HHsearch alignment of GI: 254780901 and MMDB domain: 3f2b_A_1-110

>3f2b_A (A:1-110) DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A*
Probab=91.49  E-value=1.1  Score=24.75  Aligned_cols=78  Identities=10%  Similarity=0.058  Sum_probs=51.4

Q ss_pred             EEEEEEEEC-C-C--EEEEEEECCCCCEEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEC
Q ss_conf             998888847-9-6--49999984998779999977878701235530699879999997665457811058999980111
Q gi|254780901|r  517 KLQSIRVVN-L-A--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV  592 (600)
Q Consensus       517 ~i~~~r~vG-k-~--Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~~s~QL~I~Di~p~  592 (600)
                      .|.+.+... + +  =..+.|.+..| .+++++|...+....-......|..+-+-++++.+.|+|.  +|+.+..+.|+
T Consensus        25 ~V~~~~~~~tK~G~~~~~~~l~D~tg-~ie~~~F~~~~~~~~~~~~l~~g~~v~v~G~v~~~~~~~~--~~l~v~~i~~i  101 (110)
T 3f2b_A           25 YVFDAEVSELKSGRTLLTMKITDYTN-SILVKMFSRDKEDAELMSGVKKGMWVKVRGSVQNDTFVRD--LVIIANDLNEI  101 (110)
T ss_dssp             EEEEEEEEECTTSCEEEEEEEECSSC-EEEEEEECSSHHHHHHHHTCCTTCEEEEEEEEEEETTTTE--EEEEEEEEEEE
T ss_pred             EEEEEEEEEECCCCEEEEEEEEECCC-CEEEEEECCCCCHHHHHHHCCCCCEEEEEEEEECCCCCCC--EEEEEEEEEEC
T ss_conf             99877878705898899999982788-6899995587432889850679968999998851577774--27872123654


Q ss_pred             CCCCC
Q ss_conf             31126
Q gi|254780901|r  593 EGHHF  597 (600)
Q Consensus       593 e~~~~  597 (600)
                      +...-
T Consensus       102 ~~~~~  106 (110)
T 3f2b_A          102 AANER  106 (110)
T ss_dssp             CCCCC
T ss_pred             CCCCC
T ss_conf             77554