>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains. The ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) encoded by the hom gene of Bacillus subtilis and other related sequences. HSDH reduces aspartate semi-aldehyde to the amino acid homoserine, one that is required for the biosynthesis of Met, Thr, and Ile from Asp. Neither the enzyme nor the aspartate pathway is found in the animal kingdom. This mostly bacterial HSDH group has a C-terminal ACT domain and is believed to be involved in enzyme regulation. A C-terminal deletion in the Corynebacterium glutamicum HSDH abolished allosteric inhibition by L-threonine. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=99.82 E-value=5.2e-20 Score=160.50 Aligned_cols=79 Identities=24% Similarity=0.410 Sum_probs=75.4 Q ss_pred EEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEEECCHHHHHHHHHHHHCCCCCCCCCEEEECC Q ss_conf 27999924888748999999886699578888226778776135999921048899999999862383000473576626 Q gi|254780900|r 354 YFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIE 433 (438) Q Consensus 354 yYLRl~v~DkpGVLa~It~ilak~~ISIesi~Q~~~~~~~~~~~IViiTh~~~e~~i~~ai~~i~~l~~v~~~~~~IRIE 433 (438) T Consensus 1 yYlRl~v~D~pGVla~It~i~a~~~ISI~sv~Q~~~~~-~~~a~iviiTh~~~e~~i~~al~~i~~l~~v~~~~~~iRIE 79 (79) T cd04881 1 YYLRLTVKDKPGVLAKITGILAEHGISIESVIQKEADG-GETAPVVIVTHETSEAALNAALAEIEALDAVQGVPSVIRVE 79 (79) T ss_pred CEEEEEECCCCCHHHHHHHHHHHCCCCHHHEEECCCCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCCEEEEEC T ss_conf 98999807878579999999997498876515157678-99655899953250999999999997498636787189609

HHsearch alignment for GI: 254780900 and conserved domain: cd04881