HHsearch alignment for GI: 254780901 and conserved domain: COG2022

>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism].
Probab=93.39  E-value=0.71  Score=26.78  Aligned_cols=103  Identities=25%  Similarity=0.344  Sum_probs=65.6

Q ss_pred             CCCCHHHCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC-H
Q ss_conf             196677718995561487999999999997799799994078861528999999999769947998078743366889-7
Q gi|254780901|r   61 LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN-P  139 (600)
Q Consensus        61 L~p~l~~l~~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~-~  139 (600)
T Consensus       105 Vi~d~~tLlPD~~et---l~Aae~L---v~eGF~VlPY~~dD-------~v~arrLee~GcaavMPl~aPIGSg~G~~n~  171 (262)
T COG2022         105 VIGDEKTLLPDPIET---LKAAEQL---VKEGFVVLPYTTDD-------PVLARRLEEAGCAAVMPLGAPIGSGLGLQNP  171 (262)
T ss_pred             EECCCCCCCCCHHHH---HHHHHHH---HHCCCEEEECCCCC-------HHHHHHHHHCCCEEECCCCCCCCCCCCCCCH
T ss_conf             936876548875789---9999999---86798885036887-------8999999864966863356656678675788


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEE
Q ss_conf             89887420268689996488762345555541798279
Q gi|254780901|r  140 SLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVI  177 (600)
Q Consensus       140 ~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvI  177 (600)
T Consensus       172 ~~l~iiie~-a~VPviVDAGiG~pSdAa~aMElG~DaV  208 (262)
T COG2022         172 YNLEIIIEE-ADVPVIVDAGIGTPSDAAQAMELGADAV  208 (262)
T ss_pred             HHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHHCCCEE
T ss_conf             999999973-8998898679897668899986055432