isoform B [Drosophila melanogaster]
 gi|73621419|sp|Q86BN8|PTPM1_DROME RecName: Full=Protein-tyrosine phosphatase mitochondrial 1-like
           protein; AltName: Full=PTEN-like protein; Flags:
           Precursor
 gi|28381439|gb|AAN13956.2| PTEN-like phosphatase, isoform B [Drosophila melanogaster]
 gi|201065931|gb|ACH92375.1| FI07205p [Drosophila melanogaster]
          Length = 200

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 62/199 (31%), Gaps = 28/199 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDEHVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +      +    LGI+ +    +      N E++ + +  +              
Sbjct: 67  EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A   +     H  +      
Sbjct: 127 SSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHT---- 182

Query: 181 DITFEKITQLYPNNVSKGD 199
              ++ +   Y NNV    
Sbjct: 183 -KQWDALRLFYTNNVETKS 200


>gi|195392341|ref|XP_002054816.1| GJ22584 [Drosophila virilis]
 gi|194152902|gb|EDW68336.1| GJ22584 [Drosophila virilis]
          Length = 200

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/199 (11%), Positives = 61/199 (30%), Gaps = 28/199 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   T   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKATARNWYDR----IDENVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +    +      LGI+ +    +      N E++   +  +              
Sbjct: 67  EDYELTAFSNDSPKWKALGIEFLQLATTDIFESPNQEKLYHGVEFINRFLPLSKRIPKIN 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A   +     H  +      
Sbjct: 127 SSQYAENVGSVYVHCKAGRTRSATLVGCYLMLKNGWTPDQAVEHMRQCRPHILLHT---- 182

Query: 181 DITFEKITQLYPNNVSKGD 199
              ++ +   Y NNV    
Sbjct: 183 -KQWDALRIFYANNVEAKS 200


>gi|293609261|ref|ZP_06691563.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827713|gb|EFF86076.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 174

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KE+G  +++NL      +  + E++   DLG+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSAEQLK-LIKEFGCSTVINLALTNASNHLENEDRICLDLGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + EQ   ++ ++      + + IHC     R      VY     +     +   
Sbjct: 75  -DWEMPSAEQCLLVLDLIDHLVQNEIIWIHCAKNK-RVSCLMYVYRQFYMNMDMLTSQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|24649404|ref|NP_732901.1| PTEN-like phosphatase, isoform A [Drosophila melanogaster]
 gi|7301043|gb|AAF56179.1| PTEN-like phosphatase, isoform A [Drosophila melanogaster]
          Length = 194

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 62/199 (31%), Gaps = 28/199 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 5   VSFYPTLLYNVLMEKASARNWYDR----IDEHVILGALPFRSQANDLIEKENMKAVVSMN 60

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +      +    LGI+ +    +      N E++ + +  +              
Sbjct: 61  EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLS 120

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A   +     H  +      
Sbjct: 121 SSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHT---- 176

Query: 181 DITFEKITQLYPNNVSKGD 199
              ++ +   Y NNV    
Sbjct: 177 -KQWDALRLFYTNNVETKS 194


>gi|195112226|ref|XP_002000675.1| GI10365 [Drosophila mojavensis]
 gi|193917269|gb|EDW16136.1| GI10365 [Drosophila mojavensis]
          Length = 200

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 63/199 (31%), Gaps = 28/199 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   T   +       +   +   A P  + +  L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKATSRNWYDR----IDENVILGALPFRSQVNDLIQKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +    +      LGI+ +    +      N +++ + +  +              
Sbjct: 67  EDYELTAFSNDLAKWKALGIEFLQLATTDIFESPNQDKLYRGVEFINRFLPLSKRIPKFD 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A   +     H  +      
Sbjct: 127 SSQYAENIGSVYVHCKAGRTRSATLVGCYLMLKNGWTPDQAVDHMRQCRPHILLHT---- 182

Query: 181 DITFEKITQLYPNNVSKGD 199
              ++ +   Y NNV    
Sbjct: 183 -KQWDALRIFYANNVEPQS 200


>gi|284176050|ref|ZP_06390019.1| dual specificity protein phosphatase [Sulfolobus solfataricus 98/2]
 gi|261600949|gb|ACX90552.1| dual specificity protein phosphatase [Sulfolobus solfataricus 98/2]
          Length = 161

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 49/128 (38%), Gaps = 4/128 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESWHKEEEKAA--NDLGI 99
            + V    I  S  P         ++ G+K +L L     + E W  +E          +
Sbjct: 1   MYWVRKRIIGGSGLPYIENEILEWRKEGVKRVLVLPEDWEIEEGWGDKEYYLTVLKKNEL 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           Q ++ P+      +D Q   ++  L +  +  L+HC  G  RTG   A YL +      E
Sbjct: 61  QPLHVPIPDGGVPSDSQFLTIMRWLLSVKEGNLVHCVGGIGRTGTILASYLILTEGLDAE 120

Query: 160 EAHRQLSM 167
            A  ++ +
Sbjct: 121 SAINEVRL 128


>gi|262231804|ref|NP_001074065.2| protein tyrosine phosphatase domain-containing protein 1 [Danio
           rerio]
          Length = 713

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGK----------LPESWHKE 89
             +  H +   A+P+        I       G+K+++NL+             PES    
Sbjct: 82  SWITDH-LLAMARPSTEIVEKFNIIEQFHVCGLKTVINLQRPGEHASCGSTLEPESGFTY 140

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +   + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 141 RPELFMEAGIYFYNFGWKDYGVASLTTILDMVKVMSFAMQEGKIAVHCHAGLGRTGVLIA 200

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            +L   +    ++A   +     +    +   +
Sbjct: 201 CFLVFTSRMSADQAILFVRAKRPNSIQTRGQLL 233


>gi|162416023|sp|A1L1R5|PTPC1_DANRE RecName: Full=Protein tyrosine phosphatase domain-containing
           protein 1
 gi|120538122|gb|AAI29184.1| Zgc:158271 [Danio rerio]
 gi|124297209|gb|AAI31876.1| Zgc:158271 [Danio rerio]
          Length = 713

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 54/153 (35%), Gaps = 18/153 (11%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGK----------LPESWHKE 89
             +  H +   A+P+        I       G+K+++NL+             PES    
Sbjct: 82  SWITDH-LLAMARPSTEIVEKFNIIEQFHVCGLKTVINLQRPGEHASCGSTLEPESGFTY 140

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             +   + GI   NF        +   I  ++ ++  A     + +HC +G  RTG+  A
Sbjct: 141 RPELFMEAGIYFYNFGWKDYGVASLTTILDMVKVMSFAMQEGKIAVHCHAGLGRTGVLIA 200

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
            +L   +    ++A   +     +    +   +
Sbjct: 201 CFLVFTSRMSADQAILFVRAKRPNSIQTRGQLL 233


>gi|198452108|ref|XP_001358634.2| GA10281 [Drosophila pseudoobscura pseudoobscura]
 gi|198131790|gb|EAL27775.2| GA10281 [Drosophila pseudoobscura pseudoobscura]
          Length = 200

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/200 (11%), Positives = 60/200 (30%), Gaps = 30/200 (15%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  T    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDDTVILGALPFRTQANDLIQKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +           L ++ +    +      N +++ + +  +              
Sbjct: 67  EDYELTAFSNNSDKWRKLNVEFLQLATTDIFESPNQDKLFRGVEFINKFLPQSNRISGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF-PVLKTIT 179
                     + +HCK+G  R+      YL +   +  +EA   +     H     K   
Sbjct: 127 STQSPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDEAVDHMRACRPHILLHTKQ-- 184

Query: 180 MDITFEKITQLYPNNVSKGD 199
               ++ +   Y NNV    
Sbjct: 185 ----WDALRLFYTNNVQAKS 200


>gi|195145424|ref|XP_002013693.1| GL23260 [Drosophila persimilis]
 gi|194102636|gb|EDW24679.1| GL23260 [Drosophila persimilis]
          Length = 200

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/200 (11%), Positives = 60/200 (30%), Gaps = 30/200 (15%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  T    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDDTVILGALPFRTQANDLIQKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +           L ++ +    +      N E++ + +  +              
Sbjct: 67  EDYELTAFSNNSDKWRKLNVEFLQLATTDIFESPNQEKLFRGVEFINKFLPLSNRISGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF-PVLKTIT 179
                     + +HCK+G  R+      YL +   +  +EA   +     H     K   
Sbjct: 127 STQSPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDEAVDHMRACRPHILLHTKQ-- 184

Query: 180 MDITFEKITQLYPNNVSKGD 199
               ++ +   Y NNV    
Sbjct: 185 ----WDALRLFYTNNVQAKS 200


>gi|320163093|gb|EFW39992.1| protein tyrosine phosphatase [Capsaspora owczarzaki ATCC 30864]
          Length = 111

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 37/99 (37%), Gaps = 10/99 (10%)

Query: 94  ANDLGIQLINFPLSATRELNDEQIKQLIS-----ILKTAPKPLLIHCKSGADRTGLASAV 148
             D  I L  F +   +E   +  +  +      +L T   P+LIHC  G  RTG     
Sbjct: 1   MADNHITLYQFGVPGNKEPFVDIPEDKMQQALTVLLDTRCHPILIHCNKGKHRTGCLVGC 60

Query: 149 YLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKI 187
              +   +     H  +   Y  F   K+ T+D  F ++
Sbjct: 61  LRKM-QRWS----HTSICDEYRRFSHPKSRTLDQQFIEL 94


>gi|325122529|gb|ADY82052.1| hypothetical protein BDGL_001466 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 174

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KE+G  +++NL      +  + E++   D G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSAEQLK-LIKEFGCSTVINLALTNASNHLENEDRICLDFGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + EQ   ++ ++      + + IHC     R      VY     +     +   
Sbjct: 75  -DWEMPSAEQCLLVLDLIDHLVQNEIIWIHCAKNK-RVSCLMYVYRQFYMNMDMPMSQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|149178973|ref|ZP_01857548.1| hypothetical protein PM8797T_10484 [Planctomyces maris DSM 8797]
 gi|148842172|gb|EDL56560.1| hypothetical protein PM8797T_10484 [Planctomyces maris DSM 8797]
          Length = 149

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 6/112 (5%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRE 111
             QPN   I    K  G K+I+N R    +      + EE+      ++ ++ P+ +   
Sbjct: 14  GPQPNHKEIYEFGK-NGFKTIVNFRAPHEKDQPINPQAEEQIVKGADMEYLHIPV-SMNS 71

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
           L++  + Q     +  PKP+  HCKSG  R G    + L +      E+  +
Sbjct: 72  LDESLVDQFREQYEALPKPIFAHCKSGK-RAGAMVMMDLAVKQGMSGEQTLQ 122


>gi|295086066|emb|CBK67589.1| Protein tyrosine/serine phosphatase [Bacteroides xylanisolvens
           XB1A]
          Length = 355

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 61/177 (34%), Gaps = 35/177 (19%)

Query: 50  HEIYRSAQPN--GTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLGI------- 99
             IYRSAQ +          K  GI++I++LR +    ++ +  +     + I       
Sbjct: 134 GMIYRSAQIDSIPPCSRQELKNMGIRTIIDLRPESERHNYPQLHDDKFKIVHIPILTGNM 193

Query: 100 ---------------QLINFPLSATREL----NDEQIKQLISILKTAPKPLLIHCKSGAD 140
                           +        REL      E  +    +L  +  P++IHC SG  
Sbjct: 194 EKILQGIREEKIKTDTIYRLVERMNRELVTNYQKEFKELFTVLLDRSNYPVVIHCTSGKG 253

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF-----EKITQLYP 192
           RTG+ SA+ L       ++       +   +F + K             E IT +Y 
Sbjct: 254 RTGVVSALLLAA-LGVNEDVIMEDYRLSNDYFNIPKASKYAYKLPINSQEAITTIYS 309


>gi|83647404|ref|YP_435839.1| protein-tyrosine phosphatase [Hahella chejuensis KCTC 2396]
 gi|83635447|gb|ABC31414.1| predicted protein-tyrosine phosphatase [Hahella chejuensis KCTC
           2396]
          Length = 248

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 47/136 (34%), Gaps = 15/136 (11%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEY----------LKKEYGIKSILNLRGKLPESWH 87
               +NF  V+P  + RS+QPN    +             K+ G+  I+        +  
Sbjct: 16  QFGFKNFQWVLPGVLVRSSQPNYAGHDQPHTLSFVQVDFLKKKGVTCII---SSNEYALE 72

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK--TAPKPLLIHCKSGADRTGLA 145
           +  +      GI   +F ++  +     Q+     I++        L+HC  G  RTG  
Sbjct: 73  EHSKTLLKTYGISYYHFKIADFKAATPAQLINAAEIIEANKKKGATLVHCGFGEGRTGTI 132

Query: 146 SAVYLYIVAHYPKEEA 161
            A +        +  A
Sbjct: 133 VAGWAMTKHMKTQAGA 148


>gi|91793880|ref|YP_563531.1| Dual specificity protein phosphatase [Shewanella denitrificans
           OS217]
 gi|91715882|gb|ABE55808.1| dual specificity protein phosphatase [Shewanella denitrificans
           OS217]
          Length = 156

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/161 (21%), Positives = 55/161 (34%), Gaps = 20/161 (12%)

Query: 42  QNFHAVVPHEIYRSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           ++   +V  ++   + P      +       GIK I++L            E A  ++GI
Sbjct: 2   KDVFWLVEGKLAGRSGPNKTPWDL-QELAANGIKVIVSLNDANQCD-----ESAMAEVGI 55

Query: 100 QLINFPLSATRELNDEQIKQLISIL----------KTAPKPLLIHCKSGADRTGLASAVY 149
               F L  +     + +     IL          +    P+LIHC+SG DRTGL  A Y
Sbjct: 56  LHRVFTLPDSIPPTLDDLAICTEILPKILAFIAQCEADNLPVLIHCRSGKDRTGLMMAYY 115

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           L          A  Q+  +               F+ +  L
Sbjct: 116 LM-KNGAAPLHAVSQVRNVRE-IAFSADGWDQFVFDVLYAL 154


>gi|195573230|ref|XP_002104598.1| GD21036 [Drosophila simulans]
 gi|194200525|gb|EDX14101.1| GD21036 [Drosophila simulans]
          Length = 200

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 61/199 (30%), Gaps = 28/199 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDEHVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +           LGI+ +    +      N E++ + +  +              
Sbjct: 67  EDYELTAFSNNTDKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A   +     H  +      
Sbjct: 127 SSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHT---- 182

Query: 181 DITFEKITQLYPNNVSKGD 199
              ++ +   Y NNV    
Sbjct: 183 -KQWDALRLFYTNNVETKS 200


>gi|260554737|ref|ZP_05826958.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
 gi|260411279|gb|EEX04576.1| conserved hypothetical protein [Acinetobacter baumannii ATCC 19606]
          Length = 174

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL         K E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSIEQLK-LIKEYGCSTVINLALSNSPDSIKNEDRVCLEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + +Q   ++ ++      + + +HC     R      VY     +         
Sbjct: 75  -DWETPSSDQCLLVLDLIDHLVQNEIVWLHCAKNK-RVSCLMYVYRQFYMNMDMPTCQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|83769246|dbj|BAE59383.1| unnamed protein product [Aspergillus oryzae]
          Length = 114

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 5/75 (6%)

Query: 110 RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLY 169
           +  +      L  +L  A  P+LIHC  G  RTG   A +   V  +   +   +    Y
Sbjct: 6   KTPDHVINGILEILLNKANHPILIHCNKGKHRTGCVVACFR-KVQGWNLRDVLDE----Y 60

Query: 170 GHFPVLKTITMDITF 184
             +   K+  +D  F
Sbjct: 61  LSYSWPKSRALDERF 75


>gi|296314378|ref|ZP_06864319.1| phosphatase DUF442 family protein [Neisseria polysaccharea ATCC
           43768]
 gi|296838935|gb|EFH22873.1| phosphatase DUF442 family protein [Neisseria polysaccharea ATCC
           43768]
          Length = 157

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 20  DEHLYISPQLTEAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 78

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 79  PVTARDIQKHDVETFRQLIGQAEYPVLAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 134


>gi|171183|gb|AAA34477.1| CDC14 [Saccharomyces cerevisiae]
          Length = 423

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 40/129 (31%), Gaps = 11/129 (8%)

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            QP    +        ++ ++ L        H   +K   D+GIQ ++         +  
Sbjct: 80  NQPF-KSVLNFFANNNVQLVVRLNS------HLYNKKHFEDIGIQHLDLIFEDGTCPDLS 132

Query: 116 QIKQL---ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGH 171
            +K        +      + +HCK+G  RTG     +L     +   E    L     G 
Sbjct: 133 IVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGM 192

Query: 172 FPVLKTITM 180
               +   +
Sbjct: 193 VVGPQQHWL 201


>gi|167045124|gb|ABZ09787.1| hypothetical protein ALOHA_HF4000APKG8I13ctg1g57 [uncultured marine
           crenarchaeote HF4000_APKG8I13]
          Length = 138

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 46/127 (36%), Gaps = 6/127 (4%)

Query: 22  VLVLCAVSLGLYFLTITTFTQ-NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRG 80
             +     +        T    NF  ++  ++  SA P          E GIKSI+ +R 
Sbjct: 17  FCMTIYGDVWRKVHGTITGKPDNFSWLLEEKLAGSAIPTSFDEIQWVMEQGIKSIVTVR- 75

