HHsearch alignment for GI: 254780901 and conserved domain: PRK00252

>PRK00252 alaS alanyl-tRNA synthetase; Reviewed.
Probab=90.63  E-value=1.5  Score=24.17  Aligned_cols=96  Identities=22%  Similarity=0.293  Sum_probs=37.0

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHHCEEEEEEECCCCEE---EEEEEC-CCCCCHHHHHHHHCCCCCCCCCCCCC-CC
Q ss_conf             50262057858122222278998842010799886379837---999864-89861888888530335301156532-22
Q gi|254780901|r  369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG---IGSGRS-IEGFDIGKMVSFAVEEGILVKGGGHA-MA  443 (600)
Q Consensus       369 ~~ivv~~~~wh~GViGIVAsrL~e~y~kP~iv~s~~~dg~~---kGS~RS-i~g~~l~~~l~~~~~~~ll~~~GGH~-~A  443 (600)
T Consensus       761 ~~i~~~~~~~d~k~Lr~l~~~l~~k~~~~vvil~s~~~~K~~~vv~vs~~~~~~i~A~~lvk~i~~~-~gGkGGGkp~~A  839 (864)
T PRK00252        761 KVLAAQLDGVDAKDLRTLADDLKNKLGSGVVVLASVADGKVSLVVGVTKDLTKGLKAGDLVKELAAI-VGGKGGGRPDMA  839 (864)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEEECCCEEEEEEEECHHHCCCCCHHHHHHHHHHH-CCCCCCCCHHHE
T ss_conf             9999990699999999999999965699699999803990899999897872798889999999986-599657935746


Q ss_pred             CCEEECCCCHHHHHHHHHHHHH
Q ss_conf             3146422215889999999998
Q gi|254780901|r  444 AGLTVERVNFGRLCDFFQKFAH  465 (600)
Q Consensus       444 aG~ti~~~~l~~f~~~l~~~~~  465 (600)
T Consensus       840 QgGG~~~~~l~~al~~a~~~l~  861 (864)
T PRK00252        840 QAGGKDPAKLDEALAAVKEWLK  861 (864)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHH
T ss_conf             6389987899999999999998