>cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2). Included in this CD is the second of two ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2). The first or N-terminal ACT domain of these proteins cluster with the ThrA-like ACT 1 domains (ACT_AKi-HSDH-ThrA-like_1) which includes the threonine-sensitive archaeal Methanococcus jannaschii aspartokinase ACT 1 domain. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=91.01 E-value=1.2 Score=24.51 Aligned_cols=51 Identities=14% Similarity=0.190 Sum_probs=38.6 Q ss_pred CCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEEECCHHHHHHHHHHHHC Q ss_conf 48887489999998866995788882267787761359999210488999999998623 Q gi|254780900|r 361 RNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNG 419 (438) Q Consensus 361 ~DkpGVLa~It~ilak~~ISIesi~Q~~~~~~~~~~~IViiTh~~~e~~i~~ai~~i~~ 419 (438) T Consensus 12 ~~~~GvaariF~aLa~~~INI~mIsQgs---SE~sIs~~-----V~~~d~~~Av~alh~ 62 (66) T cd04924 12 RGTPGVAGRVFGALGKAGINVIMISQGS---SEYNISFV-----VAEDDGWAAVKAVHD 62 (66) T ss_pred CCCCCHHHHHHHHHHHCCCCEEEEECCC---CCCEEEEE-----ECHHHHHHHHHHHHH T ss_conf 7896779999999997799789997377---63079999-----948999999999998

HHsearch alignment for GI: 254780900 and conserved domain: cd04924