Query: 81  KLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGAD 140
              E   +   K    + I   +  +    +L          I  T  +P+L+HC +G  
Sbjct: 76  --EEPLDESWTKDVKYIHILSNDMGIPEFNDLVQAIDFIHKRI--TNNEPVLVHCLAGLG 131

Query: 141 RTGLASA 147
           RTG+  A
Sbjct: 132 RTGVILA 138


>gi|57162210|emb|CAI40541.1| CDC14 cell division cycle 14 homolog B (S. cerevisiae) [Homo
           sapiens]
          Length = 268

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 12/117 (10%), Positives = 29/117 (24%), Gaps = 19/117 (16%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 158 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 217

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATREL 112
            Q +        K + + +I+ L  ++       + K   D G    +   +     
Sbjct: 218 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTP 268


>gi|322488072|emb|CBZ23317.1| tyrosine phospatase-like protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 869

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 48/126 (38%), Gaps = 10/126 (7%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  V    +YR A P         +   +++I++L   +PE    + +  A    IQL +
Sbjct: 392 FARVESG-VYRGAYPVLRNF-PYIRRLRLRTIVSL---IPEPPTYDIKCFAEAEHIQLHH 446

Query: 104 FPLSATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 +     L  E  + L  I+     PL IHC  G   TGL       ++  +  +
Sbjct: 447 IHAERAKGEVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALRKLLQ-WDAK 505

Query: 160 EAHRQL 165
            A+ + 
Sbjct: 506 VANAEF 511


>gi|167537137|ref|XP_001750238.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163771228|gb|EDQ84897.1| predicted protein [Monosiga brevicollis MX1]
          Length = 476

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 57/197 (28%), Gaps = 38/197 (19%)

Query: 43  NFHAVVPHEIYRS----AQPNGTFIEYLKKEYGIKSILNLRGKLPESW---------HKE 89
           N   V  + +  S       +   +     E GI  +LNL+     S             
Sbjct: 72  NSTWVTENLLAMSRPLQGAIDAYHLPKKFAEAGITMVLNLQEPFEHSHCGAGVNRHGFSY 131

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGLAS 146
             ++    G+ + N           E+   ++ I+         + +HC +G  RTGL  
Sbjct: 132 SFESFQQQGVTVCNCAWVDFGSPPMERALDIVKIMASVIQEGGKIAVHCHAGRGRTGLII 191

Query: 147 AVYLYIVAHYPKEEAHR-------------------QLSMLYGHFPVLKTITMDITFEKI 187
           A YL     Y   +A R                   +   +Y H    +        ++ 
Sbjct: 192 AAYLIFHNDYTAAKAIRLVRSQRPKTIQTRNQVKFLEEFDMYLH---PRRAVYHHVPDET 248

Query: 188 TQLYPNNVSKGDTEQPM 204
            QL      + +    +
Sbjct: 249 EQLTLREALERERTWLV 265


>gi|161870574|ref|YP_001599746.1| hypothetical protein NMCC_1640 [Neisseria meningitidis 053442]
 gi|161596127|gb|ABX73787.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 142

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 43/118 (36%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 7   DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 65

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    +++ A  P+L +C++G  R  L    +       P +E  R
Sbjct: 66  PVTARDIQKHDVETFRQLIEQAEYPVLAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 121


>gi|170289804|ref|YP_001736620.1| protein-tyrosine phosphatase [Candidatus Korarchaeum cryptofilum
           OPF8]
 gi|170173884|gb|ACB06937.1| Predicted protein-tyrosine phosphatase [Candidatus Korarchaeum
           cryptofilum OPF8]
          Length = 168

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 53/130 (40%), Gaps = 10/130 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +    +  SA  +           G +++++L     E       ++  +LGI+ +
Sbjct: 6   NFSFIDE-FVAGSALISSKEEVEWLYANGFRTVISLVEPNEEV-----RESMEELGIENL 59

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKP---LLIHCKSGADRTGLASAVYLYIVAHYPKE 159
            FP+        E + +++ IL+   +    +L+HC +G  RTG   A YL        +
Sbjct: 60  LFPVEDFEAPPIEVLARIVEILRERGRRGERVLVHCFAGCGRTGTLLACYLISK-GMRPD 118

Query: 160 EAHRQLSMLY 169
           +A   LS   
Sbjct: 119 DALSYLSSKR 128


>gi|125575968|gb|EAZ17190.1| hypothetical protein OsJ_32699 [Oryza sativa Japonica Group]
          Length = 268

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 52/148 (35%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            Y   +        A++   +   +QP     I++LK E  +  IL L+      +   +
Sbjct: 70  EYHHDLGMNY----AIISDSLIVGSQPQKPEDIDHLKDEEKVAFILCLQQDKDIEYWGID 125

Query: 91  EKA----ANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +       +LGI+ I  P       +      + +  L   +      + +HC +G  R
Sbjct: 126 FQTVVNRCKELGIKHIRRPAVDFDPDSLRTQLPKAVSSLEWAISEGKGRVYVHCTAGLGR 185

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               +  Y++   +     A+ +L+   
Sbjct: 186 APAVAIAYMFWFENMDLRTAYEKLTSKR 213


>gi|115483819|ref|NP_001065571.1| Os11g0113100 [Oryza sativa Japonica Group]
 gi|77548369|gb|ABA91166.1| Dual specificity phosphatase, catalytic domain containing protein,
           expressed [Oryza sativa Japonica Group]
 gi|113644275|dbj|BAF27416.1| Os11g0113100 [Oryza sativa Japonica Group]
 gi|125535601|gb|EAY82089.1| hypothetical protein OsI_37289 [Oryza sativa Indica Group]
 gi|215704197|dbj|BAG93037.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 271

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 52/148 (35%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            Y   +        A++   +   +QP     I++LK E  +  IL L+      +   +
Sbjct: 73  EYHHDLGMNY----AIISDSLIVGSQPQKPEDIDHLKDEEKVAFILCLQQDKDIEYWGID 128

Query: 91  EKA----ANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +       +LGI+ I  P       +      + +  L   +      + +HC +G  R
Sbjct: 129 FQTVVNRCKELGIKHIRRPAVDFDPDSLRTQLPKAVSSLEWAISEGKGRVYVHCTAGLGR 188

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               +  Y++   +     A+ +L+   
Sbjct: 189 APAVAIAYMFWFENMDLRTAYEKLTSKR 216


>gi|321475499|gb|EFX86462.1| hypothetical protein DAPPUDRAFT_208196 [Daphnia pulex]
          Length = 156

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 50/132 (37%), Gaps = 10/132 (7%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  +   +I   A P            GI+ ++ L  +L        E+    +GI   
Sbjct: 8   NFSWLEDGKIAALAFPEKREDLEFLANQGIRYLVTLTKELKPRV----EEVPALIGIN-- 61

Query: 103 NFPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
              +        EQ++Q ISI + A    + + +HC++G  RTG   A YL        E
Sbjct: 62  -ICVDDYCTFTLEQVQQFISICEKALEKKEGIAVHCRAGIGRTGTLLACYLVRFKQLKPE 120

Query: 160 EAHRQLSMLYGH 171
           EA   +     H
Sbjct: 121 EAILHVRTARPH 132


>gi|311247855|ref|XP_003122867.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like [Sus
           scrofa]
          Length = 273

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/202 (15%), Positives = 75/202 (37%), Gaps = 25/202 (12%)

Query: 9   KNLLIF--YIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYR------------ 54
           ++ L +  +  +  G L+   ++  L++ T+      F   VP   +R            
Sbjct: 62  RSSLRWAGWGGMAAGTLLEAGLARVLFYPTL--LYTLFRGKVPGRAHRDWYNRIDSTVLL 119

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA-TRELN 113
            A P  +    L ++  ++ ++ +  +    +     K   +LG++ +       T    
Sbjct: 120 GALPLRSMTRRLVQDENVRGVITMNEEYETRFLCNSSKEWKNLGVEQLRLSTVDMTGVPT 179

Query: 114 DEQIK---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYG 170
              ++   Q     ++  + + +HCK+G  R+    A YL  + ++  EEA R ++ +  
Sbjct: 180 LANLQKGVQFALKYQSQGQSVYVHCKAGRSRSATMVAAYLIQMYNWTPEEAVRAITKIRS 239

Query: 171 HFPVLKTITMDITFEKITQLYP 192
           H             E + + + 
Sbjct: 240 HI-----YIRPGQLEVLKEFHK 256


>gi|254514440|ref|ZP_05126501.1| conserved hypothetical protein [gamma proteobacterium NOR5-3]
 gi|219676683|gb|EED33048.1| conserved hypothetical protein [gamma proteobacterium NOR5-3]
          Length = 216

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 60/164 (36%), Gaps = 11/164 (6%)

Query: 8   RKNLLIFYIKILLGVLVLCAVSLGLYFLTIT-----TFTQNFHAVVPHEIYRSAQPNGTF 62
           + + L     +    LVL   +L L              +NFH V    +  + Q     
Sbjct: 26  KAHNLGGLFTVKFYRLVLAIAALWLSPAYSKDPHTLEDARNFHRV-SDVLLTAGQIYPEQ 84

Query: 63  IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122
           +  L+ E  ++ I+NL    P   + EE  A    GI  +N P+          ++   +
Sbjct: 85  VAALQSES-VELIINLAVADPSR-NAEEPFAVQQAGINYVNIPVL-WDAPTPRDLELFFA 141

Query: 123 ILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
           ++        L+HC +   R    + +Y  I    P+ +A + L
Sbjct: 142 MMDARQGRKTLVHCFANF-RASAFTYLYRVIREGVPEVDARKDL 184


>gi|89069500|ref|ZP_01156850.1| hypothetical protein OG2516_04199 [Oceanicola granulosus HTCC2516]
 gi|89044981|gb|EAR51068.1| hypothetical protein OG2516_04199 [Oceanicola granulosus HTCC2516]
          Length = 149

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query: 58  PNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
           P+   +   +K+ G ++++NLR   + PE    EEE+ A + G+  ++ P +A   L+  
Sbjct: 18  PDQAALAQAQKD-GFRAVVNLRTASEKPEIAPDEEERIAREAGLAYLHHPTAADG-LDAA 75

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVL 175
            + +    L + P P+L+HC SG  R G  + + L     +  +EA              
Sbjct: 76  HVDEFRRHLASLPDPVLVHCASGK-RAGALTLMALGAENGWSGDEALA----------HG 124

Query: 176 KTITMDITFEKI 187
           +   +D+  E+I
Sbjct: 125 RQAGLDLANEQI 136


>gi|326528817|dbj|BAJ97430.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 278

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 53/145 (36%), Gaps = 14/145 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            Y   +        AV+   +   +QP     I++LK E  +  IL L+      +   +
Sbjct: 80  EYHHDLGMNY----AVISDSLIVGSQPQKPDDIDHLKNEENVAYILCLQQDKDIEYWGID 135

Query: 91  EKA----ANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +A      +LGIQ +  P       +      + +  L   +      + IHC +G  R
Sbjct: 136 FQAVVSRCKELGIQHMRRPAVDFDPDSLRKQLPKAVSALEWAISQGKGRVYIHCTAGLGR 195

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLS 166
               +  Y++   +     A+ +L+
Sbjct: 196 APAVAISYMFWFENMDLNTAYDKLT 220


>gi|229583274|ref|YP_002841673.1| dual specificity protein phosphatase [Sulfolobus islandicus
           Y.N.15.51]
 gi|228013990|gb|ACP49751.1| dual specificity protein phosphatase [Sulfolobus islandicus
           Y.N.15.51]
          Length = 161

 Score = 69.0 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 49/128 (38%), Gaps = 4/128 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESW--HKEEEKAANDLGI 99
            + V    I  S  P         ++ G+K +L L     + ESW             G+
Sbjct: 1   MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGL 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           Q ++ P+      +D Q   ++  L +  +  L+HC  G  RTG   A YL +      E
Sbjct: 61  QPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHCVGGIGRTGTILASYLILTEELEVE 120

Query: 160 EAHRQLSM 167
            A  ++ +
Sbjct: 121 SAIDEVRL 128


>gi|146417654|ref|XP_001484795.1| hypothetical protein PGUG_02524 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146390268|gb|EDK38426.1| hypothetical protein PGUG_02524 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 276

 Score = 69.0 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 45/154 (29%), Gaps = 34/154 (22%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE------------------ 84
           NF  V    IYRS  P         +   +K+I+ L     E                  
Sbjct: 89  NFSLVEDG-IYRSGFPMPINY-PFLERLELKTIIYLGDLGQEKKEKKQKKDKEKEKEKDK 146

Query: 85  ----SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ----------LISILKTAPKP 130
                     ++  +   I   +  + +++E    Q +           L  +L     P
Sbjct: 147 NTTLEVLANYKQWIDSTDITFHHLMMESSQEPFLNQDRIKQAQESLTTALQLMLDRNNFP 206

Query: 131 LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           +LIH   G  R G+   +   I+  +       +
Sbjct: 207 MLIHSNKGKHRIGVLVGLMRKILQGWCMSGIFEE 240


>gi|221106184|ref|XP_002170866.1| PREDICTED: similar to protein tyrosine phosphatase domain
           containing 1 (predicted), partial [Hydra magnipapillata]
          Length = 273

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 56/178 (31%), Gaps = 35/178 (19%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLPESW---------HKEE 90
             V  + I  +++P+        I    +  GIKSI+NL+     S             E
Sbjct: 73  SWVTKN-ILATSRPSTEVIKKHNIIEQFQNAGIKSIINLQQAGEHSACGFGLEPSGFSYE 131

Query: 91  EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAV 148
            K   D  +   NF  +     +   I  ++ ++  A     + +HC +G  RTG+  A 
Sbjct: 132 PKDFMDNNVFFYNFCWNDYGVRSLSSILDMVKVMDFALQNGKVAVHCHAGLGRTGVLIAC 191

Query: 149 YLYIVAHYPKEEA---------------HRQLSMLYGHFPVLKTI---TMDITFEKIT 188
           YL         E                 +  +M Y H           +D    +  
Sbjct: 192 YLIYSLRCSANEVILLFVYMFHLKAVHTLKYSNMKYYHISKKLNGGKVFIDRILRRFA 249


>gi|260551681|ref|ZP_05825755.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
 gi|260405424|gb|EEW98918.1| conserved hypothetical protein [Acinetobacter sp. RUH2624]
          Length = 174

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 50/122 (40%), Gaps = 5/122 (4%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++   ++ SAQP+   ++ L KEYG  +++NL         + E++   + G+  I+ P+
Sbjct: 16  IIHEHLFSSAQPSIEQLK-LIKEYGCSTVINLALTNSPDCIENEDRVCLEYGLNYIHIPI 74

Query: 107 SATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                 + +Q   ++ ++      + + +HC     R      VY     +     +   
Sbjct: 75  -DWETPSSDQCLLVLDLIDHLVQNEIVWLHCAKNK-RVSCLMYVYRQFYMNMDMPTSQDL 132

Query: 165 LS 166
           L 
Sbjct: 133 LH 134


>gi|327538147|gb|EGF24832.1| protein containing DUF1080 [Rhodopirellula baltica WH47]
          Length = 385

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 49/117 (41%), Gaps = 6/117 (5%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             I+ + QP    +    K+ G+K ++ LR +    +  E      + G++         
Sbjct: 249 GPIWLAGQPTAEGLAA-AKKAGVKRVITLRSERELDFDDE--ALVKNAGLEFHAIRFGGH 305

Query: 110 RELNDEQIKQLISILKTAP--KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++L DE+I  +  +L+ A      L+HC S A+R G     Y  +      E A ++
Sbjct: 306 QQLTDEKIHAVCQLLQAADPDNQALLHCAS-ANRVGAIWIAYRVLDGRQTLENAIQE 361


>gi|32471313|ref|NP_864306.1| secreted glycosyl hydrolase [Rhodopirellula baltica SH 1]
 gi|32443154|emb|CAD71985.1| probable secreted glycosyl hydrolase [Rhodopirellula baltica SH 1]
          Length = 504

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 49/117 (41%), Gaps = 6/117 (5%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             I+ + QP    +    K+ G+K ++ LR +    +  E      + G++         
Sbjct: 368 GPIWLAGQPTAEGLAA-AKKAGVKRVITLRSERELDFDDE--ALVKNAGLEFHAIRFGGH 424

Query: 110 RELNDEQIKQLISILKTAP--KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++L DE+I  +  +L+ A      L+HC S A+R G     Y  +      E A ++
Sbjct: 425 QQLTDEKIHAVCQLLQAADPDNQALLHCAS-ANRVGAIWIAYRVLDGRQTLENAIQE 480


>gi|307170458|gb|EFN62728.1| Protein tyrosine phosphatase domain-containing protein 1
           [Camponotus floridanus]
          Length = 624

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 50/151 (33%), Gaps = 15/151 (9%)

Query: 45  HAVVPHEIY--R--SAQPNGTFIEYLKKEYGIKSILNLRGKLP---------ESWHKEEE 91
           H V    +   R  + Q     I    + + IK+I+NL+             ES    + 
Sbjct: 71  HWVTDDVLAMARPNTTQIVKKDIIAQFQGWSIKTIINLQTPGEHASCGDPLEESGFTYDP 130

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISI--LKTAPKPLLIHCKSGADRTGLASAVY 149
                  I   NF L    +    ++  ++ +         + IHC +G  RTG+  A Y
Sbjct: 131 NIFMKNNIYYYNFALKDYGDATMGKLLDMVKVVAFAVQEGRVAIHCHAGLGRTGVLIACY 190

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
           L         +A R + M        +   +
Sbjct: 191 LIYSLRVRANDAIRFVRMKRPSAIQTRGQIL 221


