RPSBLAST alignment for GI: 254780898 and conserved domain: KOG1572

>gnl|CDD|36785 KOG1572, KOG1572, KOG1572, Predicted protein tyrosine phosphatase [Defense mechanisms]. Length = 249
 Score = 49.2 bits (117), Expect = 8e-07
 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 14/111 (12%)

Query: 43  NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102
           NF  V    +YRS  P      +LK    +KSI++L    PE + +E        GI+L 
Sbjct: 59  NFSMVDN-GLYRSGFPRPENFSFLK-TLHLKSIISLC---PEPYPEENLNFLESNGIKLY 113

Query: 103 NFPLSATRELNDEQ---------IKQLISILKTAPKPLLIHCKSGADRTGL 144
              +   ++   E           K L  +L     P+LIHCK G  RTG 
Sbjct: 114 QIGIEGEKDNKKEPFVNIPDHSIRKALKVLLDKRNYPILIHCKRGKHRTGC 164