HHsearch alignment for GI: 254780900 and conserved domain: TIGR01546

>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II; InterPro: IPR006436 This family describes the type II glyceraldehyde-3-phosphate dehydrogenases which are limited to archaea. These enzymes catalyze the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. In archaea, either NAD or NADP may be utilised as the cofactor.; GO: 0008943 glyceraldehyde-3-phosphate dehydrogenase activity, 0050661 NADP binding, 0051287 NAD binding, 0006096 glycolysis, 0005737 cytoplasm.
Probab=93.75  E-value=0.051  Score=34.18  Aligned_cols=147  Identities=16%  Similarity=0.239  Sum_probs=76.8

Q ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCC------CCCCC-------------CCCCCHHCCCHHH
Q ss_conf             9998256678999999999899999973996599999826852------00278-------------8771022078889
Q gi|254780900|r    7 VGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKN------IDRGI-------------DCLRYEWFDDPLI   67 (438)
Q Consensus         7 IgiiG~G~VG~~~~~~l~~~~~~l~~~~g~~i~i~~i~~r~~~------k~~~~-------------~~~~~~~~~d~~~   67 (438)
T Consensus         1 VgiNGYGTIGKRVAdAv~kQ---------dDMklvGVtKtsPdfEA~~A~e~Gi~~Y~~~~e~~~~FEeaGi~V~GT~ed   71 (335)
T TIGR01546         1 VGINGYGTIGKRVADAVIKQ---------DDMKLVGVTKTSPDFEAFIAKEKGIDIYVAAEEFLKKFEEAGIKVAGTVED   71 (335)
T ss_pred             CCCCCCCCCCHHHHHHHCCC---------CCCEEEEECCCCCCHHHHHHHHCCCEEEECCHHHHHHHHHCCCEEECCHHH
T ss_conf             92345356222444441369---------982377411689838888887679326426704431254368704425787


Q ss_pred             HHCCCCCCEEEECCC-CCCCCHHH-HHHHHHHCCEEEEE--ECHHHHH-HHHHHHHHHHHHCCCEE-E-EECCCCCHHHH
Q ss_conf             844889989998648-88851135-78888632702885--0417788-76899998753139669-9-60564530131
Q gi|254780900|r   68 MAGEADIDVFVELIG-GEDYPAYD-AVRIALMRGCHVVT--ANKALIA-SHGKDLALLAQKNNAIL-N-FEAAVAGGIPI  140 (438)
Q Consensus        68 li~~~~IDvVVEliG-g~~~pA~~-~i~~AL~~GkhVVT--ANKallA-~~g~eL~~lA~~~gv~l-~-~easV~ggiPi  140 (438)
T Consensus        72 L~e--k~DIvVD~TP~G~GaknK~G~Y---ek~g~kAiFQGGEKaeva~~SF~a~~NY~~alGKdY~RVVSCNTTg---L  143 (335)
T TIGR01546        72 LLE--KVDIVVDATPEGVGAKNKEGIY---EKLGLKAIFQGGEKAEVADISFSALANYEEALGKDYVRVVSCNTTG---L  143 (335)
T ss_pred             HHH--HCCEEEECCCCCCCCCCCCHHH---HHHCCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHH---H
T ss_conf             310--4288885687874432311036---6507613643783012442125555106763178638998416267---8


Q ss_pred             HHHHHHHHHCCCCEEEEEEECCCHHHHEEHHHCCCCCHHHH
Q ss_conf             89998764128620343331420000000010068778899
Q gi|254780900|r  141 IRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDC  181 (438)
Q Consensus       141 i~~l~~~l~~~~i~~i~GIlnGT~nyIL~~m~~~g~~f~~a  181 (438)
T Consensus       144 ~RTln~ind~~~v~kVrAv-----------~vRRaADp~~v  173 (335)
T TIGR01546       144 VRTLNAINDLSKVEKVRAV-----------MVRRAADPKEV  173 (335)
T ss_pred             HHHHHHHHHHCCCCEEEEE-----------EEECCCCHHHC
T ss_conf             8766433233061058999-----------98537893342