RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >gnl|CDD|32512 COG2365, COG2365, Protein tyrosine/serine phosphatase [Signal transduction mechanisms]. Length = 249 Score = 72.4 bits (177), Expect = 8e-14 Identities = 39/128 (30%), Positives = 60/128 (46%), Gaps = 5/128 (3%) Query: 43 NFHAVVPHEIYRSAQPNGT-FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQL 101 NF ++P YRS QP L +K+I+NLR + + + N + Sbjct: 46 NFLGIIPIIDYRSGQPVPVQPDPELLDALYLKTIINLRDESNTNVELYTDHLINWDKAAI 105 Query: 102 IN---FPLSATRELNDEQIKQLISILKTAPK-PLLIHCKSGADRTGLASAVYLYIVAHYP 157 I + TRE E++ +L+ +L A P+LIHC +G DRTGL +A+Y +V Sbjct: 106 IMFESYRSFPTREDAAERLVELLQLLADAENGPVLIHCTAGKDRTGLVAALYRKLVGGSD 165 Query: 158 KEEAHRQL 165 + A L Sbjct: 166 ETVAADYL 173 >gnl|CDD|36785 KOG1572, KOG1572, KOG1572, Predicted protein tyrosine phosphatase [Defense mechanisms]. Length = 249 Score = 49.2 bits (117), Expect = 8e-07 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 14/111 (12%) Query: 43 NFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102 NF V +YRS P +LK +KSI++L PE + +E GI+L Sbjct: 59 NFSMVDN-GLYRSGFPRPENFSFLK-TLHLKSIISLC---PEPYPEENLNFLESNGIKLY 113 Query: 103 NFPLSATRELNDEQ---------IKQLISILKTAPKPLLIHCKSGADRTGL 144 + ++ E K L +L P+LIHCK G RTG Sbjct: 114 QIGIEGEKDNKKEPFVNIPDHSIRKALKVLLDKRNYPILIHCKRGKHRTGC 164 >gnl|CDD|111998 pfam03162, Y_phosphatase2, Tyrosine phosphatase family. This family is closely related to the pfam00102 and pfam00782 families. Length = 150 Score = 45.1 bits (107), Expect = 1e-05 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 16/110 (14%) Query: 43 NFHAVVPHEIYRSAQP---NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGI 99 NF V +YRS+ P N +F+ L+ +K+I++L PE + ++ + I Sbjct: 6 NFSPVES-GLYRSSYPRANNFSFLRSLR----LKTIISLS---PEPYPQDNLQFLESEHI 57 Query: 100 QLINFPLSATRE-----LNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144 +L + + ++ + + L +L P+LIHC G RTGL Sbjct: 58 KLYHIHMEGNKDPFVNIPSHLLRRALKLLLNKDNYPVLIHCNRGKHRTGL 107 >gnl|CDD|36932 KOG1720, KOG1720, KOG1720, Protein tyrosine phosphatase CDC14 [Defense mechanisms]. Length = 225 Score = 40.3 bits (94), Expect = 4e-04 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 9/94 (9%) Query: 59 NGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118 +I+Y K + SI+ L +L ++ D GI + + D +K Sbjct: 83 PQPYIQYFKNNN-VTSIVRLNKRLYDAKRFT------DAGIDHHDLFFADGSTPTDAIVK 135 Query: 119 QLISILKTAPKP--LLIHCKSGADRTGLASAVYL 150 + + I++ A K + +HCK+G RTG A YL Sbjct: 136 EFVKIVENAEKGGKIAVHCKAGLGRTGTLIACYL 169 >gnl|CDD|33256 COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 130 Score = 38.4 bits (89), Expect = 0.001 Identities = 22/97 (22%), Positives = 38/97 (39%), Gaps = 5/97 (5%) Query: 51 EIYRSAQPNGTFIEYLKKEYGIKSILNLR--GKLPESWHKEEEK-AANDLGIQLINFPLS 107 + S Q + I + G KSI+ R G+ P AA G+ + P++ Sbjct: 9 RLSVSGQISPADIASIAAL-GFKSIICNRPDGEEPGQPGFAAIAAAAEAAGLTYTHIPVT 67 Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGL 144 + + ++ L A P+L +C+SG L Sbjct: 68 G-GGITEADVEAFQRALDEAEGPVLAYCRSGTRSLNL 103 >gnl|CDD|144397 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain. Ser/Thr and Tyr protein phosphatases. The enzyme's tertiary fold is highly similar to that of tyrosine-specific phosphatases, except for a "recognition" region. Length = 131 Score = 35.3 bits (82), Expect = 0.011 Identities = 19/108 (17%), Positives = 41/108 (37%), Gaps = 6/108 (5%) Query: 66 LKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSA-TRELNDEQIKQLISIL 124 ++ GI ++N+ ++P S LGI + + + ++ L + + I Sbjct: 13 FLEKLGITHVINVTREVPNSNLNSGI---LYLGIPVEDNHETNISKYLP--EAVEFIDDA 67 Query: 125 KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF 172 +L+HC++G R+ YL + EA+ + Sbjct: 68 IQKGGKVLVHCQAGISRSATLIIAYLMKTRNLSLNEAYSFVKERRPII 115 >gnl|CDD|113060 pfam04273, DUF442, Putative phosphatase (DUF442). Although this domain is uncharacterized it seems likely that it performs a phosphatase function. Length = 110 Score = 34.4 bits (79), Expect = 0.025 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Query: 68 KEYGIKSILNLR--GKLPES-WHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124 G +S++N R G+ P + E+ AA G+ P+ + ++ + ++ L Sbjct: 24 ARAGFRSVINNRPDGEEPGQPSNAAEQAAARAAGLAYRFIPVISG-QITEADVEAFQRAL 82 Query: 125 KTAPKPLLIHCKSGA 139 A P+L HC+SG Sbjct: 83 AAAEGPVLAHCRSGT 97 >gnl|CDD|36928 KOG1716, KOG1716, KOG1716, Dual specificity phosphatase [Defense mechanisms]. Length = 285 Score = 33.7 bits (76), Expect = 0.036 Identities = 25/121 (20%), Positives = 48/121 (39%), Gaps = 5/121 (4%) Query: 48 VPHEIYRSAQPNGTFIEYLKKEYGIKSILNL-RGKLPESWHKEEEKAANDLGIQLINFPL 106 + +Y +Q + + L K+ GI +LN+ + KE+ L I + + P Sbjct: 78 ILPNLYLGSQGVASDPD-LLKKLGITHVLNVSSSCPNPRFLKEQGI--KYLRIPVEDNPS 134 Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLS 166 + + E I I + +L+HC++G R+ YL E+A+ + Sbjct: 135 TDILQHFPEAIS-FIEKAREKGGKVLVHCQAGVSRSATLVIAYLMKYEGLSLEDAYELVK 193 Query: 167 M 167 Sbjct: 194 S 194 >gnl|CDD|32569 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms]. Length = 180 Score = 33.5 bits (76), Expect = 0.039 Identities = 20/103 (19%), Positives = 40/103 (38%), Gaps = 7/103 (6%) Query: 62 FIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121 I+ + I L EE GIQ+++ P+ + E + +++ Sbjct: 40 GIQTILSLINALVIEELELLGALYNVAIEEND----GIQVLHLPILDGTVPDLEDLDKIV 95 Query: 122 SILKTA---PKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEA 161 ++ A K +++HC+ G R+G A YL + + Sbjct: 96 DFIEEALSKGKKVVVHCQGGIGRSGTVIAAYLMLYGGLSLADE 138 >gnl|CDD|29029 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases. Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like.. Length = 139 Score = 30.6 bits (69), Expect = 0.32 Identities = 21/121 (17%), Positives = 40/121 (33%), Gaps = 12/121 (9%) Query: 47 VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106 + +Y + P + E LKK GI +LN+ + + + P+ Sbjct: 4 EITPGLYLGSYPAASDKELLKK-LGITHVLNV-------AKEVPNENLFLSDFNYLYVPI 55 Query: 107 SATRELND----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAH 162 + ++ I + +L+HC +G R+ YL EA+ Sbjct: 56 LDLPSQDISKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLGLSLREAY 115 Query: 163 R 163 Sbjct: 116 E 116 >gnl|CDD|37165 KOG1954, KOG1954, KOG1954, Endocytosis/signaling protein EHD1 [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]. Length = 532 Score = 30.3 bits (68), Expect = 0.38 Identities = 20/98 (20%), Positives = 43/98 (43%), Gaps = 9/98 (9%) Query: 108 ATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM 167 A R L + + + L L+T P+ + + + + V+ YI++ KE + Sbjct: 266 ANRRLFEAEEQDLFRDLQTLPRKAALRKLNDLIKRARLAKVHAYIISCLKKE-----MPS 320 Query: 168 LYGHFPVLKTITMDI--TFEKITQLYPNNVSKGDTEQP 203 ++G K + ++ +EK+ + + N+S GD Sbjct: 321 VFGKEKKKKRLIDNLIDIYEKLQREH--NISPGDFPDV 356 >gnl|CDD|36929 KOG1717, KOG1717, KOG1717, Dual specificity phosphatase [Defense mechanisms]. Length = 343 Score = 29.0 bits (64), Expect = 0.97 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 11/87 (12%) Query: 68 KEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELN-DEQIKQLISILKT 126 K+YGIK ++N+ LP ++ E P+S N + + IS + Sbjct: 194 KKYGIKYVINVTPNLPNNFENNGE-------FIYKQIPISDHASQNLSQFFPEAISFIDE 246 Query: 127 APKP---LLIHCKSGADRTGLASAVYL 150 A +L+HC +G R+ + YL Sbjct: 247 ARSKNCGVLVHCLAGISRSVTVTVAYL 273 >gnl|CDD|145399 pfam02219, MTHFR, Methylenetetrahydrofolate reductase. This family includes the 5,10-methylenetetrahydrofolate reductase EC:1.7.99.5 from bacteria and methylenetetrahydrofolate reductase EC: 1.5.1.20 from eukaryotes. The structure for this domain is known to be a TIM barrel. Length = 286 Score = 28.8 bits (65), Expect = 0.99 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 6/41 (14%) Query: 68 KEYGIKSILNLRGKLP---ESWHKEEE--KAANDLGIQLIN 103 K GI++IL LRG P + W K E K A DL ++LI Sbjct: 94 KALGIRNILALRGDPPKGGDHWEKPEGGFKYALDL-VRLIR 133 >gnl|CDD|34925 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only]. Length = 172 Score = 28.8 bits (64), Expect = 1.0 Identities = 16/69 (23%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Query: 97 LGIQLINFPLSATRELNDEQIKQLISILKTAP--KPLLIHCKSGADRTGLASAVYLYIVA 154 L I P + ++ +I P PLLIHC +G R+ +A + +A Sbjct: 60 LHFNDIAEPDDGWIAPGEAHVRAIIDFADEWPRFAPLLIHCYAGISRS--TAAALIAALA 117 Query: 155 HYPKEEAHR 163 P + Sbjct: 118 LAPDMDETE 126 >gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 253 Score = 27.8 bits (62), Expect = 2.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Query: 163 RQLSMLYGHFPVLKTITMDITFEKITQL 190 R L++ YG LK I +DI K+T L Sbjct: 11 RDLNLYYGDKHALKDINLDIPKNKVTAL 38 >gnl|CDD|39429 KOG4228, KOG4228, KOG4228, Protein tyrosine phosphatase [Signal transduction mechanisms]. Length = 1087 Score = 27.3 bits (60), Expect = 2.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 130 PLLIHCKSGADRTGL 144 P+++HC +G RTG Sbjct: 732 PIVVHCSAGVGRTGC 746 >gnl|CDD|144247 pfam00581, Rhodanese, Rhodanese-like domain. Rhodanese has an internal duplication. This Pfam represents a single copy of this duplicated domain. The domain is found as a single copy in other proteins, including phosphatases and ubiquitin C-terminal hydrolases. Length = 106 Score = 27.5 bits (61), Expect = 3.0 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 102 INFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151 +N PL E + + K ++++C+SG +R+G A+A+ L Sbjct: 34 VNIPLPLPSLDKLESELEELGKKLDKDKTIVVYCESG-NRSGQAAALLLA 82 >gnl|CDD|28929 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways. The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active.. Length = 231 Score = 27.1 bits (60), Expect = 3.9 Identities = 7/16 (43%), Positives = 11/16 (68%) Query: 128 PKPLLIHCKSGADRTG 143 P+++HC +G RTG Sbjct: 166 SGPIVVHCSAGVGRTG 181 >gnl|CDD|30058 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology). But