BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 426 bits (1094), Expect = e-121, Method: Compositional matrix adjust. Identities = 207/207 (100%), Positives = 207/207 (100%) Query: 1 MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60 MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG Sbjct: 1 MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNG 60 Query: 61 TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120 TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL Sbjct: 61 TFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQL 120 Query: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM Sbjct: 121 ISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITM 180 Query: 181 DITFEKITQLYPNNVSKGDTEQPMNAT 207 DITFEKITQLYPNNVSKGDTEQPMNAT Sbjct: 181 DITFEKITQLYPNNVSKGDTEQPMNAT 207 >gi|254781080|ref|YP_003065493.1| hypothetical protein CLIBASIA_04910 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 25.8 bits (55), Expect = 0.65, Method: Compositional matrix adjust. Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 15/65 (23%) Query: 51 EIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATR 110 +IY A+ G ++ IK IL+LR K + W +EE Q+++ L A Sbjct: 36 DIYGEAKATGFDVK------AIKKILSLRKKDEKQWMEEE---------QILDVYLRALG 80 Query: 111 ELNDE 115 L DE Sbjct: 81 MLKDE 85 >gi|254780215|ref|YP_003064628.1| hypothetical protein CLIBASIA_00500 [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 24.6 bits (52), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/63 (23%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Query: 109 TRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG-----LASAVYLYIVAHYPKEEAHR 163 +R +D+ L +K P P +IHC S + + L + + +PK +A R Sbjct: 130 SRSADDDMAAILQEEMKKGPFPFVIHCFSSSQKLADICLELGGYISFTGMITFPKYDALR 189 Query: 164 QLS 166 ++ Sbjct: 190 AIA 192 >gi|254780147|ref|YP_003064560.1| 50S ribosomal protein L11 [Candidatus Liberibacter asiaticus str. psy62] Length = 142 Score = 24.6 bits (52), Expect = 1.4, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Query: 53 YRSAQPNGTFIEYLKKEYGIKSILNLRGK 81 + +QP +F +LKKE GIKS L GK Sbjct: 69 FTMSQPPVSF--FLKKEVGIKSGSKLPGK 95 >gi|254780558|ref|YP_003064971.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 23.5 bits (49), Expect = 2.5, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Query: 14 FYIKIL--LGVLVL-CA--VSLGLYFLTITTFTQNFHAVVPHEIYRSAQP 58 FY +I+ LG+ +L C V L +Y L F ++P+ + R P Sbjct: 19 FYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAP 68 >gi|254780689|ref|YP_003065102.1| flagellar motor switch protein G [Candidatus Liberibacter asiaticus str. psy62] Length = 345 Score = 23.1 bits (48), Expect = 3.3, Method: Compositional matrix adjust. Identities = 12/52 (23%), Positives = 26/52 (50%) Query: 132 LIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDIT 183 ++HC S R + + L + P+E A + S++ +LKT ++++ Sbjct: 290 ILHCLSNRQRKIIEENIVLNDSSIAPREVAMARRSIVQEAISLLKTNKIELS 341 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.138 0.399 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 130,975 Number of Sequences: 1233 Number of extensions: 5305 Number of successful extensions: 29 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 10 length of query: 207 length of database: 328,796 effective HSP length: 70 effective length of query: 137 effective length of database: 242,486 effective search space: 33220582 effective search space used: 33220582 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 36 (18.5 bits)