>gi|268536030|ref|XP_002633150.1| Hypothetical protein CBG05851 [Caenorhabditis briggsae]
 gi|187034666|emb|CAP26483.1| hypothetical protein CBG_05851 [Caenorhabditis briggsae AF16]
          Length = 446

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 31/175 (17%), Positives = 58/175 (33%), Gaps = 19/175 (10%)

Query: 46  AVVPHEIYRSAQPNGTFIEYL-----KKEYGIKSILNLRGKLPESW---------HKEEE 91
            + P  I   ++      E +      K   I+S++NL+     S+            + 
Sbjct: 73  WITPD-ILAMSRLQEEHFEKMGIVEQFKINEIQSVINLQESGEHSFCGSGNLASGFSYDP 131

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVY 149
           +     GI   NFPL   +     ++  ++ ++  A     + +HC +G  RTG+  A +
Sbjct: 132 EILMKNGIYHYNFPLPDFQACTSNRLLDIVKVVDFALANGKIAVHCHAGHGRTGMVIAAW 191

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPM 204
           +         +A   +          K      T  K      NN      +Q M
Sbjct: 192 MMFALGMSPSQAVNTVRSRRAKAVQSKEQV--ETLHKFRLQIRNNGGMIIPKQKM 244


>gi|121635361|ref|YP_975606.1| hypothetical protein NMC1647 [Neisseria meningitidis FAM18]
 gi|120867067|emb|CAM10832.1| hypothetical protein NMC1647 [Neisseria meningitidis FAM18]
 gi|316985739|gb|EFV64684.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
          Length = 155

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 20  DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 78

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 79  PVTARDIQKHDVETFRQLIGQAEYPVLAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 134


>gi|189464962|ref|ZP_03013747.1| hypothetical protein BACINT_01306 [Bacteroides intestinalis DSM
           17393]
 gi|189437236|gb|EDV06221.1| hypothetical protein BACINT_01306 [Bacteroides intestinalis DSM
           17393]
          Length = 356

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 62/181 (34%), Gaps = 44/181 (24%)

Query: 50  HEIYRSAQPNGTFI--EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
             +YRSAQ +          K  GIK+I++LR +     H          G  +++ P+ 
Sbjct: 134 GMLYRSAQIDSLECYSRRELKNIGIKTIVDLRSESELKGH-----TPLQEGFNVVHIPIK 188

Query: 108 ATRELN-------------------------------DEQIKQLISILKTAPKPLLIHCK 136
                +                                E  +    +L +A  P++IHC 
Sbjct: 189 TGDMEDILRGIQEQKIKSDTVYRMVERMNRELVMNYHHEYRQIFDILLDSANYPVVIHCS 248

Query: 137 SGADRTGLASAVYLYIVAHYPKEEAHRQ--LSMLYGHFPVLKTITMD---ITFEKITQLY 191
           SG  RTG+ASA+ L        +       LS  Y + P       +    + E IT +Y
Sbjct: 249 SGKGRTGIASALILAS-LGVNSDIIMEDYRLSNDYFNIPSASRYAYNLPARSQEAITTVY 307

Query: 192 P 192
            
Sbjct: 308 S 308


>gi|196004674|ref|XP_002112204.1| hypothetical protein TRIADDRAFT_56005 [Trichoplax adhaerens]
 gi|190586103|gb|EDV26171.1| hypothetical protein TRIADDRAFT_56005 [Trichoplax adhaerens]
          Length = 191

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/161 (14%), Positives = 63/161 (39%), Gaps = 6/161 (3%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           V   I   A P  +    L K+  ++ ++ +       +    ++    LG++ +     
Sbjct: 31  VDENILIGALPFRSHANELVKQENVRGVVTMNENYETRFVSPNQQEWGALGVKQLRLSTV 90

Query: 108 AT-RELNDEQIKQLISILKTAPK---PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
              +  + E++++ I+ +    K    + +HCK+G  R+      Y+     Y    A +
Sbjct: 91  DFYQSPSVERVEEAINFIDDVNKNGCSVYVHCKAGRGRSATVVLCYIMKHYRYDPFHALQ 150

Query: 164 QLSMLYGHFP--VLKTITMDITFEKITQLYPNNVSKGDTEQ 202
            L     H      + +T++  ++K+++      +  + E+
Sbjct: 151 FLKTKRSHIKLCEAQQLTVNHYYKKLSENLEKQCNPQNAEE 191


>gi|77553468|gb|ABA96264.1| Dual specificity phosphatase, catalytic domain containing protein,
           expressed [Oryza sativa Japonica Group]
 gi|218185108|gb|EEC67535.1| hypothetical protein OsI_34846 [Oryza sativa Indica Group]
          Length = 271

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 53/148 (35%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            Y   +        A++   +   +QP     I++LK E  +  IL L+      +   +
Sbjct: 73  EYHHDLGMNY----AIISDSLIVGSQPQKPEDIDHLKDEEKVAFILCLQQDKDIEYWGID 128

Query: 91  EKA----ANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +       +LGI+ I  P       +      + +  L   +      + +HC +G  R
Sbjct: 129 FQTVVNRCKELGIKHIRRPAVDFDPDSLRTQLPKAVASLEWAISEGKGRVYVHCTAGLGR 188

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               +  Y++   +   + A+ +L+   
Sbjct: 189 APAVAIAYMFWFENMNLKTAYEKLTSKR 216


>gi|145579198|pdb|2DXP|A Chain A, Crystal Structure Of The Complex Of The Archaeal
           Sulfolobus Ptp-Fold Phosphatase With Phosphopeptides
           A-(P)y-R
 gi|145579564|pdb|2I6O|A Chain A, Crystal Structure Of The Complex Of The Archaeal
           Sulfolobus Ptp-Fold Phosphatase With Phosphopeptides
           N-G-(P)y-K-N
 gi|145579566|pdb|2I6P|A Chain A, Crystal Structure Of The Complex Of The Archaeal
           Sulfolobus Ptp-Fold Phosphatase With Pnpp
          Length = 161

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 48/128 (37%), Gaps = 4/128 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK--LPESW--HKEEEKAANDLGI 99
            + V    I  S  P         ++ G+K +L L     + ESW             G+
Sbjct: 1   MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGL 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           Q ++ P+      +D Q   ++  L +  +  L+H   G  RTG   A YL +      E
Sbjct: 61  QPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHSVGGIGRTGTILASYLILTEGLEVE 120

Query: 160 EAHRQLSM 167
            A  ++ +
Sbjct: 121 SAIDEVRL 128


>gi|156543882|ref|XP_001606959.1| PREDICTED: similar to GA10281-PA [Nasonia vitripennis]
          Length = 188

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/189 (11%), Positives = 54/189 (28%), Gaps = 21/189 (11%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                  ++ +  ++   +       +   +   A P  +  + L  E  +K ++++   
Sbjct: 7   FYPSLLYNVFMEKISTRRWYDR----IDETVILGALPFRSTTKQLISEENVKGVVSMNED 62

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSA-----------TRELNDEQIKQLISILKTAPKP 130
                     +      +Q +    +                   Q     S  +    P
Sbjct: 63  YELWLLSNNAEEWKKYNVQFLQLSTTDIFETPCQEKLKRGVSFINQFSNEKSQSQEEKCP 122

Query: 131 -LLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
            + +HCK+G  R+      YL     +  EEA   +     H  + K       ++ +  
Sbjct: 123 TVYVHCKAGRTRSATLVGCYLMTKHGWTPEEAVDYMRNKRQHILIHKA-----QWQALKI 177

Query: 190 LYPNNVSKG 198
            Y + +   
Sbjct: 178 FYNDQIKSK 186


>gi|332019490|gb|EGI59969.1| Protein tyrosine phosphatase domain-containing protein 1
           [Acromyrmex echinatior]
          Length = 615

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 32/140 (22%), Positives = 50/140 (35%), Gaps = 15/140 (10%)

Query: 45  HAVVPHEIY--R--SAQPNGTFIEYLKKEYGIKSILNLR---------GKLPESWHKEEE 91
           H V    +   R  +AQ     I    + + IK+I+NL+         G L ES    + 
Sbjct: 72  HWVTDDVLAMARPNTAQIIKKDIIAQFQGWNIKTIINLQTPGEHASCGGPLEESGFTYDP 131

Query: 92  KAANDLGIQLINFPLSATRELNDEQIKQLISI--LKTAPKPLLIHCKSGADRTGLASAVY 149
                  I   NF L         ++  ++ +         + IHC +G  RTG+  A Y
Sbjct: 132 NIFMKNDIYYYNFALKDYGSATVGKLLDMVKVVAFAVQEGRVAIHCHAGLGRTGVLIACY 191

Query: 150 LYIVAHYPKEEAHRQLSMLY 169
           L         +A R + M  
Sbjct: 192 LIYSLRVRANDAIRFVRMKR 211


>gi|120435701|ref|YP_861387.1| hypothetical protein GFO_1346 [Gramella forsetii KT0803]
 gi|117577851|emb|CAL66320.1| conserved hypothetical protein [Gramella forsetii KT0803]
          Length = 148

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 50/106 (47%), Gaps = 4/106 (3%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPES--WHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118
                   + G KS++NL+    E     ++E++ A  L ++  +  + +   L++  + 
Sbjct: 21  ENSFKTFADKGFKSVINLQTDEEEQNVSQEKEKELAKKLNLEYKHIGI-SKDNLSEAIVN 79

Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                L++ PKP+L+HCKSG  R+G    +++        EE  +Q
Sbjct: 80  NFRQELESLPKPILVHCKSGK-RSGAFVMMHIGCQKDMSGEEVIKQ 124


>gi|313667888|ref|YP_004048172.1| hypothetical protein NLA_5440 [Neisseria lactamica ST-640]
 gi|313005350|emb|CBN86783.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 144

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 7   DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFSQIKQWLEQAGVTGFHHQ 65

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 66  PVTARDIQKHDVEAFQQLIGQAEYPVLAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 121


>gi|297181326|gb|ADI17517.1| predicted protein-tyrosine phosphatase [uncultured bacterium
           HF0130_06E03]
          Length = 158

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 47/137 (34%), Gaps = 19/137 (13%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIE---------YLKKEYGIKSILNLRGKLPESWHKEEEK 92
            NF  ++  ++  S    G                +E G+++I+ L     +     E  
Sbjct: 3   PNFGWIMEKKLAGSGDVAGWQSGNTSIVRQNLAWLEEQGLRAIVTLTESSLDGSVLNEFD 62

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLASAVY 149
                 I   + P++         I + ++         KP+L+HC +G  RTG   + +
Sbjct: 63  ------IVYKHMPITDMSAPQLSSINEFVAFSGDCIERNKPVLVHCSAGLGRTGTMLSCF 116

Query: 150 LYIVAHYPKEEAHRQLS 166
           L         +A  ++ 
Sbjct: 117 LVNT-GMDPLDAITKVR 132


>gi|304386789|ref|ZP_07369056.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|304339139|gb|EFM05226.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
          Length = 155

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 20  DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 78

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 79  PVTARDIQKHDVETFRQLIGQAEYPVLGYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 134


>gi|260826129|ref|XP_002608018.1| hypothetical protein BRAFLDRAFT_58222 [Branchiostoma floridae]
 gi|229293368|gb|EEN64028.1| hypothetical protein BRAFLDRAFT_58222 [Branchiostoma floridae]
          Length = 183

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 24/177 (13%), Positives = 61/177 (34%), Gaps = 9/177 (5%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                  ++ +  +T   +       +   +   A P  +    L ++ G+K ++ +   
Sbjct: 10  FYPTLLYNVVMEKVTSRRWYDR----IDRTVLLGALPFRSMTPMLVQQEGVKGVVTMNED 65

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIK-QLISILKTAPKP--LLIHCKS 137
                     +  +  G++ +       T     E +K  ++ +L+   +   + +HCK+
Sbjct: 66  FELKRFTNSMEEWSRAGVEQLRLTTIDLTGVPTHEHLKLGVMFLLRHREQGNTVYVHCKA 125

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNN 194
           G  R+    A YL  +  +   EAH  +     H  + +   +    +  T  +   
Sbjct: 126 GRRRSATMVACYLMQLHGWTPAEAHLYIKDKRPHITLAR-GQLQALDKYYTTEHIEE 181


>gi|21592631|gb|AAM64580.1| unknown [Arabidopsis thaliana]
          Length = 282

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 51/148 (34%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWH--- 87
            Y   +         ++  E+   +QP     I++LK+E  +  ILNL+      +    
Sbjct: 84  EYHHDLGMNYT----LIRDELIVGSQPQKPEDIDHLKQEQNVAYILNLQQDKDIEYWGID 139

Query: 88  -KEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
                +   +LGI+ +  P      L+      + +  L   +      + +HC +G  R
Sbjct: 140 LDSIVRRCKELGIRHMRRPAKDFDPLSLRSQLPKAVSSLEWAVSEGKGRVYVHCSAGLGR 199

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               S  Y+Y         A+  L    
Sbjct: 200 APGVSIAYMYWFCDMNLNTAYDTLVSKR 227


>gi|194099153|ref|YP_002002238.1| hypothetical protein NGK_1613 [Neisseria gonorrhoeae NCCP11945]
 gi|239999450|ref|ZP_04719374.1| hypothetical protein Ngon3_08191 [Neisseria gonorrhoeae 35/02]
 gi|240014625|ref|ZP_04721538.1| hypothetical protein NgonD_08263 [Neisseria gonorrhoeae DGI18]
 gi|240017071|ref|ZP_04723611.1| hypothetical protein NgonFA_07871 [Neisseria gonorrhoeae FA6140]
 gi|240081293|ref|ZP_04725836.1| hypothetical protein NgonF_08300 [Neisseria gonorrhoeae FA19]
 gi|240113501|ref|ZP_04727991.1| hypothetical protein NgonM_08034 [Neisseria gonorrhoeae MS11]
 gi|240116148|ref|ZP_04730210.1| hypothetical protein NgonPID1_07880 [Neisseria gonorrhoeae PID18]
 gi|240118431|ref|ZP_04732493.1| hypothetical protein NgonPID_08208 [Neisseria gonorrhoeae PID1]
 gi|240121149|ref|ZP_04734111.1| hypothetical protein NgonPI_05139 [Neisseria gonorrhoeae PID24-1]
 gi|240123975|ref|ZP_04736931.1| hypothetical protein NgonP_08553 [Neisseria gonorrhoeae PID332]
 gi|240126177|ref|ZP_04739063.1| hypothetical protein NgonSK_08178 [Neisseria gonorrhoeae SK-92-679]
 gi|240128654|ref|ZP_04741315.1| hypothetical protein NgonS_08503 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494165|ref|ZP_05107336.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260440041|ref|ZP_05793857.1| hypothetical protein NgonDG_02965 [Neisseria gonorrhoeae DGI2]
 gi|268595268|ref|ZP_06129435.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268597399|ref|ZP_06131566.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599569|ref|ZP_06133736.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601813|ref|ZP_06135980.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268604145|ref|ZP_06138312.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268682603|ref|ZP_06149465.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684763|ref|ZP_06151625.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268687043|ref|ZP_06153905.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043327|ref|ZP_06569050.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|193934443|gb|ACF30267.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|226513205|gb|EEH62550.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548657|gb|EEZ44075.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268551187|gb|EEZ46206.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583700|gb|EEZ48376.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585944|gb|EEZ50620.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268588276|gb|EEZ52952.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622887|gb|EEZ55287.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268625047|gb|EEZ57447.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268627327|gb|EEZ59727.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012933|gb|EFE04916.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|317164698|gb|ADV08239.1| hypothetical protein NGTW08_1272 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 155

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 20  DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 78

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 79  PVTARDIQKHDVETFRQLIGQAEYPVLAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 134


>gi|325918190|ref|ZP_08180339.1| hypothetical protein XVE_4365 [Xanthomonas vesicatoria ATCC 35937]
 gi|325535597|gb|EGD07444.1| hypothetical protein XVE_4365 [Xanthomonas vesicatoria ATCC 35937]
          Length = 165

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 47/115 (40%), Gaps = 5/115 (4%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSAT 109
             +  S QP    +     + G+ ++++LRG      +  E  A   LG++ +  P+   
Sbjct: 30  GNLSSSGQPTQADLRAAAAK-GVTTVIDLRGPEEPRGYD-EIAATEALGLRYVRLPVRNA 87

Query: 110 RELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
             L  E  + L   L       +L+HC +G +R G   A+ L        E+A +
Sbjct: 88  DALTPEAARVLQRALDQQQHGAVLLHCATG-NRAGALLAL-LAAREGASTEQALQ 140


>gi|87311119|ref|ZP_01093243.1| hypothetical protein DSM3645_18906 [Blastopirellula marina DSM
           3645]
 gi|87286210|gb|EAQ78120.1| hypothetical protein DSM3645_18906 [Blastopirellula marina DSM
           3645]
          Length = 295

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 47/125 (37%), Gaps = 8/125 (6%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            N   V P  ++  +QP+G        + G++ I+++ G  P      E  AA   G++ 
Sbjct: 34  HNLFQVTP-RVWSGSQPHGVAGFESLAKLGVQVIVSVDGAKP------EIAAAKKQGLKY 86

Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           I+ P        D Q + L  ++K  P  +  HC  G  R     A+           +A
Sbjct: 87  IHIPFGYDGVPGDAQAQ-LAEVMKQYPGQIYFHCHHGKHRGPAGVAIACLAEGSLNTAQA 145

Query: 162 HRQLS 166
              + 
Sbjct: 146 EAFMH 150


>gi|261335277|emb|CBH18271.1| tyrosine phosphatase, putative [Trypanosoma brucei gambiense
           DAL972]
          Length = 818

