HHsearch alignment of GI: 254780901 and MMDB domain: 2dri_A_1-104_237-271

>2dri_A (A:1-104,A:237-271) D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli}
Probab=92.54  E-value=0.87  Score=25.61  Aligned_cols=103  Identities=13%  Similarity=0.128  Sum_probs=72.3

Q ss_pred             CCCEEEEECCCCCHHHHHH--HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH-HHHHH
Q ss_conf             9979999407886152899--99999997699479980787433668897898874202686899964887623-45555
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVA--LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY-DALQY  168 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitsta--il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~-e~i~~  168 (600)
                      +.+|++.-..-.|...+..  =+.+.++..|.++.++-.++-.+   --.+.++.+.+.+++-+|..-++.+.. +.+..
T Consensus         1 K~tIgvi~~~~~~~f~~~i~~gi~~~a~~~G~~l~i~~~~~~~~---~~~~~i~~li~~~vdgiIi~~~~~~~~~~~l~~   77 (139)
T 2dri_A            1 KDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNLVVLDSQNNPA---KELANVQDLTVRGTKILLINPTDSDAVGNAVKM   77 (139)
T ss_dssp             CCEEEEEESCSSSHHHHHHHHHHHHHHHHHTCEEEEEECTTCHH---HHHHHHHHHTTTTEEEEEECCSSTTTTHHHHHH
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             98899992889898999999999999998599899995899999---999999999861876443212222231689999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCEEEECCC
Q ss_conf             541798279961544765556725652378
Q gi|254780901|r  169 ATNQGIDVIVIDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       169 a~~~GidvIVtDHH~~~~~~p~a~aivNP~  198 (600)
                      +.+.|+-||..|.+......+ ++...||.
T Consensus        78 l~~~gIPvV~id~~~~~~~~~-~~v~~d~~  106 (139)
T 2dri_A           78 ANQANIPVITLDRQATKGEVV-SHIASDPD  106 (139)
T ss_dssp             HHHTTCCEEEESSCCSSSCCS-EEEEECHH
T ss_pred             HHHCCCCCCCCCCCCCCCCCC-EEEEECHH
T ss_conf             986377532356555545542-37852299