HHsearch alignment for GI: 254780901 and conserved domain: PRK02947

>PRK02947 hypothetical protein; Provisional.
Probab=95.94  E-value=0.19  Score=31.20  Aligned_cols=153  Identities=16%  Similarity=0.246  Sum_probs=88.9

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC--CEEEEEC---------------CCCCCCC
Q ss_conf             5614879999999999977997999940788615289999999997699--4799807---------------8743366
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV--NANMYIP---------------DRIVDGY  135 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~--~v~~~IP---------------~R~~eGY  135 (600)
T Consensus        22 ~q~~~I~~Aa~~ia~si~~gg~i~~fGt----G-HS~~~a~E~f~RAGGla~~~pI~~~~l~~~~g~~~s~~~ER-~~g~   95 (247)
T PRK02947         22 TQADAIKQAADLVADSIANGGRIYVFGT----G-HSHMAAEEVFYRAGGLAPFNPILEPSLMLHEGAVASSYLER-IEGY   95 (247)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECC----C-CHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHC-CCCH
T ss_conf             9999999999999999975997999888----5-16489998741147643313003411025478666531222-5509


Q ss_pred             CCCHHHHHHHHHCCCC-EEEEECCCCC--CHHHHHHHHHCCCCEEEEC---C-------CCCCC------------CCCC
Q ss_conf             8897898874202686-8999648876--2345555541798279961---5-------44765------------5567
Q gi|254780901|r  136 GPNPSLMEKFINEGAQ-LIITVDCGST--SYDALQYATNQGIDVIVID---H-------HQVKS------------EEIP  190 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~-LiItvD~Gi~--~~e~i~~a~~~GidvIVtD---H-------H~~~~------------~~p~  190 (600)
T Consensus        96 a--~~il~~~~i~~~Dvlii~SnSG~N~~pVE~A~~ak~~G~~VIaiTS~~~s~~~~srH~SGkkL~d~aDiviDN~~p~  173 (247)
T PRK02947         96 A--KLILDRYPIRPGDVLIIVSNSGRNAVPIEMALEAKERGAKVIAVTSLAYSKSVASRHSSGKRLYEVADVVIDNGAPK  173 (247)
T ss_pred             H--HHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCEEHHHCCEEEECCCCC
T ss_conf             9--99998679999988999967877768999999999869969999667881678998976671156366786579998


Q ss_pred             CEEEEC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             256523-7888864334430478899999999999702148876
Q gi|254780901|r  191 AYALVN-PNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP  233 (600)
Q Consensus       191 a~aivN-P~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~  233 (600)
T Consensus       174 GDA~l~i~g~~~kvgp~STi~g~~i~n~i~~e~~~~L~~~G~~p  217 (247)
T PRK02947        174 GDAVLEIEGLEAKVGPTSTVVGVAILNAIFAEAAEELVERGIDP  217 (247)
T ss_pred             CCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             76589878977775757789999999999999999999779999