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/236 (11%), Positives = 59/236 (25%), Gaps = 64/236 (27%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP-------NGT 61
             L      + LG        L  Y         +   ++P  +   + P       +  
Sbjct: 285 DILGGLQRAVELGWYDPNTFDLQEYD---RLRIYDCCWIIPKALLTFSSPVSGDPNRDPV 341

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
               L +E  +  ++ L     E  +     A    GIQ  +         ND  I + +
Sbjct: 342 MYAKLFQELRVAGVVRLN----EPLYD--RHAFLSRGIQHEDLEFPDGTAPNDAIINRFM 395

Query: 122 SIL-----------------------------------------------KTAPKPLLIH 134
            ++                                                +    + +H
Sbjct: 396 EVVDPILSVQPPATHSDARKRATKERETSDSVDLHPKGREDVRFRGRLKSDSRGGAVAVH 455

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQ 189
           C +G  RTG  +  Y+     +    A     +   G     + + ++    ++ +
Sbjct: 456 CHAGLGRTGTIACTYIIRRYGFTARGAVGWTRLCRPGSVMGAQHMFLEKFERRLLR 511


>gi|74025478|ref|XP_829305.1| tyrosine phosphatase [Trypanosoma brucei TREU927]
 gi|70834691|gb|EAN80193.1| tyrosine phosphatase, putative [Trypanosoma brucei]
          Length = 818

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/236 (11%), Positives = 59/236 (25%), Gaps = 64/236 (27%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQP-------NGT 61
             L      + LG        L  Y         +   ++P  +   + P       +  
Sbjct: 285 DILGGLQRAVELGWYDPNTFDLQEYD---RLRIYDCCWIIPKALLTFSSPVSGDPNRDPV 341

Query: 62  FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121
               L +E  +  ++ L     E  +     A    GIQ  +         ND  I + +
Sbjct: 342 MYAKLFQELRVAGVVRLN----EPLYD--RHAFLSRGIQHEDLEFPDGTAPNDAIINRFM 395

Query: 122 SIL-----------------------------------------------KTAPKPLLIH 134
            ++                                                +    + +H
Sbjct: 396 EVVDPILSVQPPATHSDARKRATKERETSDSVDLHPKGREDVRFRGRLKSDSRGGAVAVH 455

Query: 135 CKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPVLKTITMDITFEKITQ 189
           C +G  RTG  +  Y+     +    A     +   G     + + ++    ++ +
Sbjct: 456 CHAGLGRTGTIACTYIIRRYGFTARGAVGWTRLCRPGSVMGAQHMFLEKFERRLLR 511


>gi|73983300|ref|XP_540742.2| PREDICTED: similar to PTEN-like phosphatase [Canis familiaris]
          Length = 275

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 28/190 (14%), Positives = 67/190 (35%), Gaps = 15/190 (7%)

Query: 11  LLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEY 70
            ++FY  +L  +                 +    H + P  +   A P       L ++ 
Sbjct: 87  RVLFYPTLLYTLFRGKVPGRA-----HRDWY---HRIDPTVLL-GALPLRNMTRRLVQDE 137

Query: 71  GIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIK---QLISILKT 126
            ++ ++ +  +    +     K    +G++ +       T       ++   Q     ++
Sbjct: 138 NVRGVITMNEEYETRFLCNSSKEWKKVGVEQLRLSTVDMTGVPTLANLQKGVQFALKYQS 197

Query: 127 APKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM--LYGHFPVLKTITMDITF 184
             + + +HCK+G  R+    A YL  V ++  EEA R ++    + H    +   +    
Sbjct: 198 LGQSVYVHCKAGRSRSATMVAAYLIQVYNWSPEEAVRAITKIRSHIHIRSGQLEVLKEFH 257

Query: 185 EKITQLYPNN 194
           ++IT     +
Sbjct: 258 KEITAGAAKD 267


>gi|242082782|ref|XP_002441816.1| hypothetical protein SORBIDRAFT_08g002770 [Sorghum bicolor]
 gi|241942509|gb|EES15654.1| hypothetical protein SORBIDRAFT_08g002770 [Sorghum bicolor]
          Length = 280

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 52/145 (35%), Gaps = 14/145 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWH--- 87
            Y   +        AV+   +   +QP     I++LK E  +  IL L+      +    
Sbjct: 82  EYHHDLGMNY----AVISESLIVGSQPQKPEDIDHLKDEERVAYILCLQQDKDIEYWGID 137

Query: 88  -KEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +       +LGIQ I  P       +      + +  L   +      + IHC +G  R
Sbjct: 138 FQSILNRCKELGIQHIRKPAVDFDPDSLRSQLPKAVSALEWAISQRKGRVYIHCTAGLGR 197

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLS 166
               +  Y++   +     A+++L+
Sbjct: 198 APAVAIAYMFWFENMDLNTAYKKLT 222


>gi|59801724|ref|YP_208436.1| hypothetical protein NGO1376 [Neisseria gonorrhoeae FA 1090]
 gi|293398638|ref|ZP_06642816.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|59718619|gb|AAW90024.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|291611109|gb|EFF40206.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
          Length = 155

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 20  DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 78

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 79  PVTARDIQKHDVETFRQLIGQAEYPILAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 134


>gi|255010250|ref|ZP_05282376.1| hypothetical protein Bfra3_14012 [Bacteroides fragilis 3_1_12]
 gi|313148045|ref|ZP_07810238.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313136812|gb|EFR54172.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 351

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 57/160 (35%), Gaps = 29/160 (18%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKK--EYGIKSILNLRGKLPESWHKEEEKAANDLGI---- 99
            V   ++YRSAQ +       +K    GIK+IL+LR +         +K  N + I    
Sbjct: 129 HVRWGKLYRSAQIDSLNCFAFRKLQNLGIKTILDLRSESELHNTPPLQKGFNVVHIPIST 188

Query: 100 ------------------QLINFPLSATREL----NDEQIKQLISILKTAPKPLLIHCKS 137
                              + +      REL      E  +    +L     P++IHC S
Sbjct: 189 GDMEHILHGIQQEKIKTDTIYHMVEGMNRELVVKYQKEYKEIFDILLDKNSYPVVIHCSS 248

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           G  RTG+ SA+ L        +       +   +F + K 
Sbjct: 249 GKGRTGIVSALILAA-LDVNADIIMEDYRLSNDYFNIPKA 287


>gi|195331397|ref|XP_002032389.1| GM26529 [Drosophila sechellia]
 gi|194121332|gb|EDW43375.1| GM26529 [Drosophila sechellia]
          Length = 200

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 62/199 (31%), Gaps = 28/199 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDEHVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +      +    LGI+ +    +      N E++ + +  +              
Sbjct: 67  EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A   +     H  +      
Sbjct: 127 SSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNRWTPDQAVDHMRKCRPHILLHT---- 182

Query: 181 DITFEKITQLYPNNVSKGD 199
              ++ +   Y NNV    
Sbjct: 183 -KQWDALRLFYTNNVETKS 200


>gi|148224884|ref|NP_783859.1| protein-tyrosine phosphatase mitochondrial 1 isoform 1 [Homo
           sapiens]
 gi|73621420|sp|Q8WUK0|PTPM1_HUMAN RecName: Full=Protein-tyrosine phosphatase mitochondrial 1;
           AltName: Full=PTEN-like phosphatase; AltName:
           Full=Phosphoinositide lipid phosphatase; Flags:
           Precursor
 gi|18044254|gb|AAH20242.1| PTPMT1 protein [Homo sapiens]
 gi|119588311|gb|EAW67905.1| hCG25195, isoform CRA_b [Homo sapiens]
 gi|190689353|gb|ACE86451.1| protein tyrosine phosphatase, mitochondrial 1 protein [synthetic
           construct]
 gi|190690705|gb|ACE87127.1| protein tyrosine phosphatase, mitochondrial 1 protein [synthetic
           construct]
 gi|312151764|gb|ADQ32394.1| protein tyrosine phosphatase, mitochondrial 1 [synthetic construct]
          Length = 201

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 61/157 (38%), Gaps = 7/157 (4%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           +H + P  +   A P  +    L ++  ++ ++ +  +    +     +    LG++ + 
Sbjct: 38  YHRIDPTVLL-GALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLR 96

Query: 104 FPLSA-TRELNDEQIK---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 T     + ++   Q     ++  + + +HCK+G  R+    A YL  V  +  E
Sbjct: 97  LSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPE 156

Query: 160 EAHRQLSM--LYGHFPVLKTITMDITFEKITQLYPNN 194
           EA R ++    Y H    +   +    ++IT     +
Sbjct: 157 EAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKD 193


>gi|17542340|ref|NP_501178.1| hypothetical protein T12B3.1 [Caenorhabditis elegans]
 gi|4262617|gb|AAD14737.1| Hypothetical protein T12B3.1 [Caenorhabditis elegans]
          Length = 446

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 46/128 (35%), Gaps = 11/128 (8%)

Query: 63  IEYLKKEYGIKSILNLRGKLPESW---------HKEEEKAANDLGIQLINFPLSATRELN 113
           I    K  GI+S++NL+     S+            + +     GI   NFPL   +   
Sbjct: 94  IVEKFKTNGIQSVINLQESGEHSFCGSGNLTSGFSYDPENLMRNGIYHYNFPLPDFQACT 153

Query: 114 DEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGH 171
             ++  ++ ++  A     + +HC +G  RTG+  A ++         +A   +      
Sbjct: 154 PNRLLDIVKVVDFALSHGKIAVHCHAGHGRTGMVIAAWMMYALGMSPSQAVDTVRSRRAK 213

Query: 172 FPVLKTIT 179
               K   
Sbjct: 214 AVQSKEQV 221


>gi|320354141|ref|YP_004195480.1| dual specificity protein phosphatase [Desulfobulbus propionicus DSM
           2032]
 gi|320122643|gb|ADW18189.1| dual specificity protein phosphatase [Desulfobulbus propionicus DSM
           2032]
          Length = 347

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 59/150 (39%), Gaps = 13/150 (8%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
            + + PH +     P         +  GI++I+NL G+       +  +   + G ++  
Sbjct: 4   LNWITPH-LATGHAPMSYEDLDAIRAQGIRAIVNLCGE-----FCDLHQIEENSGFEVRY 57

Query: 104 FPLSATRELNDEQIKQLISILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            P+      + E ++Q++  +  A    K +L+HC+ G  RTG   A YL +   +  + 
Sbjct: 58  LPVVDECAPDLEAMEQVLDWMDEAIYLDKKVLVHCRMGHGRTGTFIAAYL-LRRGFDYKR 116

Query: 161 AHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           A + +    G      T       ++  + 
Sbjct: 117 AEQTMK---GKSANPATFAQRRFLKQYGKQ 143


>gi|313230314|emb|CBY08018.1| unnamed protein product [Oikopleura dioica]
          Length = 365

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 57/162 (35%), Gaps = 16/162 (9%)

Query: 45  HAVVPHEIYRSAQPNGTFIE---YLKKEYGIKSILNLRGKLPESW---------HKEEEK 92
             V   ++   A+P+  F        K  GI+SI+NL+                     +
Sbjct: 50  SWVWEKKLLAIARPSDEFFPDNVKYFKRDGIRSIVNLQEPGEHEHCGQVLQDSGFTYSPE 109

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYL 150
                 I   ++P       + +Q+  +  ++  A       +HC +G  RTG+  A +L
Sbjct: 110 RLMAEKISFYSYPTKDYGIYSVDQMFDICKVISFAISEGACAVHCHAGLGRTGVVCAAWL 169

Query: 151 YIVAHYPKEEAHRQLSM-LYGHF-PVLKTITMDITFEKITQL 190
                +   EA  Q+     G      +  ++   FE + QL
Sbjct: 170 IFEMGFTDIEAFNQVRATRPGSIQSRPQIASVSNFFEVLKQL 211


>gi|297688777|ref|XP_002821851.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like
           isoform 1 [Pongo abelii]
          Length = 201

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 61/157 (38%), Gaps = 7/157 (4%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           +H + P  +   A P  +    L ++  ++ ++ +  +    +     +    LG++ + 
Sbjct: 38  YHRIDPTVLL-GALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLR 96

Query: 104 FPLSA-TRELNDEQIK---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 T     + ++   Q     ++  + + +HCK+G  R+    A YL  V  +  E
Sbjct: 97  LSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPE 156

Query: 160 EAHRQLSM--LYGHFPVLKTITMDITFEKITQLYPNN 194
           EA R ++    Y H    +   +    ++IT     +
Sbjct: 157 EAVRAIAKIRSYIHIKPGQLDVLKEFHKQITAGAAKD 193


>gi|24374642|ref|NP_718685.1| tyrosine-specific protein phosphatase, putative [Shewanella
           oneidensis MR-1]
 gi|24349272|gb|AAN56129.1|AE015749_6 tyrosine-specific protein phosphatase, putative [Shewanella
           oneidensis MR-1]
          Length = 156

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 56/160 (35%), Gaps = 20/160 (12%)

Query: 43  NFHAVVPHEIYRSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           +   +V  +I   + P  +   +    K  GI+++L++ G         E  +    G++
Sbjct: 3   HLFWLVEGKIAGRSGPNKDPWDLAE-LKAAGIRAVLSVNGGEGC-----EPGSFQHHGLR 56

Query: 101 LINFPLSATRELND----------EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150
               P S      D           +    I   +    P+L+HC+SG DRTGL  A YL
Sbjct: 57  YECIPFSRNVPPQDGDIAVCVAQLPKALAFIQQCEADNLPVLVHCRSGKDRTGLIMAYYL 116

Query: 151 YIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
             V       A  Q+  +               F+ +  L
Sbjct: 117 M-VNGAAPLHAVSQVRSIRD-IAFSAEGWDQFAFDVLYAL 154


>gi|332836319|ref|XP_003313059.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like [Pan
           troglodytes]
          Length = 201

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 61/157 (38%), Gaps = 7/157 (4%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           +H + P  +   A P  +    L ++  ++ ++ +  +    +     +    LG++ + 
Sbjct: 38  YHRIDPTVLL-GALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLR 96

Query: 104 FPLSA-TRELNDEQIK---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 T     + ++   Q     ++  + + +HCK+G  R+    A YL  V  +  E
Sbjct: 97  LSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPE 156

Query: 160 EAHRQLSM--LYGHFPVLKTITMDITFEKITQLYPNN 194
           EA R ++    Y H    +   +    ++IT     +
Sbjct: 157 EAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKD 193


>gi|15677573|ref|NP_274730.1| hypothetical protein NMB1727 [Neisseria meningitidis MC58]
 gi|254805475|ref|YP_003083696.1| hypothetical protein NMO_1543 [Neisseria meningitidis alpha14]
 gi|7226982|gb|AAF42072.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|254669017|emb|CBA07422.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
 gi|254671790|emb|CBA03855.1| hypothetical protein NMW_0004 [Neisseria meningitidis alpha275]
 gi|261392053|emb|CAX49545.1| conserved hypothetical protein [Neisseria meningitidis 8013]
 gi|308389845|gb|ADO32165.1| hypothetical protein NMBB_1979 [Neisseria meningitidis alpha710]
 gi|325132786|gb|EGC55466.1| hypothetical protein TIGR01244 [Neisseria meningitidis M6190]
 gi|325134742|gb|EGC57379.1| hypothetical protein TIGR01244 [Neisseria meningitidis M13399]
 gi|325136631|gb|EGC59231.1| hypothetical protein TIGR01244 [Neisseria meningitidis M0579]
 gi|325138689|gb|EGC61241.1| hypothetical protein TIGR01244 [Neisseria meningitidis ES14902]
 gi|325140814|gb|EGC63324.1| hypothetical protein TIGR01244 [Neisseria meningitidis CU385]
 gi|325145085|gb|EGC67368.1| hypothetical protein TIGR01244 [Neisseria meningitidis M01-240013]
 gi|325198818|gb|ADY94274.1| conserved hypothetical protein TIGR01244 [Neisseria meningitidis
           G2136]
 gi|325199684|gb|ADY95139.1| conserved hypothetical protein TIGR01244 [Neisseria meningitidis
           H44/76]
 gi|325201623|gb|ADY97077.1| conserved hypothetical protein TIGR01244 [Neisseria meningitidis
           M01-240149]
 gi|325204682|gb|ADZ00136.1| conserved hypothetical protein TIGR01244 [Neisseria meningitidis
           M01-240355]
 gi|325205563|gb|ADZ01016.1| conserved hypothetical protein TIGR01244 [Neisseria meningitidis
           M04-240196]
 gi|325208642|gb|ADZ04094.1| conserved hypothetical protein TIGR01244 [Neisseria meningitidis
           NZ-05/33]
          Length = 142

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 7   DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 65

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 66  PVTARDIQKHDVETFRQLIGQAEYPVLAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 121


>gi|327542372|gb|EGF28856.1| Beta-lactamase hydrolase-like protein [Rhodopirellula baltica WH47]
          Length = 153

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 57/113 (50%), Gaps = 6/113 (5%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLR--GKLPES-WHKEEEKAANDLGIQLINFPLSATRE 111
             QP+   ++ L  + G +S++N R  G+  +    +EE +A    G++ ++ P+ +   
Sbjct: 14  GPQPSQDELKSLPDD-GFRSVINFRTAGEDEQPLSPEEEGEAVRATGLKYLHVPV-SMDG 71

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++++++ Q     ++ PKP+  HCKSG  R G    ++  +      ++A  Q
Sbjct: 72  MDEKKVDQFREQYQSLPKPVFAHCKSGK-RAGAMMMMHTAVEQGISGDQALEQ 123


