HHsearch alignment of GI: 254780901 and MMDB domain: 3kf6_A_

>3kf6_A (A:) Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe}
Probab=94.58  E-value=0.41  Score=28.12  Aligned_cols=86  Identities=12%  Similarity=0.120  Sum_probs=63.9

Q ss_pred             CCCCCEEEECCEEEEEEEEEC--------CCEEEEEEECCCCCEEEEEEECCCCCCHHH-HHHCCCCCEEEEEEEEEEEE
Q ss_conf             999846842780998888847--------964999998499877999997787870123-55306998799999976654
Q gi|254780901|r  505 GNPNPVFAFPNHKLQSIRVVN--------LAHLQMTFESQDSETLQAIAFRVYGTPLGE-FLMQSRGKRMHVTGHLCVNY  575 (600)
Q Consensus       505 gNpeP~F~~~~~~i~~~r~vG--------k~Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~-~~~~~~g~~idii~~l~~N~  575 (600)
                      ++++-.|...+..+..++++|        ++...+.+.|..|..++++.|........+ ......|..+.+.|++..  
T Consensus        34 ~~~~~~~~~~~~~i~~V~ivG~V~~~~~~~~~~~~~IdD~TG~~i~~~~~~~~~~~~~~~~~~i~~G~~V~V~G~i~~--  111 (159)
T 3kf6_A           34 HLQRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINS--  111 (159)
T ss_dssp             C---CCEEETTEEECEEEEEEEEEEEEEETTEEEEEEECSSSCEEEEEEEGGGCHHHHHHHTTCCTTCEEEEEEEEEC--
T ss_pred             CCCCCEEEECCEEEEEEEEEEEEEEEEEECCEEEEEEECCCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEE--
T ss_conf             866647999999889999999999899954559999988999917999987677433443556899959999999966--


Q ss_pred             ECCCCEEEEEEEEEEECCC
Q ss_conf             5781105899998011131
Q gi|254780901|r  576 WRGSKRCQLRVLDASPVEG  594 (600)
Q Consensus       576 ~~G~~s~QL~I~Di~p~e~  594 (600)
                      |+|.  .|+.+..+++++.
T Consensus       112 ~~~~--~~i~~~~i~~v~d  128 (159)
T 3kf6_A          112 FRSE--VELIAQSFEELRD  128 (159)
T ss_dssp             SSSS--CEEEEEEEEEECS
T ss_pred             CCCE--EEEEEEEEEEECC
T ss_conf             2988--8999999999099