RPSBLAST alignment of GI: 254780898 and protein with PDBid: 2g6z

>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211
 Score = 38.2 bits (88), Expect = 0.001
 Identities = 20/119 (16%), Positives = 46/119 (38%), Gaps = 7/119 (5%)

Query: 47  VVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPL 106
           ++P  +Y  +  + +  E+L     I ++LN+  +  E+             I + +   
Sbjct: 9   ILPF-LYLGSAYHASKCEFLAN-LHITALLNVSRRTSEACMTHLHY----KWIPVEDSHT 62

Query: 107 SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQL 165
           +       E I  +  + +   K +L+H ++G  R+      YL     +  +EA   +
Sbjct: 63  ADISSHFQEAIDFIDCVREKGGK-VLVHSEAGISRSPTICMAYLMKTKQFRLKEAFDYI 120