HHsearch alignment for GI: 254780901 and conserved domain: cd04489

>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit. E. coli ExoVII is composed of two non-identical subunits. E. coli ExoVII is a single-strand-specific exonuclease which degrades ssDNA from both 3-prime and 5-prime ends. ExoVII plays a role in methyl-directed mismatch repair in vivo. ExoVII may also guard the genome from mutagenesis by removing excess ssDNA, since the build up of ssDNA would lead to SOS induction and PolIV-dependent mutagenesis.
Probab=95.25  E-value=0.17  Score=31.56  Aligned_cols=71  Identities=21%  Similarity=0.416  Sum_probs=49.6

Q ss_pred             EEEEEEEECCCEEEEEEECCCCCEEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEC
Q ss_conf             9988888479649999984998779999977878701235530699879999997665457811058999980111
Q gi|254780901|r  517 KLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV  592 (600)
Q Consensus       517 ~i~~~r~vGk~Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~~s~QL~I~Di~p~  592 (600)
T Consensus         7 EIs~~~~~~sGh~Yf~LkD~~-a~i~~v~~~~~~~~~~--~~~~~G~~V~v~g--~~~~y~~~G~~ql~v~~i~~~   77 (78)
T cd04489           7 EISNLKRPSSGHLYFTLKDED-ASIRCVMWRSNARRLG--FPLEEGMEVLVRG--KVSFYEPRGGYQLIVEEIEPA   77 (78)
T ss_pred             EECCCEECCCCEEEEEEECCC-EEEEEEEEHHHHHHCC--CCCCCCCEEEEEE--EEEEECCCCEEEEEEEEEEEC
T ss_conf             988558289963999994788-1999999667883279--9988998999999--999998984099999999978