HHsearch alignment for GI: 254780901 and conserved domain: LOAD_cdc45

>LOAD_cdc45 consensus.
Probab=95.58  E-value=0.094  Score=33.67  Aligned_cols=88  Identities=16%  Similarity=0.363  Sum_probs=60.9

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCC-CHHHHHHH
Q ss_conf             79979999407886152899999999976994799807874336688978988742026868999648876-23455555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST-SYDALQYA  169 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~-~~e~i~~a  169 (600)
T Consensus        13 ~r~sVlilva~DvDALCA~kILt~Llk~D~I~y~l-vP---V~Gy~dL~~~~~e~~~~-~~~vilIncGg~~DL~~~l~-   86 (578)
T LOAD_cdc45       13 SRSSVLLVVALDVDALCATKILQALFKCDHIQYTI-VP---VSGYSELERAFLEHQED-IKYVILINCGAVVDLLETLQ-   86 (578)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEE-EE---ECCHHHHHHHHHHHCCC-CCEEEEEECCCCEEHHHHCC-
T ss_conf             88769999828817989999999998544887589-98---47899999999973677-54799990687327888609-


Q ss_pred             HHCCCCEEEECCCCC
Q ss_conf             417982799615447
Q gi|254780901|r  170 TNQGIDVIVIDHHQV  184 (600)
Q Consensus       170 ~~~GidvIVtDHH~~  184 (600)
T Consensus        87 ~~~~~~vyViDsHRP  101 (578)
T LOAD_cdc45       87 IPPDVIIFVIDSHRP  101 (578)
T ss_pred             CCCCCEEEEEECCCC
T ss_conf             998718999347898