HHsearch alignment of GI: 254780901 and MMDB domain: 1f0k_A_1-171_340-364

>1f0k_A (A:1-171,A:340-364) MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli}
Probab=92.49  E-value=0.88  Score=25.57  Aligned_cols=95  Identities=11%  Similarity=0.068  Sum_probs=65.3

Q ss_pred             HCCCCEEEEECCCCCHHHHHH-HHHHHHHHCCCCEEEEECCCCC-------CCCC---C--------C------------
Q ss_conf             779979999407886152899-9999999769947998078743-------3668---8--------9------------
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVA-LMMRFLSHCSVNANMYIPDRIV-------DGYG---P--------N------------  138 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitsta-il~~~L~~~g~~v~~~IP~R~~-------eGYG---l--------~------------  138 (600)
                      .++.||++++. ..-|.+..+ -|.+.|...|.+|.++.+.+-.       +|+-   +        .            
T Consensus         4 ~~~mrIL~v~~-~~gG~~~~~~~la~~L~~~G~eV~v~~~~~~~~~~~~~~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~   82 (196)
T 1f0k_A            4 GQGKRLMVMAG-GTGGHVFPGLAVAHHLMAQGWQVRWLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIF   82 (196)
T ss_dssp             ---CEEEEECC-SSHHHHHHHHHHHHHHHTTTCEEEEEECTTSTHHHHGGGGTCEEEECCCCCCTTCCHHHHHTCHHHHH
T ss_pred             CCCCEEEEECC-CCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             99987999917-84687999999999999788979999788706554444429708998457867777899998699999


Q ss_pred             ---HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             ---789887420268689996488762345555541798279961544765
Q gi|254780901|r  139 ---PSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       139 ---~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                         ....+-+.+..+|+|++ .+...+.-....++..|+.+|++.|+....
T Consensus        83 ~~~~~l~~~l~~~kpDiI~~-~~~~~~~~~~~~~~~~~ip~v~~~h~~~~~  132 (196)
T 1f0k_A           83 NAWRQARAIMKAYKPDVVLG-MGGYVSGPGGLAAWSLGIPVVLHEQNGIAG  132 (196)
T ss_dssp             HHHHHHHHHHHHHCCSEEEE-CSSTTHHHHHHHHHHTTCCEEEEECSSSCC
T ss_pred             HHHHHHHHHHHCCCCCEEEE-CCCCCHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99999999975029978997-897341999999986699889982687743