L-HYDs differ by having an L-enantio specificity and by lacking activity on possible natural substrates such as dihydropyrimidines. Allantoinase catalyzes the hydrolytic cleavage of the five-member ring of allantoin (5-ureidohydantoin) to form allantoic acid.. Length = 447 Score = 26.8 bits (59), Expect = 4.2 Identities = 6/28 (21%), Positives = 15/28 (53%) Query: 110 RELNDEQIKQLISILKTAPKPLLIHCKS 137 ++DEQ+++ + L L +H ++ Sbjct: 157 PAVDDEQLEEAMKELAKTGSVLAVHAEN 184 >gnl|CDD|107328 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. This subgroup includes the type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. Members of this subgroup are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however. Length = 312 Score = 26.8 bits (60), Expect = 4.3 Identities = 12/57 (21%), Positives = 27/57 (47%), Gaps = 7/57 (12%) Query: 52 IYRSAQPN----GTFIEYLKKEYGIKSI--LNLRGKLPESWHKEEEKAANDLGIQLI 102 ++++ Q + + +KK G+K++ + ES KE + A GI+++ Sbjct: 110 VFKTPQNDRLMAEAILADMKKR-GVKTVAFIGFSDAYGESGLKELKALAPKYGIEVV 165 >gnl|CDD|30817 COG0469, PykF, Pyruvate kinase [Carbohydrate transport and metabolism]. Length = 477 Score = 26.7 bits (59), Expect = 4.7 Identities = 12/47 (25%), Positives = 23/47 (48%) Query: 152 IVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKG 198 I+A P E R+L++++G +P+L T E + + + G Sbjct: 401 IIALTPNERVARRLALVWGVYPLLVEEKPTSTDEMVEEAVEKLLESG 447 >gnl|CDD|36011 KOG0792, KOG0792, KOG0792, Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms]. Length = 1144 Score = 26.6 bits (58), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Query: 130 PLLIHCKSGADRTG--LASAVYLYIVAH 155 P+L+HC +G RTG + L ++ H Sbjct: 1065 PILVHCSAGIGRTGVLILMETALCLLEH 1092 >gnl|CDD|37494 KOG2283, KOG2283, KOG2283, Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms, General function prediction only]. Length = 434 Score = 26.6 bits (58), Expect = 5.7 Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Query: 133 IHCKSGADRTGLASAVYLYIVAHYPK-EEAHRQLSMLYGHFPVLKTIT 179 +HCK+G RTG+ YL EEA + K +T Sbjct: 112 VHCKAGKGRTGVMICAYLIYSGISATAEEALDYFNEKRFDEGKSKGVT 159 >gnl|CDD|143879 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase. Length = 234 Score = 26.5 bits (59), Expect = 5.7 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 125 KTAPKPLLIHCKSGADRTG 143 P+++HC +G RTG Sbjct: 166 PPRSGPIVVHCSAGVGRTG 184 >gnl|CDD|119440 cd06578, HemD, Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in the human uroporphyrinogen-III synthase gene cause congenital erythropoietic porphyria, a recessive inborn error of metabolism also known as Gunther disease. Length = 239 Score = 26.5 bits (59), Expect = 6.0 Identities = 11/53 (20%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Query: 75 ILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127 +L R P E LG +++ PL L+D ++ ++ L Sbjct: 1 VLVTR---PRPQADELAALLEALGAEVLELPLIEIEPLDDAELDAALADLDEY 50 >gnl|CDD|144675 pfam01168, Ala_racemase_N, Alanine racemase, N-terminal domain. Length = 216 Score = 26.0 bits (58), Expect = 6.7 Identities = 14/61 (22%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Query: 115 EQIKQLISILKTAPKPLLIHCK--SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHF 172 EQ + L + +PL +H K +G R G + +L L HF Sbjct: 97 EQAEALSAAAAKLGRPLRVHLKVDTGMGRLGFTPEELPALAEA--LALPGLRLEGLMTHF 154 Query: 173 P 173 Sbjct: 155 A 155 >gnl|CDD|28903 cd00019, AP2Ec, AP endonuclease family 2; These endonucleases play a role in DNA repair. Cleave phosphodiester bonds at apurinic or apyrimidinic sites; the alignment also contains hexulose-6-phosphate isomerases, enzymes that catalyze the epimerization of D-arabino-6-hexulose 3-phosphate to D-fructose 6-phosphate, via cleaving the phosphoesterbond with the sugar. . Length = 279 Score = 26.1 bits (57), Expect = 7.8 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 7/67 (10%) Query: 75 ILNLRGKLPESWHK------EEEKAANDLGIQLINF-PLSATRELNDEQIKQLISILKTA 127 ++NL E K +E + +LGI+L+ F P S + +E +K++I L Sbjct: 69 LINLASPDKEKREKSIERLKDEIERCEELGIRLLVFHPGSYLGQSKEEGLKRVIEALNEL 128 Query: 128 PKPLLIH 134 Sbjct: 129 IDKAETK 135 >gnl|CDD|37597 KOG2386, KOG2386, KOG2386, mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification]. Length = 393 Score = 26.1 bits (57), Expect = 8.0 Identities = 15/69 (21%), Positives = 27/69 (39%) Query: 104 FPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHR 163 P + + + +K + K + + +HC G +RTG YL V Y EA + Sbjct: 100 VPRTELVDKFVKLVKGFVDDTKLDDELIGVHCTHGLNRTGYLICAYLADVGGYSSSEAIK 159 Query: 164 QLSMLYGHF 172 + + Sbjct: 160 RFADARPPG 168 >gnl|CDD|145647 pfam02608, Bmp, Basic membrane protein. This is a family of basic membrane lipoproteins form Borrelia and various putative lipoproteins form other bacteria. All of these proteins are outer membrane proteins and are thus antigenic in nature when possessed by the pathogenic members of the family. One protein, Bacillus subtilis med, is a transcriptional activator. Length = 302 Score = 25.8 bits (57), Expect = 8.9 Identities = 12/40 (30%), Positives = 18/40 (45%) Query: 63 IEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLI 102 I KKE+ I+ I +L + ++ K D G LI Sbjct: 25 IRRFKKEFNIELIYKESSELQDEDYEALLKLLKDQGYDLI 64 >gnl|CDD|35784 KOG0564, KOG0564, KOG0564, 5,10-methylenetetrahydrofolate reductase [Amino acid transport and metabolism]. Length = 590 Score = 25.7 bits (56), Expect = 9.2 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Query: 68 KEYGIKSILNLRGKLP---ESWHKEE 90 K GI++IL LRG P + W +EE Sbjct: 102 KALGIRNILALRGDPPIGQDKWVEEE 127 >gnl|CDD|36931 KOG1719, KOG1719, KOG1719, Dual specificity phosphatase [Defense mechanisms]. Length = 183 Score = 25.7 bits (56), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Query: 123 ILKTAP--KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165 I K A K + +HCK+G R+ A YL ++ E A + Sbjct: 102 IHKNASLGKTVYVHCKAGRTRSATVVACYLMQHKNWTPEAAVEHV 146 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.399 Gapped Lambda K H 0.267 0.0639 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,452,628 Number of extensions: 123651 Number of successful extensions: 488 Number of sequences better than 10.0: 1 Number of HSP's gapped: 484 Number of HSP's successfully gapped: 44 Length of query: 207 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 118 Effective length of database: 4,340,536 Effective search space: 512183248 Effective search space used: 512183248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.2 bits)