>TIGR01693 UTase_glnD protein-P-II uridylyltransferase; InterPro: IPR010043 This entry describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for signal-transduction protein PII, and acts as the sensory component of the nitrogen regulation (ntr) system . The ntr system modulates nitrogen metabolism in response to the prevailing nitrogen source and the requirements of the cell. During nitrogen fixation, ammonia and 2-oxoglutarate can be used to produce glutamate. The activity of the PII protein is stimulated by glutamine and inhibited by 2-oxoglutarate. Under glutamate-limiting conditions, PII is uridylylated by GlnD leading to the activation of glutamate synthetase and to the stimulation of NtrC-dependent promoters. Under high concentrations of fixed nitrogen, PII is de-uridylylated leading to the inactivation of the glutamate synthetase pathway and switching off NtrC-dependent promoters . Not all homologues of PII share the property of uridylyltransferase modification on the characteristic Tyr residue (see IPR002332 from INTERPRO), but the modification site is preserved in the PII homologue of all species with a member of this family. ; GO: 0008773 [protein-PII] uridylyltransferase activity, 0006807 nitrogen compound metabolic process.

Probab=91.80 E-value=0.82 Score=25.71 Aligned_cols=108 Identities=10% Similarity=0.126 Sum_probs=68.8 Q ss_pred EECCCCCCC---CHHHHHHHHHHHHHCCCC--CCCC---CCCCCCCCC------CCCCCCCCHHHCCCCEEEEEEE--CC Q ss_conf 726876661---020688999999741777--7655---666678310------0234438853446532799992--48 Q gi|254780900|r 299 TGPGAGGSA---TASAVLGDICSIAKTNTQ--KSVS---WALGKESSS------FSVIHCDGVYEEEKEYFIRLTI--RN 362 (438) Q Consensus 299 ~G~GAG~~~---TAsaV~sDli~i~~~~~~--~~~~---~~~~~~~~~------~~~~~~~~~~~~~~~yYLRl~v--~D 362 (438) T Consensus 761 ~G~~~~~~~~R~r~~~~~~~~~~~L~~~~~r~~~~~~~r~~~~r~~~hGvPvtrF~~~p~V~~~~~as~~~T~~E~~a~D 840 (903) T TIGR01693 761 NGSPVEEERVRARLQELRQGLVDVLSGLKKRDPDTIKARRARRRQLQHGVPVTRFAVPPRVTILNTASKKATVMEVRALD 840 (903) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCEEEEEEECC T ss_conf 16870046788999999999999983544577200542566667666888510245787124344215454488886378 Q ss_pred CCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEEECCHH Q ss_conf 8874899999988669957888822677877613599992104889 Q gi|254780900|r 363 FEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGK 408 (438) Q Consensus 363 kpGVLa~It~ilak~~ISIesi~Q~~~~~~~~~~~IViiTh~~~e~ 408 (438) T Consensus 841 rpGLL~~v~~~l~~~~l~i~~AkI--~T~GE~A~D~Fyvt~~~g~~ 884 (903) T TIGR01693 841 RPGLLAAVGKTLEELGLSIQSAKI--TTLGEKAEDVFYVTDLFGLK 884 (903) T ss_pred CCCHHHHHHHHHHHCCCCEEEEEE--ECCCCCEEEEEEEECCCCCC T ss_conf 646289999998750675343456--05466458877640545752

HHsearch alignment for GI: 254780900 and conserved domain: TIGR01693