>gi|146096219|ref|XP_001467737.1| phosphatase [Leishmania infantum JPCM5]
 gi|134072103|emb|CAM70802.1| putative phosphatase [Leishmania infantum JPCM5]
          Length = 604

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 48/142 (33%), Gaps = 21/142 (14%)

Query: 45  HAVVPHEIYRSAQPNGTFI-----EYLKKEYGIKSILNLRGKLPES------------WH 87
           + V  +++  S +P+ +               +  +LNL+ K                + 
Sbjct: 89  NWVG-NDVIASQRPSTSLFLKYPIIAQFHAKNVTGVLNLQEKGEHGNCGPDGIYESSGYS 147

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGL 144
               +     GI    FP         + + + + ++         +L+HC +G  RTGL
Sbjct: 148 YNGAEDLMPHGISYYEFPWPDMTAPQQDIVLRSVQVMDYHIKQKGKVLVHCHAGLGRTGL 207

Query: 145 ASAVYLYIVAHYPKEEAHRQLS 166
             A Y     H P +EA   + 
Sbjct: 208 MIACYYVYSQHIPSDEAIALVR 229


>gi|90109268|pdb|2F46|A Chain A, Crystal Structure Of A Putative Phosphatase (Nma1982) From
           Neisseria Meningitidis Z2491 At 1.41 A Resolution
 gi|90109269|pdb|2F46|B Chain B, Crystal Structure Of A Putative Phosphatase (Nma1982) From
           Neisseria Meningitidis Z2491 At 1.41 A Resolution
          Length = 156

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+I+  R    E       + ++     G+   +  
Sbjct: 21  DEHLYISPQLTKAD-AEQIAQLGIKTIICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 79

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 80  PVTARDIQKHDVETFRQLIGQAEYPVLAYCRTGT-RCSLLWG-FRRAAEGXPVDEIIR 135


>gi|149177621|ref|ZP_01856223.1| hypothetical protein PM8797T_00402 [Planctomyces maris DSM 8797]
 gi|148843601|gb|EDL57962.1| hypothetical protein PM8797T_00402 [Planctomyces maris DSM 8797]
          Length = 304

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 50/119 (42%), Gaps = 7/119 (5%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +  + Y  + P+G       K+ GIK+I+++ G  P+  H      A   G++ I+ P+ 
Sbjct: 54  IDRQFYSGSGPHGEQSFQELKKLGIKTIVSVDGTTPDLVH------ARKAGMKYIHIPIG 107

Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166
                +++       + +    P+ IHC  G  R   A+AV         +  A + L+
Sbjct: 108 YDGV-SEDAGLAFARVARDLNGPVYIHCHHGKHRGPTAAAVVGLCRGSLDQNSALQFLT 165


>gi|18399058|ref|NP_566383.1| protein phosphatase-related [Arabidopsis thaliana]
 gi|6016700|gb|AAF01527.1|AC009991_23 unknown protein [Arabidopsis thaliana]
 gi|87116654|gb|ABD19691.1| At3g10940 [Arabidopsis thaliana]
 gi|110740568|dbj|BAE98389.1| hypothetical protein [Arabidopsis thaliana]
 gi|332641459|gb|AEE74980.1| dual-specificity protein-like phosphatase 3 [Arabidopsis thaliana]
          Length = 282

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 51/148 (34%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWH--- 87
            Y   +         ++  E+   +QP     I++LK+E  +  ILNL+      +    
Sbjct: 84  EYHHDLGMNYT----LIRDELIVGSQPQKPEDIDHLKQEQNVAYILNLQQDKDIEYWGID 139

Query: 88  -KEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
                +   +LGI+ +  P      L+      + +  L   +      + +HC +G  R
Sbjct: 140 LDSIVRRCKELGIRHMRRPAKDFDPLSLRSQLPKAVSSLEWAVSEGKGRVYVHCSAGLGR 199

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               S  Y+Y         A+  L    
Sbjct: 200 APGVSIAYMYWFCDMNLNTAYDTLVSKR 227


>gi|32476832|ref|NP_869826.1| hypothetical protein RB11176 [Rhodopirellula baltica SH 1]
 gi|32447378|emb|CAD77204.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 153

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 57/113 (50%), Gaps = 6/113 (5%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLR--GKLPES-WHKEEEKAANDLGIQLINFPLSATRE 111
             QP+   ++ L  + G +S++N R  G+  +    +EE +A    G++ ++ P+ +   
Sbjct: 14  GPQPSQDELKSLPDD-GFRSVINFRTAGEDEQPLSPEEEGEAVRATGLKYLHVPV-SMDG 71

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++++++ Q     ++ PKP+  HCKSG  R G    ++  +      ++A  Q
Sbjct: 72  MDEKKVDQFREQYQSLPKPVFAHCKSGK-RAGAMMMMHTAVEQGLSGDQALEQ 123


>gi|119873093|ref|YP_931100.1| dual specificity protein phosphatase [Pyrobaculum islandicum DSM
           4184]
 gi|119674501|gb|ABL88757.1| dual specificity protein phosphatase [Pyrobaculum islandicum DSM
           4184]
          Length = 165

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 49/124 (39%), Gaps = 7/124 (5%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-----KEEEKAANDLGI 99
           + V P ++  S  P    IE      G+K++++L       ++      E  K   + G+
Sbjct: 13  YWVEP-KLAGSCMPRQEDIERW-ASLGVKTVISLTESWEIEYYGRWSLPEFRKTLAEKGV 70

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           + I++P        D      +   +     +++HC  G  RT  A A YL +      +
Sbjct: 71  KWIHWPTPDGYPPRDLDELVEVIETEIKRGSVVVHCVGGMGRTPTALAAYLIVKRCMKAD 130

Query: 160 EAHR 163
           +A R
Sbjct: 131 DAIR 134


>gi|117919871|ref|YP_869063.1| Dual specificity protein phosphatase [Shewanella sp. ANA-3]
 gi|117612203|gb|ABK47657.1| dual specificity protein phosphatase [Shewanella sp. ANA-3]
          Length = 156

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/161 (20%), Positives = 56/161 (34%), Gaps = 22/161 (13%)

Query: 43  NFHAVVPHEIYRSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           +   +V  +I   + P  +   +    K  GI+++L++ G         E  +    G++
Sbjct: 3   HLFWLVEGKIAGRSGPNKDPWDLAE-LKSLGIRAVLSVNGGEGC-----EPGSFKHHGLR 56

Query: 101 LINFPLSATRELNDE-----------QIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
               P  +      E           +    I   +    P+LIHC+SG DRTGL  A Y
Sbjct: 57  YECIPF-SRNVPPQEGDVAICVAQLPRALAFIQQCEADNLPVLIHCRSGKDRTGLIMAYY 115

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           L  V       A  Q+  +               F+ +  L
Sbjct: 116 LM-VNGAAPLHAVSQVRSIRD-IAFTAEGWDQFAFDVLYAL 154


>gi|288960214|ref|YP_003450554.1| hypothetical protein AZL_a04790 [Azospirillum sp. B510]
 gi|288912522|dbj|BAI74010.1| hypothetical protein AZL_a04790 [Azospirillum sp. B510]
          Length = 147

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 6/118 (5%)

Query: 50  HEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPL 106
            ++    QP+G  ++ + K  G++S++NLR            EE + A  LG+  ++ P+
Sbjct: 10  GKLLAGEQPSGDDLD-VLKAQGVRSVVNLREDGERDRPSIPAEEGRQAEALGLSFVHLPV 68

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
               EL+ E ++Q    +   P P+ +HC  G  R    + +          E+A R 
Sbjct: 69  -TVPELSPELVEQFRRTVDALPGPVYVHCGLG-QRAVTLALIVDAQDTGASAEDAIRD 124


>gi|329960669|ref|ZP_08299012.1| tyrosine phosphatase family protein [Bacteroides fluxus YIT 12057]
 gi|328532542|gb|EGF59336.1| tyrosine phosphatase family protein [Bacteroides fluxus YIT 12057]
          Length = 354

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 37/180 (20%), Positives = 59/180 (32%), Gaps = 34/180 (18%)

Query: 46  AVVPHEIYRSAQPNGTFI--EYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI---- 99
            V    +YRSA+ +          K  GIK+I++LR           +K    + I    
Sbjct: 130 EVRWGMLYRSAEIDSLAYCSRRELKNIGIKTIIDLRAGSESQRQDPLQKEFKVIHIPIAT 189

Query: 100 ------------------QLINFPLSATREL----NDEQIKQLISILKTAPKPLLIHCKS 137
                              +        R+L      E  +    +L     P+++HC S
Sbjct: 190 GDMEDILKGIQEQKIKSDTVYRMVEQMNRDLIGNYTKEYRRIFDILLDKNNYPVVVHCSS 249

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQ--LSMLYGHFPVLKTITMD---ITFEKITQLYP 192
           G  RTG+ SA+ L       ++       LS  Y + P            + E IT L+ 
Sbjct: 250 GKGRTGVVSALVLAA-LGVNEDIIMEDYRLSNDYFNIPAASKYAYQLPARSQEAITTLFS 308


>gi|158520282|ref|YP_001528152.1| ADP-ribosylation/crystallin J1 [Desulfococcus oleovorans Hxd3]
 gi|158509108|gb|ABW66075.1| ADP-ribosylation/Crystallin J1 [Desulfococcus oleovorans Hxd3]
          Length = 539

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 51/138 (36%), Gaps = 19/138 (13%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKK------EYGIKSILNLRGKLPES--------WHKEE 90
           + VVP ++     P G   E  +K      ++GI+ +++L     +         +    
Sbjct: 369 YWVVPGKLMAGCYPGGLNKEEARKTLQGLLDHGIRHVVSLMEPDEKDHAGKPFISYEPLM 428

Query: 91  EKAANDLG--IQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGLA 145
           +  A   G  +    FP+       ++++  ++  +     A  P+ +HC  G  RTG  
Sbjct: 429 QSLAIAAGKAVTFARFPIKDQNIPTEDEMVGILDHIGREIDASIPVYVHCWGGKGRTGTV 488

Query: 146 SAVYLYIVAHYPKEEAHR 163
              YL        + A R
Sbjct: 489 VGCYLARHGLASGKSALR 506


>gi|322501718|emb|CBZ36799.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 604

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 48/142 (33%), Gaps = 21/142 (14%)

Query: 45  HAVVPHEIYRSAQPNGTFI-----EYLKKEYGIKSILNLRGKLPES------------WH 87
           + V  +++  S +P+ +               +  +LNL+ K                + 
Sbjct: 89  NWVG-NDVIASQRPSTSLFLKYPIIAQFHAKNVTGVLNLQEKGEHGNCGPDGIYESSGYS 147

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGL 144
               +     GI    FP         + + + + ++         +L+HC +G  RTGL
Sbjct: 148 YNGAEDLMPHGISYYEFPWPDMTAPQQDIVLRSVQVMDYHIKQKGKVLVHCHAGLGRTGL 207

Query: 145 ASAVYLYIVAHYPKEEAHRQLS 166
             A Y     H P +EA   + 
Sbjct: 208 MIACYYVYSQHIPSDEAIALVR 229


>gi|17945211|gb|AAL48664.1| RE13143p [Drosophila melanogaster]
          Length = 200

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 22/199 (11%), Positives = 61/199 (30%), Gaps = 28/199 (14%)

Query: 20  LGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLR 79
           +        ++ +   +   +       +   +   A P  +    L ++  +K+++++ 
Sbjct: 11  VSFYPTLLYNVLMEKASARNWYDR----IDEHVILGALPFRSQANDLIEKENMKAVVSMN 66

Query: 80  GKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK------------- 125
                +      +    LGI+ +    +      N E++ + +  +              
Sbjct: 67  EDYELTAFSNNTEKWRKLGIEFLQLATTDIFESPNQEKLFRGVEFINKFLPLKQRIGGLS 126

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                     + +HCK+G  R+      YL +   +  ++A   +     H  +      
Sbjct: 127 SSYQPENVGSVYVHCKAGRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHILLHT---- 182

Query: 181 DITFEKITQLYPNNVSKGD 199
              +  +   Y NNV    
Sbjct: 183 -KQWGALRLFYTNNVETKS 200


>gi|222616979|gb|EEE53111.1| hypothetical protein OsJ_35888 [Oryza sativa Japonica Group]
          Length = 164

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 48/142 (33%), Gaps = 37/142 (26%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P+     +            LRG                LG++ +
Sbjct: 25  NFGMVDTG-VYRSGFPDPASFGF------------LRG----------------LGLRSV 55

Query: 103 NFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
           +  +       D  +  L  IL     P+LIHCK G  RTG     +  +  ++      
Sbjct: 56  DPNV---SIPVDAIMGALRVILDVRNHPVLIHCKRGKHRTGCLVGCFRKL-QNWC----L 107

Query: 163 RQLSMLYGHFPVLKTITMDITF 184
             +   Y  +   K+   D+ F
Sbjct: 108 SSVFEEYHRYAAGKSRLSDLKF 129


>gi|157873750|ref|XP_001685379.1| phosphatase [Leishmania major strain Friedlin]
 gi|68128451|emb|CAJ08557.1| putative phosphatase [Leishmania major strain Friedlin]
          Length = 605

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 48/142 (33%), Gaps = 21/142 (14%)

Query: 45  HAVVPHEIYRSAQPNGTFI-----EYLKKEYGIKSILNLRGKLPES------------WH 87
           + V  +++  S +P+ +               +  +LNL+ K                + 
Sbjct: 90  NWVG-NDVIASQRPSTSLFLKYPIIAQFHAKNVTGVLNLQEKGEHGNCGPDGIYESSGYS 148

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGL 144
               +     GI    FP         + + + + ++         +L+HC +G  RTGL
Sbjct: 149 YNGAEDLMPHGISYYEFPWPDMTAPQQDIVLRSVQVMDYHIKQKGKVLVHCHAGLGRTGL 208

Query: 145 ASAVYLYIVAHYPKEEAHRQLS 166
             A Y     H P +EA   + 
Sbjct: 209 MIACYYVYSQHIPSDEAIALVR 230


>gi|41053754|ref|NP_957182.1| hypothetical protein LOC393862 [Danio rerio]
 gi|39645513|gb|AAH63976.1| Zgc:77752 [Danio rerio]
          Length = 464

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 54/152 (35%), Gaps = 18/152 (11%)

Query: 45  HAVVPHEIYRSAQPN-----GTFIEYLKKEYGIKSILNLR----------GKLPESWHKE 89
             V    I   A+P+        I    K+  IKSI+N++             P+S    
Sbjct: 59  SWVTDD-ILAMARPSTYLMKRYSIIEQFKQLNIKSIINMQLPGEHAHCGPPLEPDSGFTY 117

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             ++  D  I   NF +S     + E +   + +L  +     + +HC +G  RTG+  A
Sbjct: 118 SPQSFMDNQIFFYNFGMSDFGVSSLEGMLDAVKVLAFSVQEGKVAVHCHAGLGRTGVLIA 177

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTIT 179
            YL         EA   + +        ++  
Sbjct: 178 CYLVYTCRISASEAVHYVRIKRPRSIQTRSQI 209


>gi|332259922|ref|XP_003279033.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like
           [Nomascus leucogenys]
          Length = 201

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 60/151 (39%), Gaps = 7/151 (4%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           +H + P  +   A P  +    L ++  ++ ++ +  +    +     +    LG++ + 
Sbjct: 38  YHRIDPTVLL-GALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLR 96

Query: 104 FPLSA-TRELNDEQIK---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 T     + ++   Q     ++  + + +HCK+G  R+    A YL  V  +  E
Sbjct: 97  LSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPE 156

Query: 160 EAHRQLSM--LYGHFPVLKTITMDITFEKIT 188
           EA R ++    Y H    +   +    ++IT
Sbjct: 157 EAVRAIAKIRSYIHIRPGQLDVLKEFHKQIT 187


>gi|76363768|ref|XP_888595.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|12311810|emb|CAC22628.1| tyrosine phospatase-like protein [Leishmania major strain Friedlin]
          Length = 891

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 47/126 (37%), Gaps = 10/126 (7%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  V    +YR A P         +   ++++++L   +PE    + +  A    IQL +
Sbjct: 404 FARVESG-VYRGAYPVLRNF-PYIRRLRLRTMVSL---IPEPPTYDLKCFAEAEHIQLHH 458

Query: 104 FPLSATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 +     L  E  + L  I+     PL IHC  G   TGL       ++  +   
Sbjct: 459 IHAERAKGEVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALRKLLQ-WDAN 517

Query: 160 EAHRQL 165
            A+ + 
Sbjct: 518 VANAEF 523


>gi|313235034|emb|CBY10693.1| unnamed protein product [Oikopleura dioica]
          Length = 169

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 57/129 (44%), Gaps = 4/129 (3%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +   +   A P  +  + L++   ++ ++++       +    ++   +LG++L++F + 
Sbjct: 13  IDDNLIIGAIPFKSMAQPLQEVENVRGVVSVNEDFERWYTTPSDEEWTELGVELLHFNVG 72

Query: 108 AT-RELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
                   +++KQ ++++           +HCK+G  R+    A YL        EEA +
Sbjct: 73  DYVHTPTVDELKQAVALISKIADLGHTTYVHCKAGRTRSATVCAAYLITKEKISIEEAVK 132

Query: 164 QLSMLYGHF 172
           +++ +  H 
Sbjct: 133 KIADVRHHI 141


>gi|307176882|gb|EFN66223.1| Protein-tyrosine phosphatase mitochondrial 1-like protein
           [Camponotus floridanus]
          Length = 195

