HHsearch alignment of GI: 254780901 and MMDB domain: 2vbc_A_324-425_465-481

>2vbc_A (A:324-425,A:465-481) Dengue 4 NS3 FULL-length protein; transmembrane, RNA replication, NS2B-NS3 protease; 3.15A {Dengue virus type 4}
Probab=92.26  E-value=0.93  Score=25.36  Aligned_cols=88  Identities=14%  Similarity=0.047  Sum_probs=64.1

Q ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             99999779979999407886152899999999976994799807874336688978988742026868999648876234
Q gi|254780901|r   85 IVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYD  164 (600)
Q Consensus        85 i~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e  164 (600)
                      +......+++++||    |.....+--|++.|+..|..+..+-...       -..+++.+.....+.||+.|+.     
T Consensus        25 ~~~~~~~~~~~lIF----~~s~~~ae~l~~~L~~~g~~~~~lhg~~-------R~~~~~~f~~g~~~vLVaTdil-----   88 (119)
T 2vbc_A           25 FDWITDYQGKTVWF----VPSIKAGNDIANCLRKSGKRVIQLSRKT-------FDTEYPKTKLTDWDFVVTTDIS-----   88 (119)
T ss_dssp             CHHHHHCCSCEEEE----CSSHHHHHHHHHHHHTTTCCEEEECTTT-------HHHHTHHHHHSCCSEEEECGGG-----
T ss_pred             HHHHHHCCCCEEEE----ECCHHHHHHHHHHHHHCCCEEEEECCCC-------CHHHHHHCCCCCCEEEEECHHH-----
T ss_conf             99998568999999----5988999999999973898299927999-------8777824679995399986587-----


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCEEEEC-CCCCCCCCCCC
Q ss_conf             55555417982799615447655567256523-78888643344
Q gi|254780901|r  165 ALQYATNQGIDVIVIDHHQVKSEEIPAYALVN-PNRLDDLSGQG  207 (600)
Q Consensus       165 ~i~~a~~~GidvIVtDHH~~~~~~p~a~aivN-P~~~~~~~p~~  207 (600)
                            +.|+|+            | ...||| |.+.|+.|-|.
T Consensus        89 ------~rGiDi------------~-v~~VI~~~~~~~~~~~~~  113 (119)
T 2vbc_A           89 ------EMGANF------------R-AGRVIDPPAQEDDQYVFS  113 (119)
T ss_dssp             ------GTTCCC------------C-CSEEEECCCSSCEEEEEC
T ss_pred             ------HHCCCC------------C-CEEEEECCCCCCCEEEEC
T ss_conf             ------618535------------9-179997988887489977