HHsearch alignment for GI: 254780901 and conserved domain: pfam05690

>pfam05690 ThiG Thiazole biosynthesis protein ThiG. This family consists of several bacterial thiazole biosynthesis protein G sequences. ThiG, together with ThiF and ThiH, is proposed to be involved in the synthesis of 4-methyl-5-(b-hydroxyethyl)thiazole (THZ) which is an intermediate in the thiazole production pathway.
Probab=93.97  E-value=0.63  Score=27.20  Aligned_cols=103  Identities=25%  Similarity=0.347  Sum_probs=70.9

Q ss_pred             CCCCHHHCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC-CH
Q ss_conf             19667771899556148799999999999779979999407886152899999999976994799807874336688-97
Q gi|254780901|r   61 LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGP-NP  139 (600)
Q Consensus        61 L~p~l~~l~~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl-~~  139 (600)
T Consensus        97 Vi~D~~~LlPD~~et---l~Aae~L---v~eGF~VlpY~~~D-------~v~akrLed~Gc~avMPlgsPIGSg~Gl~n~  163 (246)
T pfam05690        97 VIGDSKTLLPDPIET---LKAAEIL---VKEGFTVLPYTTDD-------PVLARRLEEAGCAAVMPLGAPIGSGLGLRNP  163 (246)
T ss_pred             EECCCCCCCCCHHHH---HHHHHHH---HHCCCEEEEECCCC-------HHHHHHHHHCCCEEEEECCCCCCCCCCCCCH
T ss_conf             826988779887899---9999999---97899898861799-------8999999875984986224401368886899


Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEE
Q ss_conf             89887420268689996488762345555541798279
Q gi|254780901|r  140 SLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVI  177 (600)
Q Consensus       140 ~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvI  177 (600)
T Consensus       164 ~~l~~i~e~-~~vPvIVDAGiG~pS~Aa~aMElG~DaV  200 (246)
T pfam05690       164 ENLRIIIEE-ADVPVIVDAGIGTPSDAAQAMELGADAV  200 (246)
T ss_pred             HHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHCCCCEE
T ss_conf             999999996-7998898489896788999997456777