HHsearch alignment for GI: 254780900 and conserved domain: COG4747

>COG4747 ACT domain-containing protein [General function prediction only].
Probab=95.07  E-value=0.13  Score=31.24  Aligned_cols=60  Identities=18%  Similarity=0.252  Sum_probs=44.9

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEEECCHHHHHHHHHHHHCCC
Q ss_conf             7999924888748999999886699578888226778776135999921048899999999862383
Q gi|254780900|r  355 FIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKS  421 (438)
Q Consensus       355 YLRl~v~DkpGVLa~It~ilak~~ISIesi~Q~~~~~~~~~~~IViiTh~~~e~~i~~ai~~i~~l~  421 (438)
T Consensus        71 VlaVEmeD~PG~l~~I~~vl~d~diNldYiYAFv~e--k~KAlli~r-----~ed~d~~~~aLed~g  130 (142)
T COG4747          71 VLAVEMEDVPGGLSRIAEVLGDADINLDYIYAFVTE--KQKALLIVR-----VEDIDRAIKALEDAG  130 (142)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEEEC--CCEEEEEEE-----HHHHHHHHHHHHHCC
T ss_conf             899981588870889999874148672014565303--733799998-----457788999999759