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 25/195 (12%), Positives = 63/195 (32%), Gaps = 30/195 (15%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                  ++ +  +T   +       +   +   A P     + L  +  IK+++++   
Sbjct: 7   FYPTLFYNIVMEKITTRNWYDR----IDETVILGALPFRRMTKQLIDDENIKAVVSMNED 62

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK--------------- 125
              S     EK  +   ++ +    +      + E+++  ++ +                
Sbjct: 63  YELSLLSNTEKEWHRHNVEFLQLSTTDIFHAPSQEKLQDGVNFINKFRTAPSRKLGNPPD 122

Query: 126 -----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180
                  P  + +HCK+G  R+      YL I  ++  EEA   +     H  +      
Sbjct: 123 TIKGSNQPGTVYVHCKAGRTRSATLVGCYLIIKNNWSPEEAVNYMRTKRPHILLHTA--- 179

Query: 181 DITFEKITQLYPNNV 195
              +  + Q Y  ++
Sbjct: 180 --QWSALRQFYAEHI 192


>gi|328862362|gb|EGG11463.1| hypothetical protein MELLADRAFT_115262 [Melampsora larici-populina
           98AG31]
          Length = 358

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 59/171 (34%), Gaps = 15/171 (8%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE---EEKAANDLG 98
            NF  +    +YRS +PN            +KS++ L  +   S  +E         DLG
Sbjct: 146 PNFGFIES-WLYRSGEPN-ELSHQFLLSLNLKSLIWLAPRPISSSFRECLSSTVKFYDLG 203

Query: 99  IQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
           I             ++   + L  IL     PL+I C  G+ RTG        +   +  
Sbjct: 204 ILHAAAI---DEVTDEAVTEALRLILSPKLYPLMIMCAGGSHRTGTVIGCLRKL-QGWN- 258

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKI--TQLYPNNVSKGDTEQPMNAT 207
                 +   Y  +   +   M+  F +   T+    N+S+   +   N T
Sbjct: 259 ---LASIFEEYRRYAGAQHHIMNEQFIEFYDTRRLTQNLSQETMKSSRNET 306


>gi|301772550|ref|XP_002921701.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like,
           partial [Ailuropoda melanoleuca]
          Length = 193

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 62/166 (37%), Gaps = 8/166 (4%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           +H + P  +   A P       L ++  ++ ++ +  +    +     K     G++ + 
Sbjct: 30  YHRIDPTVLL-GALPLRGMTRRLVEDENVRGVITMNEEYETRFLCNSAKEWRKAGVEQLR 88

Query: 104 FPLSA-TRELNDEQIK---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 T       ++   Q     +   + + +HCK+G  R+    A YL  V ++  E
Sbjct: 89  LSTVDMTGVPTLANLQKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVYNWSPE 148

Query: 160 EAHRQLSM--LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
           EA R ++    + H    +   +    ++IT     + + G T Q 
Sbjct: 149 EAVRAITKIRSHIHIRSGQLEVLKEFHKEITAGAAKDKT-GHTSQT 193


>gi|281340494|gb|EFB16078.1| hypothetical protein PANDA_010601 [Ailuropoda melanoleuca]
          Length = 189

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 62/166 (37%), Gaps = 8/166 (4%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           +H + P  +   A P       L ++  ++ ++ +  +    +     K     G++ + 
Sbjct: 26  YHRIDPTVLL-GALPLRGMTRRLVEDENVRGVITMNEEYETRFLCNSAKEWRKAGVEQLR 84

Query: 104 FPLSA-TRELNDEQIK---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 T       ++   Q     +   + + +HCK+G  R+    A YL  V ++  E
Sbjct: 85  LSTVDMTGVPTLANLQKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVYNWSPE 144

Query: 160 EAHRQLSM--LYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQP 203
           EA R ++    + H    +   +    ++IT     + + G T Q 
Sbjct: 145 EAVRAITKIRSHIHIRSGQLEVLKEFHKEITAGAAKDKT-GHTSQT 189


>gi|237720586|ref|ZP_04551067.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|260172627|ref|ZP_05759039.1| hypothetical protein BacD2_12241 [Bacteroides sp. D2]
 gi|293373373|ref|ZP_06619729.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|315920917|ref|ZP_07917157.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|229450337|gb|EEO56128.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|292631659|gb|EFF50281.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|313694792|gb|EFS31627.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 355

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 61/177 (34%), Gaps = 35/177 (19%)

Query: 50  HEIYRSAQPN--GTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLGI------- 99
             IYRSAQ +          K  G+++I++LR +    ++ +  +   N + I       
Sbjct: 134 GMIYRSAQIDSIPPCSRRELKNMGVRTIIDLRSENERHNYPQLHDDEFNIIHIPILTGNM 193

Query: 100 ---------------QLINFPLSATREL----NDEQIKQLISILKTAPKPLLIHCKSGAD 140
                           +        REL      E  K    +L     P++IHC SG  
Sbjct: 194 EEILQGIQEEKIKSDTIYRLVEQMNRELVINYQKEFKKLFTVLLDRTHYPVVIHCTSGKG 253

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF-----EKITQLYP 192
           RTG+ SA+ L       ++       +   +F + K             E IT +Y 
Sbjct: 254 RTGVVSALLLAA-LGVNEDVIMEDYRLSNDYFNIPKASQYAYKLSVNSQEAITTIYS 309


>gi|146076423|ref|XP_001462923.1| tyrosine phospatase-like protein [Leishmania infantum]
 gi|134067004|emb|CAM65109.1| tyrosine phospatase-like protein [Leishmania infantum JPCM5]
          Length = 692

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 48/126 (38%), Gaps = 10/126 (7%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  V    +YR A P         +   ++++++L   +PE    + +  A    IQL +
Sbjct: 205 FARVESG-VYRGAYPVLRNF-PYIRRLRLRTMVSL---IPEPPTYDLKCFAEAEHIQLHH 259

Query: 104 FPLSATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 +     L  E  + L  I+     PL IHC  G   TGL       ++  +  +
Sbjct: 260 IHAERAKGEVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALRKLLQ-WDAK 318

Query: 160 EAHRQL 165
            A+ + 
Sbjct: 319 VANAEF 324


>gi|223944219|gb|ACN26193.1| unknown [Zea mays]
          Length = 280

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 50/145 (34%), Gaps = 14/145 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWH--- 87
            Y   +        AV+   +   +QP     I+ LK E  +  IL L+      +    
Sbjct: 82  EYHHDLGMNY----AVISESLIVGSQPQKPEDIDRLKNEERVAYILCLQQDKDIEYWGID 137

Query: 88  -KEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +       +LGIQ I  P       +      + +  L          + +HC +G  R
Sbjct: 138 FQSIVNRCKELGIQHIRRPAVDFDPDSLRSQLPKAVSALEWATSQRKGRVYVHCTAGLGR 197

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLS 166
               +  Y++   +     A+++L+
Sbjct: 198 APAVAIAYMFWFENMDLNTAYQKLT 222


>gi|160882943|ref|ZP_02063946.1| hypothetical protein BACOVA_00905 [Bacteroides ovatus ATCC 8483]
 gi|299146923|ref|ZP_07039990.1| conserved hypothetical protein [Bacteroides sp. 3_1_23]
 gi|156111626|gb|EDO13371.1| hypothetical protein BACOVA_00905 [Bacteroides ovatus ATCC 8483]
 gi|298514808|gb|EFI38690.1| conserved hypothetical protein [Bacteroides sp. 3_1_23]
          Length = 329

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 61/177 (34%), Gaps = 35/177 (19%)

Query: 50  HEIYRSAQPN--GTFIEYLKKEYGIKSILNLRGKLP-ESWHKEEEKAANDLGI------- 99
             IYRSAQ +          K  GI++I++LR +    ++ +  +   N + I       
Sbjct: 108 GMIYRSAQIDSIPPCSRQELKNMGIRTIIDLRSENERHNYPQLHDDEFNIIHIPILTGNM 167

Query: 100 ---------------QLINFPLSATREL----NDEQIKQLISILKTAPKPLLIHCKSGAD 140
                           +        REL      E  K    +L     P++IHC SG  
Sbjct: 168 EEILQGIQEEKIKSDTIYRLVEQMNRELVINYQKEFKKLFTVLLDRTHYPVVIHCTSGKG 227

Query: 141 RTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF-----EKITQLYP 192
           RTG+ SA+ L       ++       +   +F + K             E IT +Y 
Sbjct: 228 RTGVVSALLLAA-LGVNEDVIMEDYRLSNDYFNIPKASQYAYKLSVNSQEAITTIYS 283


>gi|330795815|ref|XP_003285966.1| hypothetical protein DICPUDRAFT_22039 [Dictyostelium purpureum]
 gi|325084055|gb|EGC37492.1| hypothetical protein DICPUDRAFT_22039 [Dictyostelium purpureum]
          Length = 161

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 58/152 (38%), Gaps = 18/152 (11%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  + P ++YR+            K  G+K+++ L  ++P    K       +  I LI+
Sbjct: 5   FGTIEP-QLYRTNSLYPANF-PFIKLLGLKTVVQLSPEVP---IKAVSSFFQENNINLIH 59

Query: 104 FPLSATREL-------NDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY 156
             L + +         ++   + L  +L     PL+I C SG  +TG+       +  ++
Sbjct: 60  LGLKSWKVDSNWKPLTDELIKECLEIVLNYDYYPLMITCTSGVHQTGVLVGCLRRL-QNW 118

Query: 157 PKEEAHRQLSMLYGHFP-VLKTITMDITFEKI 187
                   + + Y  F     T  ++  F ++
Sbjct: 119 N----LTSILVEYKAFSGQSNTRYVNEQFIEL 146


>gi|50085130|ref|YP_046640.1| hypothetical protein ACIAD1995 [Acinetobacter sp. ADP1]
 gi|49531106|emb|CAG68818.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 182

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/161 (14%), Positives = 53/161 (32%), Gaps = 9/161 (5%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +   ++ S QP+   ++   K YG  +++NL     +   + E++   +LG+  I+ P+ 
Sbjct: 25  IHDHLFTSGQPSAEDLQN-IKAYGFSTVINLALSDADPHLEHEDRICLELGLNYIHLPIL 83

Query: 108 ATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
                  EQ   ++ ++        + +HC     R      +Y           A   L
Sbjct: 84  -WEMPTAEQCILVLDLIDHLVQTDMVWVHCAKNF-RVSSLMYLYHQYYMGMDIGTAQELL 141

Query: 166 SMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNA 206
                           I      QL     ++   +  ++ 
Sbjct: 142 HQ----IWEPNETWTGIIHSVALQLQGRKATQEIEQSLIHP 178


>gi|328769227|gb|EGF79271.1| hypothetical protein BATDEDRAFT_6727 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 154

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 57/159 (35%), Gaps = 14/159 (8%)

Query: 38  TTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKE--EEKAAN 95
                + + +V  ++YRS+          +    +K+IL+L  + P        E+    
Sbjct: 1   QVVFPDVYGIVEKKVYRSSSLQPASYPLFRH---VKTILSLSPEAPTKSLLNWIEDNRMT 57

Query: 96  DLGIQLINF---PLSATRELNDE-QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
            + +          ++ R +++E   + L  IL     PLLI C SG   TG        
Sbjct: 58  LIHLGYQQLIKPNTNSWRPVSEEMIKEGLELILNADKHPLLIMCTSGVQETGALVGCLRK 117

Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           +   +       +    Y  F   K+  ++  F ++  L
Sbjct: 118 L-QGWNFNSIVVE----YRSFAGNKSRYVNEQFIELFDL 151


>gi|218768739|ref|YP_002343251.1| hypothetical protein NMA1982 [Neisseria meningitidis Z2491]
 gi|121052747|emb|CAM09091.1| hypothetical protein NMA1982 [Neisseria meningitidis Z2491]
          Length = 155

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 20  DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 78

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 79  PVTARDIQKHDVETFRQLIGQAESPVLAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 134


>gi|198436298|ref|XP_002123739.1| PREDICTED: similar to Protein tyrosine phosphatase
           domain-containing protein 1 [Ciona intestinalis]
          Length = 1238

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/176 (16%), Positives = 55/176 (31%), Gaps = 23/176 (13%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGL----YFLTITTFTQNFH-AVVPHEIYRSAQPNGT-- 61
           +   +F   +   +              +          F   V+ + +   ++P+    
Sbjct: 26  RIRQVFPGPMQCSMACGGKNCKWENPSRWSDADQAIKGVFSSWVLDNVV-AMSRPSTQII 84

Query: 62  ---FIEYLKKEYGIKSILNLRGKLP----------ESWHKEEEKAANDLGIQLINFPLSA 108
               I    K + I SI+NL+              ES    + +   D  I   NF    
Sbjct: 85  EKYNIIDQFKRHNITSIINLQRPGEHASCGPPLDKESLFTYKPQLFMDNDIFFYNFGWKD 144

Query: 109 TRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162
               +   I  ++ ++  A     + +HC +G  RTG+  A YL        + A 
Sbjct: 145 FGVTSLNTILDMVKVMCFALEEGNVAVHCHAGLGRTGVLIACYLVFAHRMDPDAAI 200


>gi|298706626|emb|CBJ29564.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 731

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 45/143 (31%), Gaps = 19/143 (13%)

Query: 45  HAVVPHEIYRSAQPNGT-----FIEYLKKEYGIKSILNLRGKLPESW----------HKE 89
           H +    I    +P+        I    K  G+ +I NL                     
Sbjct: 239 HWI-SDSIIGMQRPSSRLIKTYDIVGQFKRKGVTAIFNLTEPGEHPHCGDGLEKASGFPY 297

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISI---LKTAPKPLLIHCKSGADRTGLAS 146
             +     GI + NF        +   +  +I +          + +HC +G  RTGL  
Sbjct: 298 LPETFMREGISVYNFSWEDMTTPSMALLSDIIRVALSCLRTGGKIAVHCHAGYGRTGLVI 357

Query: 147 AVYLYIVAHYPKEEAHRQLSMLY 169
           A  L ++ + P ++A   +    
Sbjct: 358 ASILVMMNNLPPQQAVALVREKR 380


>gi|331217852|ref|XP_003321604.1| tyrosine specific protein phosphatase [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309300594|gb|EFP77185.1| tyrosine specific protein phosphatase [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 313

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/117 (21%), Positives = 37/117 (31%), Gaps = 17/117 (14%)

Query: 76  LNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC 135
           LNL    P +        A  L +              D+    L  +L T   P+LIHC
Sbjct: 196 LNLSSPHPLNPPPNFAIVAPGLFL------------PEDKIRLALRQVLDTRNHPMLIHC 243

Query: 136 KSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
             G  RTG        +        +   +   Y  +   K+  MD  F ++    P
Sbjct: 244 NKGKHRTGCLVGCLRKLQH-----WSSTAIFDEYRRYAFPKSRNMDQQFIELFDHSP 295


>gi|74025756|ref|XP_829444.1| phosphatase [Trypanosoma brucei TREU927]
 gi|70834830|gb|EAN80332.1| phosphatase, putative [Trypanosoma brucei]
 gi|261335437|emb|CBH18431.1| phosphatase, putative [Trypanosoma brucei gambiense DAL972]
          Length = 494

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 51/163 (31%), Gaps = 22/163 (13%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYL-----KKEYGIKSILNLRGKLPE------------SWH 87
             V    +  S +P+ +           +E  I  +LNL+ K                + 
Sbjct: 86  SWVGDD-VIASQRPSTSLFRKYSLIEQFREKRITGVLNLQEKGEHASCGPDGIYASTGYS 144

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGL 144
              E+      I    FP         + + + + ++         +L+HC +G  RTGL
Sbjct: 145 YSGEQDLMRHQISYYEFPWPDMTAPKQDIVLRSVQVMDSHVKKSGKVLVHCHAGLGRTGL 204

Query: 145 ASAVYLYIVAHYPKEEAHRQLS-MLYGHFPVLKTITMDITFEK 186
             A YL      P  +    +  M  G     + +     FE 
Sbjct: 205 MIACYLLYAQKMPSADVIELVRQMRPGAIQTSRQVKFIHDFES 247


>gi|322496351|emb|CBZ31422.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 693

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 48/126 (38%), Gaps = 10/126 (7%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLIN 103
           F  V    +YR A P         +   ++++++L   +PE    + +  A    IQL +
Sbjct: 206 FARVESG-VYRGAYPVLRNF-PYIRRLRLRTMVSL---IPEPPTYDLKCFAEAEHIQLHH 260

Query: 104 FPLSATR----ELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
                 +     L  E  + L  I+     PL IHC  G   TGL       ++  +  +
Sbjct: 261 IHAERAKGEVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALRKLLQ-WDAK 319

Query: 160 EAHRQL 165
            A+ + 
Sbjct: 320 VANAEF 325


>gi|168055820|ref|XP_001779921.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162668635|gb|EDQ55238.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 181

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 49/125 (39%), Gaps = 8/125 (6%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
           HA+V    +R A P         +   +K++++L  +   +  ++  +     GI + NF
Sbjct: 13  HAIVEDSFFRGAYPTIKNF-RFLRRLHLKTLVSLTPEAHPN--RDMREFCEHEGITVHNF 69

Query: 105 PL----SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEE 160
            +          N + I+ L  I++    P+ +HC  G   TGL    +  +   +    
Sbjct: 70  FVEKFQDGVTLTNAKVIQVLQIIIRPENLPVYVHCLDGTHVTGLVVMCFRKL-QSWNLST 128

Query: 161 AHRQL 165
           +  + 
Sbjct: 129 STAEF 133


>gi|294463799|gb|ADE77424.1| unknown [Picea sitchensis]
          Length = 287

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 56/147 (38%), Gaps = 13/147 (8%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQP-NGTFIEYLKKEYGIKSILNLRGKLPESWHKEE 90
            Y   +     N+  + P+ I  S QP N   I+ LK+E G+ +ILNL+      +   +
Sbjct: 92  EYHHDLGM---NYTRITPNLIVGS-QPQNAEDIDRLKEEEGVTAILNLQQDKDIEYWGID 147

Query: 91  ----EKAANDLGIQLINFPLSATRELNDEQIKQ----LISILKTAPKPLLIHCKSGADRT 142
                K   +LGI+ +  P       +  +        +    +    + +HC +G  R 
Sbjct: 148 LGSIVKRCQELGIRHMRRPARDFDPDSLRKELPKAVSSLDWAISKGGTVYVHCTAGLGRA 207

Query: 143 GLASAVYLYIVAHYPKEEAHRQLSMLY 169
              +  YL+        +A+  ++   
Sbjct: 208 PAVAIAYLFWFCDMDLNKAYDMVTSKR 234


>gi|94968590|ref|YP_590638.1| dual specificity protein phosphatase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94550640|gb|ABF40564.1| dual specificity protein phosphatase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 168

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 61  TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120
             +E  +K  GI +IL+L           E +  N+L I   + P+        ++++++
Sbjct: 30  RALERWQK-IGITTILSLLTPGERPGWDNEGEICNELDINFYSLPIRDHSVPRPDEMQKV 88

Query: 121 ISILKTAP------KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYG 170
           + +L          + ++ HC +G  R+G+A+   L I A  P E+A  ++S+  G
Sbjct: 89  VDVLTKVEARLKAGERVVAHCFAGIGRSGIATVGLLMI-AGIPMEDAIDRVSLARG 143


>gi|225448641|ref|XP_002274406.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 242

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 50/148 (33%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHK-- 88
            Y   +         ++   +   +QP     +++LK+E  +  ILNL+      + +  
Sbjct: 44  EYHHDLGMNYT----LITDHLIVGSQPQKPEDVDHLKQEENVAYILNLQQDKDVEYWEVD 99

Query: 89  --EEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
                K   +L I+ +  P       +      + +  L   +      + +HC +G  R
Sbjct: 100 LPSIIKRCKELEIRHMRRPARDFDPDSLRSGLPKAVSSLEWAISEGKGKVYVHCTAGLGR 159

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               +  Y++         A+  L+   
Sbjct: 160 APAVAIAYMFWFCGMDLNTAYDTLTSKR 187


>gi|94733551|emb|CAK11330.1| novel protein (zgc:77752) [Danio rerio]
          Length = 626

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 54/152 (35%), Gaps = 18/152 (11%)

Query: 45  HAVVPHEIYRSAQPN-----GTFIEYLKKEYGIKSILNLR----------GKLPESWHKE 89
             V    I   A+P+        I    K+  IKSI+N++             P+S    
Sbjct: 59  SWVTDD-ILAMARPSTYLMKRYSIIEQFKQLNIKSIINMQLPGEHAHCGPPLEPDSGFTY 117

Query: 90  EEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASA 147
             ++  D  I   NF +S     + E +   + +L  +     + +HC +G  RTG+  A
Sbjct: 118 SPQSFMDNQIFFYNFGMSDFGVSSLEGMLDAVKVLAFSVQEGKVAVHCHAGLGRTGVLIA 177

Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTIT 179
            YL         EA   + +        ++  
Sbjct: 178 CYLVYTCRISASEAVHYVRIKRPRSIQTRSQI 209


>gi|60679731|ref|YP_209875.1| hypothetical protein BF0135 [Bacteroides fragilis NCTC 9343]
 gi|253564477|ref|ZP_04841934.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|265764860|ref|ZP_06093135.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|60491165|emb|CAH05913.1| conserved hypothetical protein [Bacteroides fragilis NCTC 9343]
 gi|251948253|gb|EES88535.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263254244|gb|EEZ25678.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|301161193|emb|CBW20731.1| conserved hypothetical protein [Bacteroides fragilis 638R]
          Length = 351

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 57/160 (35%), Gaps = 29/160 (18%)

Query: 46  AVVPHEIYRSAQPNGTFIE--YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI---- 99
            V   ++YRSAQ +          +  GIK+IL+LR +         +K  N + I    
Sbjct: 129 HVRWGKLYRSAQIDSLNCFALRKLQNLGIKTILDLRSESELHNTPPLQKGFNVVHIPINT 188

Query: 100 ------------------QLINFPLSATREL----NDEQIKQLISILKTAPKPLLIHCKS 137
                              + +   +  REL      E  +    +L     P++IHC S
Sbjct: 189 GDMEHILHGIQQEKIKTDTIYHMVEAMNRELVAKYQKEYKEIFDILLDKNSYPVVIHCSS 248

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           G  RTG+ SA+ L        +       +   +F + K 
Sbjct: 249 GKGRTGIVSALILAS-LDVNADIIMEDYRLSNDYFNIPKA 287


>gi|70606364|ref|YP_255234.1| hypothetical protein Saci_0545 [Sulfolobus acidocaldarius DSM 639]
 gi|68567012|gb|AAY79941.1| conserved Archaeal protein [Sulfolobus acidocaldarius DSM 639]
          Length = 155

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 46/127 (36%), Gaps = 5/127 (3%)

Query: 44  FHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP----ESWHKEEEKAANDLGI 99
            + V  H I  SA P            G+K +L L  +          +          I
Sbjct: 1   MYWVKKHVIGGSAIPYTQDEIIGWINEGVKRVLVLPEEFEIDEAWGSLEYYISVLKSFNI 60

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           + +  P+   R  ++ Q  ++   L+      L+HC  G  RTG   A YL +  +   E
Sbjct: 61  EYLYSPIPDGRAPSENQFLEIYKWLRKDKG-NLVHCVGGIGRTGTILASYLVLEENMSAE 119

Query: 160 EAHRQLS 166
           EA  ++ 
Sbjct: 120 EAIEEVR 126


>gi|53711461|ref|YP_097453.1| hypothetical protein BF0170 [Bacteroides fragilis YCH46]
 gi|52214326|dbj|BAD46919.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
          Length = 351

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 59/160 (36%), Gaps = 29/160 (18%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKK--EYGIKSILNLRGKLPESWHKEEEKAANDLGI---- 99
            V   ++YRSAQ +      L+K    GIK+IL+LR +         +K  N + I    
Sbjct: 129 HVRWGKLYRSAQIDSLNCFALRKLQNLGIKTILDLRSESELHNTPPLQKGFNVVHIPINT 188

Query: 100 ------------------QLINFPLSATREL----NDEQIKQLISILKTAPKPLLIHCKS 137
                              + +   +  REL      E  +    +L     P++IHC S
Sbjct: 189 GDMEHILHGIQQEKIKTDTIYHMVEAMNRELVAKYQKEYKEIFDILLDKNSYPVVIHCSS 248

Query: 138 GADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKT 177
           G  RTG+ SA+ L        +       +   +F + K 
Sbjct: 249 GKGRTGIVSALILAS-LDVNADIIMEDYRLSNDYFNIPKA 287


>gi|114046941|ref|YP_737491.1| dual specificity protein phosphatase [Shewanella sp. MR-7]
 gi|113888383|gb|ABI42434.1| dual specificity protein phosphatase [Shewanella sp. MR-7]
          Length = 156

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 55/161 (34%), Gaps = 22/161 (13%)

Query: 43  NFHAVVPHEIYRSAQP--NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQ 100
           +   +V  +I   + P  +   +    K  GI+++L++ G         E  +    G++
Sbjct: 3   HLFWLVEGKIAGRSGPNKDPWDLAE-LKSLGIRAVLSVNGGEGC-----EPGSFKHHGLR 56

Query: 101 LINFPLSATRELNDE-----------QIKQLISILKTAPKPLLIHCKSGADRTGLASAVY 149
               P  +      E           +    I   +    P+LIHC+SG DRTGL  A Y
Sbjct: 57  YECIPF-SRNVPPQEGDVAICVAQLPRALAFIQECEADNLPVLIHCRSGKDRTGLIMAYY 115

Query: 150 LYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
           L          A  Q+  +               F+ +  L
Sbjct: 116 LMA-NGAAPLHAVSQVRSIRD-IAFTAEGWDQFAFDVLYAL 154


>gi|75910356|ref|YP_324652.1| hypothetical protein Ava_4158 [Anabaena variabilis ATCC 29413]
 gi|75704081|gb|ABA23757.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
          Length = 157

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 3/108 (2%)

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q     +E    + G KS+LNLR      +   E++ A  LG++ +N PL    +LN+E
Sbjct: 15  GQVIPEQLEQ-ASQEGFKSVLNLRSPDELGFSHNEQQVAEALGLKYVNVPLK-LEDLNEE 72

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
            I +++  LKT PKP L+HC +    TG  + + + +      E+   
Sbjct: 73  LITEVLKALKTLPKPTLVHCAAAMRSTG-IALLSIAVEEGLTPEQTLA 119


>gi|255559653|ref|XP_002520846.1| dual specificity protein phosphatase, putative [Ricinus communis]
 gi|223539977|gb|EEF41555.1| dual specificity protein phosphatase, putative [Ricinus communis]
          Length = 286

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 52/148 (35%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWH--- 87
            Y   +         ++ + +   +QP     I++LK E  +  ILNL+      +    
Sbjct: 88  EYHHDLGMNYT----LITNNLIVGSQPQKSEDIDHLKHEENVAYILNLQQDSDIEYWGID 143

Query: 88  -KEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +   +   +LGI+ +  P       +      + +  L   +      + +HC +G  R
Sbjct: 144 LQSIRERCQELGIRHMRRPAKDFDPDSLRSILPKAVSSLEWAISEGKGRVYVHCTAGLGR 203

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               +  Y++         A+ +L+   
Sbjct: 204 APAVTIAYMFWFCDMNLNAAYDELTSQR 231


>gi|145482781|ref|XP_001427413.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124394494|emb|CAK60015.1| unnamed protein product [Paramecium tetraurelia]
          Length = 373

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 61/186 (32%), Gaps = 14/186 (7%)

Query: 23  LVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKL 82
            ++    L L ++T       F A+    IYR++  +       + +   K I+NL  + 
Sbjct: 71  FIMDGFDLDLTYITEQVIAMGFPAIDYEAIYRNSMEDVQRFFNQRHKNHYK-IINLCSER 129

Query: 83  --PESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGAD 140
               ++             Q   F +     + +   +    + +     + IHCK+G  
Sbjct: 130 KYDHAYFDGNVSEYPFDDHQAPQFNM-----IYELCAEIHNYVTQDKQNVVAIHCKAGKG 184

Query: 141 RTGLASAVYLYIVAHY-PKEEAHRQLSMLYGHFPVLKT-ITMDITFEKITQLYPNNVSKG 198
           RTG+    YL     +    EA R     YG             +  +    +   +  G
Sbjct: 185 RTGIMICCYLLFSELFKSSFEAMR----YYGMMRTKNNKGVTIPSQIRYILYFEKALQMG 240

Query: 199 DTEQPM 204
            T Q +
Sbjct: 241 YTVQDV 246


>gi|91086207|ref|XP_971869.1| PREDICTED: similar to dual-specificity protein phosphatase,
           putative [Tribolium castaneum]
          Length = 185

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/162 (16%), Positives = 57/162 (35%), Gaps = 18/162 (11%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +   +   A P  +    L +E  +K ++++  +  E +     K  N  G++ +    +
Sbjct: 29  IDDNVILGALPFPSLTRRLLEEENVKGVISMN-EDYELFLANNGKRWNAYGVEFLQLATT 87

Query: 108 A--TRELNDEQIKQLISI---------LKTAPKP-LLIHCKSGADRTGLASAVYLYIVAH 155
                    +    +  I         L    KP + +HCK+G  R+      YL    +
Sbjct: 88  DIFATPCQQKLNDGVSFIYRVVNKEPSLDEPKKPTVYVHCKAGRTRSATLVGCYLIKRYN 147

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           +  E+A + +     H  +         +E +   Y  N+ K
Sbjct: 148 WTPEQAVQHMQDKRSHILLHT-----KQWEALRVFYELNIPK 184


>gi|297736513|emb|CBI25384.3| unnamed protein product [Vitis vinifera]
          Length = 208

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 50/148 (33%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWHK-- 88
            Y   +         ++   +   +QP     +++LK+E  +  ILNL+      + +  
Sbjct: 10  EYHHDLGMNYT----LITDHLIVGSQPQKPEDVDHLKQEENVAYILNLQQDKDVEYWEVD 65

Query: 89  --EEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
                K   +L I+ +  P       +      + +  L   +      + +HC +G  R
Sbjct: 66  LPSIIKRCKELEIRHMRRPARDFDPDSLRSGLPKAVSSLEWAISEGKGKVYVHCTAGLGR 125

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               +  Y++         A+  L+   
Sbjct: 126 APAVAIAYMFWFCGMDLNTAYDTLTSKR 153


>gi|260942369|ref|XP_002615483.1| hypothetical protein CLUG_04365 [Clavispora lusitaniae ATCC 42720]
 gi|238850773|gb|EEQ40237.1| hypothetical protein CLUG_04365 [Clavispora lusitaniae ATCC 42720]
          Length = 262

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/162 (15%), Positives = 44/162 (27%), Gaps = 42/162 (25%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW---------------- 86
           NF  V    IYRS  P          +  +K+I+ L     E                  
Sbjct: 67  NFSLVEDG-IYRSGFPMPINY-PFLDQLNLKTIIYLGDIGYEKKKKKDDKKDKKDDKKDK 124

Query: 87  ---------------HKEEEKAANDLGIQLINFPLSATRELN---------DEQIKQLIS 122
                           +  +       IQ  +  + +++E              I  L  
Sbjct: 125 KDKKDKKKEHSTHEIFENYKAWVATTDIQFHHLVMHSSQEPFISNTHEETQKALITALQL 184

Query: 123 ILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           +L     P+LIH   G  R G+   +   ++  +       +
Sbjct: 185 MLNRQNFPMLIHSNKGKHRIGILVGLVRKMLQGWCMSGIFEE 226


>gi|254671785|emb|CBA09646.1| hypothetical protein NME_2354 [Neisseria meningitidis alpha153]
 gi|319410975|emb|CBY91371.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594]
 gi|325128736|gb|EGC51599.1| hypothetical protein TIGR01244 [Neisseria meningitidis N1568]
          Length = 142

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 6/118 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPE---SWHKEEEKAANDLGIQLINFP 105
              +Y S Q           + GIK+++  R    E       + ++     G+   +  
Sbjct: 7   DEHLYISPQLTKAD-AEQIAQLGIKTVICNRPDREEESQPDFAQIKQWLEQAGVTGFHHQ 65

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               R++    ++    ++  A  P+L +C++G  R  L    +       P +E  R
Sbjct: 66  PVTARDIQKHDVETFRQLIGQAESPVLAYCRTGT-RCSLLWG-FRRAAEGMPVDEIIR 121


>gi|332376166|gb|AEE63223.1| unknown [Dendroctonus ponderosae]
          Length = 192

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 61/188 (32%), Gaps = 22/188 (11%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                  ++ +  LT   +       +   +   A P  +    + ++  +K+++++  +
Sbjct: 15  FYPTLVYNVLMEKLTPRQWYNR----IDDTVILGALPFPSIATEIIEKENVKAVVSMN-E 69

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAP-------K 129
             E +     K+   LG++ +                 E +  +   + +          
Sbjct: 70  DYELFLANNSKSWKKLGVEFLQLATVDIFATPCQSKLVEGVNFINKFVDSQKVVNGISTS 129

Query: 130 PLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQ 189
            + IHCK+G  R+      YL    ++  E+A   +     H  + K       +E +  
Sbjct: 130 SVYIHCKAGRTRSATLVGCYLMKRYNWTPEQAVNCMKEKRPHILMHK-----KQWEALQL 184

Query: 190 LYPNNVSK 197
               N+  
Sbjct: 185 FRAQNLKS 192


>gi|256081932|ref|XP_002577220.1| dual-specificity phosphatase [Schistosoma mansoni]
 gi|238662519|emb|CAZ33457.1| dual-specificity phosphatase, putative [Schistosoma mansoni]
          Length = 149

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 51/128 (39%), Gaps = 13/128 (10%)

Query: 43  NFHAVVPHEIYRSAQPNGT-FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           NF  V    +   A P     + YL    GI  I+ L  ++P+          +D   + 
Sbjct: 7   NFSWVSK-SVAGFAFPREKCELGYLVDNAGITHIITLCHEVPQ--------YISDFTFKH 57

Query: 102 INFPLSATRELNDEQIKQLISIL---KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
            + P+      +   I++ + I+   +T  + + +HC+ G  R G   A YL    +   
Sbjct: 58  YHLPVEDLTSASLPVIQKAMEIIKQAETNNEKVGVHCQLGRGRAGTILACYLAYKNNLDA 117

Query: 159 EEAHRQLS 166
           ++A  +L 
Sbjct: 118 DQAIMELR 125


>gi|12849578|dbj|BAB28400.1| unnamed protein product [Mus musculus]
          Length = 279

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 55/159 (34%), Gaps = 9/159 (5%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           N++  + H +   A P       L  +  ++ ++ +  +    +     K     G++ +
Sbjct: 122 NWYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQL 181

Query: 103 NFPLSA-TRELNDEQIK---QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPK 158
                  T       +    Q     +   + + +HCK+G  R+    A YL  V ++  
Sbjct: 182 RLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSP 241

Query: 159 EEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK 197
           EEA   ++ +  H             E + + +    ++
Sbjct: 242 EEAIEAIAKIRSHIS-----IRPSQLEVLKEFHKEITAR 275


>gi|195652299|gb|ACG45617.1| dual-specificity protein-like phosphatase 3 [Zea mays]
          Length = 280

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 50/145 (34%), Gaps = 14/145 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWH--- 87
            Y   +        AV+   +   +QP     I +LK E  +  IL L+      +    
Sbjct: 82  EYHHDLGMNY----AVISESLIVGSQPQKPEDINHLKNEERVAYILCLQQDKDIEYWGID 137

Query: 88  -KEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +       +LGIQ I  P       +      + +  L          + +HC +G  R
Sbjct: 138 FQSIVNRCKELGIQHIRRPAVDFDPDSLRSQLPKAVSALEWATSQRKGRVYVHCTAGLGR 197

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLS 166
               +  Y++   +     A+++L+
Sbjct: 198 APAVAIAYMFWFENMDLNTAYQKLT 222


>gi|157376036|ref|YP_001474636.1| dual specificity protein phosphatase [Shewanella sediminis HAW-EB3]
 gi|157318410|gb|ABV37508.1| dual specificity protein phosphatase [Shewanella sediminis HAW-EB3]
          Length = 156

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 51/159 (32%), Gaps = 18/159 (11%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIE-YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
           +   +V  +I   + PN    +    K  GI +IL++ G         E  A     +  
Sbjct: 3   HLFWLVEDKIAGRSGPNKEAWDLNEIKRSGIGAILSVNGGEAC-----EPDAFTQADLAY 57

Query: 102 INFPLSATRELNDEQ----------IKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
              P S+     DE               I   +    P++IHC+SG DRT L  A YL 
Sbjct: 58  ACIPFSSNVPPKDEDLGLCVEQLPKALAFIRECEANNTPVMIHCRSGKDRTALLMAYYLM 117

Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQL 190
                    A  Q+                  F+ +  L
Sbjct: 118 E-NGAAPLHAVSQVRAARD-IAFSAEGWDQFAFDVLYAL 154


>gi|162462322|ref|NP_001105825.1| LOC732726 [Zea mays]
 gi|74318856|gb|ABA02564.1| dual-specificity protein-like phosphatase 3 [Zea mays]
          Length = 280

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 51/145 (35%), Gaps = 14/145 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWH--- 87
            Y   +        AV+   +   +QP     I++LK E  +  IL L+      +    
Sbjct: 82  EYHHDLGMNY----AVISESLIVGSQPQKPEDIDHLKNEERVPYILCLQQDKDIEYWGID 137

Query: 88  -KEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
            +       +LGIQ I  P       +      + +  L          + +HC +G  R
Sbjct: 138 FQSIVNRCKELGIQHIRRPAVDFDPDSLRSQLPKAVSALEWATSQRKGRVYVHCTAGLGR 197

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLS 166
               +  Y++   +     A+++L+
Sbjct: 198 APAVAIAYMFWFENMDLNTAYQKLT 222


>gi|330843463|ref|XP_003293673.1| hypothetical protein DICPUDRAFT_158575 [Dictyostelium purpureum]
 gi|325075979|gb|EGC29808.1| hypothetical protein DICPUDRAFT_158575 [Dictyostelium purpureum]
          Length = 713

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 49/154 (31%), Gaps = 8/154 (5%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINF 104
             ++P         +      +    GI  I+   G     + K  +  + D      + 
Sbjct: 507 SEIIPGVFL--GGLDSANNAPILAALGITHIVLAIGDCEPFFPKNFKYYSID---DARDT 561

Query: 105 PLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           P     +  ++    +          +L+HC++G  R+      YL        ++A   
Sbjct: 562 PNYDISQHFEQTNCFIEQ--GRRSGGVLVHCRAGISRSSTLILSYLMRYHQMTFKQASDF 619

Query: 165 LSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198
           + +      +      D   +  ++LY NN+ K 
Sbjct: 620 VQLKRPQI-LPNPGFRDQLLKYESKLYCNNILKK 652


>gi|322494153|emb|CBZ29450.1| putative phosphatase [Leishmania mexicana MHOM/GT/2001/U1103]
          Length = 604

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 47/142 (33%), Gaps = 21/142 (14%)

Query: 45  HAVVPHEIYRSAQPNGTFI-----EYLKKEYGIKSILNLRGKLPES------------WH 87
           + V  +++  S +P+ +               +  +LNL+ K                + 
Sbjct: 89  NWVG-NDVIASQRPSTSLFLKYPIIAQFHAKNVTGVLNLQEKGEHGHCGPDGIYESSGYS 147

Query: 88  KEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILK---TAPKPLLIHCKSGADRTGL 144
               +     GI    FP         + + + + ++         +L+HC +G  RTGL
Sbjct: 148 YNGAEDLMPHGISYYEFPWPDMTAPQQDIVLRSVQVMDYHIKQKGKVLVHCHAGLGRTGL 207

Query: 145 ASAVYLYIVAHYPKEEAHRQLS 166
             A Y     H P  EA   + 
Sbjct: 208 MIACYYVYSQHIPSHEAIALVR 229


>gi|262372673|ref|ZP_06065952.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262312698|gb|EEY93783.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 174

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 50/127 (39%), Gaps = 6/127 (4%)

Query: 42  QNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101
            +F  +  H ++ SAQP    + +  KEYG  +++NL           +++   D+G+  
Sbjct: 12  PHFSFIHEH-LFNSAQPTIDQL-HHIKEYGCSTVINLSTSKSADHLNHQDQICLDIGLNY 69

Query: 102 INFPLSATRELNDEQIKQLISILKTA--PKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           I+ P+      + +Q   ++ ++      + + +HC     R      +Y     +    
Sbjct: 70  IHIPI-DWEIPSSDQCLLVLDLIDHLVKNEIVWLHCTENM-RASCLIYLYRQYYMNMDMP 127

Query: 160 EAHRQLS 166
            A   L 
Sbjct: 128 TAQELLH 134


>gi|91081221|ref|XP_975624.1| PREDICTED: similar to rCG63711 [Tribolium castaneum]
 gi|270005257|gb|EFA01705.1| hypothetical protein TcasGA2_TC007281 [Tribolium castaneum]
          Length = 250

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 52/157 (33%), Gaps = 15/157 (9%)

Query: 43  NFHAVVPHEI---YRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99
           N   +VP      Y SAQ          +++GI  I+ +R  +   +    +   NDL I
Sbjct: 35  NMQEIVPGLFLGPYSSAQ---KHCLKTLRDHGISHIICVRQDIEAQY---IKPQINDLSI 88

Query: 100 QLINFPLSATRELND----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAH 155
             +   ++ T   N       ++Q I         +L+H  +G  R+      Y+     
Sbjct: 89  TYLTLNIADTATENIIRFFPTVRQFIDEAFQRNGKVLVHGNNGISRSATLVLAYIMEKYG 148

Query: 156 YPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYP 192
              +EA   +    G         +    E    +Y 
Sbjct: 149 LSSKEAIECVKQRRGCI-HPNEGFLAQLIE-YEPIYK 183


>gi|149927941|ref|ZP_01916191.1| hypothetical protein LMED105_07653 [Limnobacter sp. MED105]
 gi|149823380|gb|EDM82613.1| hypothetical protein LMED105_07653 [Limnobacter sp. MED105]
          Length = 112

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 5/98 (5%)

Query: 49  PHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLP---ESWHKEEEKAANDLGIQLINFP 105
            +E+    Q +   +E    E G K+I+N R       +  H   E  A  LG+ +   P
Sbjct: 7   SNEVAVCGQISPEDLEA-IAELGFKTIVNNRPDHEVGAQLAHSVIEAKAKSLGLAIHYLP 65

Query: 106 LSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143
           +   +  ++  ++    IL  A KP+L +C+SG +R+G
Sbjct: 66  MEVGQPPSEVLLEDFKRILDAAEKPVLAYCRSG-NRSG 102


>gi|149239923|ref|XP_001525837.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146449960|gb|EDK44216.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 263

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/176 (15%), Positives = 46/176 (26%), Gaps = 56/176 (31%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESW---------------- 86
           NF  V    IYR   P         ++   K+I+ L     E                  
Sbjct: 54  NFSLVEDG-IYRCGFPMPINY-PFLQQLNFKTIIYLGDLGHEPTEPKKEKDKRKGNEKEE 111

Query: 87  ---------------------------HKEEEKAANDLG-IQLINFPLSATRELNDEQIK 118
                                        +      D G I   N  + + +E  ++  +
Sbjct: 112 PKEKKKKKEKEKDKKKKKKDKDGSVEILNQYVDWIKDQGSITFHNLLVESLKEPFNKMEE 171

Query: 119 Q----------LISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
                      L  IL  +  P+LIH   G  RTGL   +   ++  +       +
Sbjct: 172 HEQTLRSLTTALTLILDRSNYPILIHSNKGKHRTGLLVGLMRKLLQGWCLSGIFEE 227


>gi|18312696|ref|NP_559363.1| hypothetical protein PAE1536 [Pyrobaculum aerophilum str. IM2]
 gi|18160173|gb|AAL63545.1| conserved protein (possible dual specificity phosphatase)
           [Pyrobaculum aerophilum str. IM2]
          Length = 195

 Score = 66.3 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 49/126 (38%), Gaps = 7/126 (5%)

Query: 45  HAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH-----KEEEKAANDLGI 99
           + + P  +  S  P    IE    E G+K++++L       ++      E  K   + G+
Sbjct: 39  YWITP-RLAGSCMPGRGDIEKW-AELGVKTVVSLAEAWEIEYYGRWGLLELRKTLMNKGM 96

Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKE 159
           + I++P               +   + A   +++HC  G  RT    A YL        +
Sbjct: 97  KWIHWPTPDGYPPRKLDELVELLKEEAAKGSVVVHCVGGIGRTPTVLAAYLIATRCMKAD 156

Query: 160 EAHRQL 165
           +A R++
Sbjct: 157 DAIREV 162


>gi|320169800|gb|EFW46699.1| hypothetical protein CAOG_04657 [Capsaspora owczarzaki ATCC 30864]
          Length = 436

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 49/124 (39%), Gaps = 9/124 (7%)

Query: 46  AVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFP 105
            +V  ++YR A P             +K++L+L  K P+S          + G+Q I   
Sbjct: 13  TIVDEQVYRGAYPTHLNFA-FLARLKLKTVLSLTPKKPDSNID---FFCKEEGVQNIFIQ 68

Query: 106 LSATRE----LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161
           +   +E     +   ++ L  +L  +  P+ IHC  GA+ TGL       I   +    A
Sbjct: 69  VDKFKENVTLTHQHIVQILPILLNASCHPIYIHCLDGANVTGLVVMFLRRIQQ-WTVASA 127

Query: 162 HRQL 165
             + 
Sbjct: 128 VIEF 131


>gi|322795664|gb|EFZ18343.1| hypothetical protein SINV_03852 [Solenopsis invicta]
          Length = 195

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/194 (12%), Positives = 63/194 (32%), Gaps = 29/194 (14%)

Query: 22  VLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGK 81
                  ++ +  +T   +       +   +   A P     + L  +  IK+++++   
Sbjct: 7   FYPTLFYNVVMEKITTRNWYDR----IDETVILGALPFRQTTKQLIDDENIKAVVSMNED 62

Query: 82  LPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISILK--------------- 125
              S     EK      ++ +    +   +  + E+++  ++ +                
Sbjct: 63  YELSLLSNTEKEWRSYNVEFLQLSTTDIFQAPSQEKLQDGVNFINKFRNVSSKKLDDTGV 122

Query: 126 ----TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMD 181
                 P  + +HCK+G  R+    A YL    ++  +EA   +     H  +       
Sbjct: 123 IDGNEQPGTVYVHCKAGRTRSATLVACYLISKNNWTPQEAIDYMRTKRPHILIHTA---- 178

Query: 182 ITFEKITQLYPNNV 195
             +  + Q Y  ++
Sbjct: 179 -QWSALKQFYTRHI 191


>gi|114331088|ref|YP_747310.1| hypothetical protein Neut_1090 [Nitrosomonas eutropha C91]
 gi|114308102|gb|ABI59345.1| protein of unknown function DUF442 [Nitrosomonas eutropha C91]
          Length = 176

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 68/157 (43%), Gaps = 12/157 (7%)

Query: 13  IFYIKILLGVLVLCAVSLGLY-----FLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLK 67
           +F+ + ++ +LVL + SL        + T       ++ V P +I  S       I+ L 
Sbjct: 1   MFFARTIITLLVLSSTSLVFAKDQVPYATQVNDLMRYYRVTP-QIATSGALTHDSIQELV 59

Query: 68  KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127
           K +   ++++LR +        E KA    G+  IN P++     N+ Q+     +L+ A
Sbjct: 60  K-HSFNTVIDLRIESE--GTPNERKAVEAAGMTYINIPVTNDGV-NESQLIAFKRVLEQA 115

Query: 128 PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
             P L+HC +G +R G     Y  +      E A ++
Sbjct: 116 SPPFLVHCATG-NRAGAMWTAYR-LKEGISPEIAFKE 150


>gi|87306696|ref|ZP_01088843.1| hypothetical protein DSM3645_10192 [Blastopirellula marina DSM
           3645]
 gi|87290875|gb|EAQ82762.1| hypothetical protein DSM3645_10192 [Blastopirellula marina DSM
           3645]
          Length = 151

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 45/113 (39%), Gaps = 6/113 (5%)

Query: 55  SAQPNGTFIEYLKKEYGIKSILNLRGKLPESWH---KEEEKAANDLGIQLINFPLSATRE 111
             QPN   I    K  G ++I+N R    +        E+       ++ ++ P+ +   
Sbjct: 14  GPQPNEAEIGQ-LKLEGFRTIVNFREDGEDDQPITPSHEKDWVVAAEMEYLHLPV-SMMT 71

Query: 112 LNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQ 164
           ++ + + +     +  PKP+  HC SG  R G    ++L        EE  +Q
Sbjct: 72  MSPQIVDEFRDKYQYLPKPIFAHCASGK-RAGAMVMMHLACEQGMSGEETLKQ 123


>gi|297833882|ref|XP_002884823.1| hypothetical protein ARALYDRAFT_478435 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297330663|gb|EFH61082.1| hypothetical protein ARALYDRAFT_478435 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 282

 Score = 66.3 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 52/148 (35%), Gaps = 14/148 (9%)

Query: 32  LYFLTITTFTQNFHAVVPHEIYRSAQPN-GTFIEYLKKEYGIKSILNLRGKLPESWH--- 87
            Y   +         ++  E+   +QP     I++LK+E  +  ILNL+      +    
Sbjct: 84  EYHHDLGMNYT----LIRDELIVGSQPQKPEDIDHLKQEQNVAYILNLQQDKDIDYWGID 139

Query: 88  -KEEEKAANDLGIQLINFPLSATRELN-----DEQIKQLISILKTAPKPLLIHCKSGADR 141
                + + +LGI+ +  P      L+      + +  L   +      + +HC +G  R
Sbjct: 140 LDSIVRRSKELGIRHMRRPAKDFDPLSLRSQLPKAVSSLEWAVSEGKGRVYVHCSAGLGR 199

Query: 142 TGLASAVYLYIVAHYPKEEAHRQLSMLY 169
               S  Y+Y         A+  L    
Sbjct: 200 APGVSIAYMYWFCDMNLNTAYDNLVSKR 227


>gi|88799531|ref|ZP_01115108.1| protein tyrosine/serine phosphatase [Reinekea sp. MED297]
 gi|88777841|gb|EAR09039.1| protein tyrosine/serine phosphatase [Reinekea sp. MED297]
          Length = 132

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 33  YFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEK 92
               +  F  N H +  H ++RS QP+           G ++I+NLRG      +  E++
Sbjct: 40  DHAFLRAFWSNLHPLT-HSVWRSNQPSPRR-IRRLARRGFRTIVNLRGPSRWGSYALEKE 97

Query: 93  AANDLGIQLINFPLSATRELNDEQIKQLISILKT 126
           A    G+ LIN  + + R    ++++   ++ ++
Sbjct: 98  ACEQSGLTLINHKMYSRRMPTFKELQATKALFES 131


>gi|149725146|ref|XP_001491295.1| PREDICTED: similar to Protein tyrosine phosphatase, mitochondrial
           1, partial [Equus caballus]
          Length = 167

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 53/150 (35%), Gaps = 9/150 (6%)

Query: 48  VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107
           +   +   A P  +    L ++  ++ ++ +  +    +     K    +G++ +     
Sbjct: 7   IDATVLLGALPLRSMTRRLVQDENVRGVITMNEEYETRFLCNSAKEWKKVGVEQLRLSTV 66

Query: 108 ATRELNDEQIK----QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163
               +          Q     ++  + + +HCK+G  R+    A YL  V  +  EEA R
Sbjct: 67  DMTGIPTLVNLRKGVQFALKYQSLGQSVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVR 126

Query: 164 QLSMLYGHFPVLKTITMDITFEKITQLYPN 193
            ++ +  H            FE + + +  
Sbjct: 127 AITKIRSHI-----YIRPGQFEVLKEFHKE 151


>gi|113969712|ref|YP_733505.1| dual specificity protein phosphatase [Shewanella sp. MR-4]
 gi|113884396|gb|ABI38448.1| dual specificity protein phosphatase [Shewanella sp. MR-4]
          Length = 156

 Score = 65.9 bits (1