Query         gi|254780901|ref|YP_003065314.1| single-stranded-DNA-specific exonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 600
No_of_seqs    191 out of 2089
Neff          6.5 
Searched_HMMs 33803
Date          Wed Jun  1 20:37:20 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780901.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2zxr_A Single-stranded DNA sp 100.0 2.9E-28 8.7E-33  240.5  14.0  192   71-273     3-194 (194)
  2 >2zxr_A Single-stranded DNA sp  99.9 8.2E-24 2.4E-28  205.7   9.3   94  367-467     2-95  (96)
  3 >2zxr_A Single-stranded DNA sp  99.9 1.1E-21 3.4E-26  188.9  11.8  111  472-595    49-159 (160)
  4 >3dma_A Exopolyphosphatase-rel  99.8 2.2E-19 6.6E-24  171.0  11.8  176   73-248     2-201 (214)
  5 >3dev_A SH1221; alpha-beta pro  99.8 3.9E-18 1.2E-22  161.3  11.3  163   80-262     3-168 (196)
  6 >2zxr_A Single-stranded DNA sp  99.7 7.6E-18 2.3E-22  159.0   4.2   83  274-358     1-83  (84)
  7 >2eb0_A Manganese-dependent in  99.6 3.9E-17 1.1E-21  153.5  -1.1  170   95-279     2-179 (191)
  8 >2haw_A Manganese-dependent in  98.8 1.8E-08 5.5E-13   85.6   8.1  146   93-260     2-157 (192)
  9 >1wpn_A Manganese-dependent in  98.8 4.3E-08 1.3E-12   82.7   9.1  146   93-260     2-157 (188)
 10 >3dev_A SH1221; alpha-beta pro  98.2 7.5E-06 2.2E-10   65.2   7.4   85  377-470    36-122 (124)
 11 >1k20_A Manganese-dependent in  98.1 0.00011 3.3E-09   56.0  12.8  146   93-260     1-158 (192)
 12 >3dma_A Exopolyphosphatase-rel  98.0 6.9E-05   2E-09   57.7  10.2   82  380-468    41-124 (129)
 13 >2qb7_A Exopolyphosphatase; A/  97.3  0.0009 2.6E-08   49.0   6.6  159   83-262    18-212 (255)
 14 >2zvf_A Alanyl-tRNA synthetase  96.2    0.13 3.9E-06   32.0  16.4  138  327-468     6-144 (145)
 15 >2pi2_A Replication protein A   96.2    0.13 3.7E-06   32.2  10.8   85  507-595    60-152 (270)
 16 >2zj3_A Glucosamine--fructose-  94.7     0.4 1.2E-05   28.2   9.5  133   78-225     1-141 (159)
 17 >3kf6_A Protein STN1; OB fold,  94.6    0.41 1.2E-05   28.1  10.9   86  505-594    34-128 (159)
 18 >1x92_A APC5045, phosphoheptos  94.4    0.44 1.3E-05   27.9   9.7  146   76-226    29-194 (199)
 19 >2poc_A D-fructose-6-, isomera  93.9    0.56 1.7E-05   27.1  11.7  137   79-229     3-147 (161)
 20 >1moq_A Glucosamine 6-phosphat  93.8    0.57 1.7E-05   27.0  11.1  134   79-227     1-142 (158)
 21 >2bpl_A Glucosamine--fructose-  93.6    0.63 1.9E-05   26.7  13.1  138   79-228     2-144 (159)
 22 >2c31_A Oxalyl-COA decarboxyla  93.5    0.57 1.7E-05   27.0   8.1  137   80-231     8-149 (179)
 23 >2fn9_A Ribose ABC transporter  93.2    0.59 1.7E-05   26.9   7.7  103   94-199     4-109 (150)
 24 >3kdf_D Replication protein A   93.1    0.75 2.2E-05   26.1  10.6   83  509-595    22-112 (132)
 25 >3lkb_A Probable branched-chai  93.0    0.76 2.3E-05   26.0   9.0   91   91-183    18-110 (172)
 26 >2e5f_A Hypothetical protein P  92.9    0.53 1.6E-05   27.3   7.1   99   74-184     2-103 (146)
 27 >2dri_A D-ribose-binding prote  92.5    0.87 2.6E-05   25.6   9.7  103   92-198     1-106 (139)
 28 >1f0k_A MURG, UDP-N-acetylgluc  92.5    0.88 2.6E-05   25.6   7.8   95   90-186     4-132 (196)
 29 >2yva_A DNAA initiator-associa  92.3    0.93 2.7E-05   25.4  10.5  146   76-227    25-191 (196)
 30 >2vbc_A Dengue 4 NS3 FULL-leng  92.3    0.93 2.8E-05   25.4   8.1   88   85-207    25-113 (119)
 31 >3g1w_A Sugar ABC transporter;  92.2    0.58 1.7E-05   26.9   6.6   82  113-197    27-109 (171)
 32 >1gm5_A RECG; helicase, replic  92.2    0.95 2.8E-05   25.3   8.4   64  526-594    26-89  (89)
 33 >1dbq_A Purine repressor; tran  91.6       1   3E-05   25.1   7.3   95   91-188     6-102 (157)
 34 >3f2b_A DNA-directed DNA polym  91.5     1.1 3.3E-05   24.7   8.8   78  517-597    25-106 (110)
 35 >1ml4_A Aspartate transcarbamo  91.3    0.79 2.3E-05   25.9   6.5   80   91-185     2-81  (124)
 36 >2zxr_A Single-stranded DNA sp  91.3    0.33 9.7E-06   28.9   4.5   39   14-53      3-41  (160)
 37 >2vk2_A YTFQ, ABC transporter   91.3    0.93 2.8E-05   25.4   6.8  120   94-233     4-127 (134)
 38 >2i2w_A Phosphoheptose isomera  90.6     1.3 3.9E-05   24.2   9.1  124   71-198    43-184 (212)
 39 >3d8u_A PURR transcriptional r  90.6    0.84 2.5E-05   25.7   6.1  103  112-218    25-127 (154)
 40 >1usg_A Leucine-specific bindi  90.5     1.4   4E-05   24.1   9.8  116   88-205    11-136 (150)
 41 >3brs_A Periplasmic binding pr  90.4     1.1 3.1E-05   24.9   6.4  105   92-198     7-114 (156)
 42 >3i10_A Putative glycerophosph  90.2    0.89 2.6E-05   25.5   5.9   19  316-334   215-233 (239)
 43 >3h5l_A Putative branched-chai  90.1     1.5 4.3E-05   23.8   7.4  100   80-181    10-115 (182)
 44 >1jeo_A MJ1247, hypothetical p  89.8     1.5 4.6E-05   23.7  12.8   93   79-188    27-125 (180)
 45 >3hbm_A UDP-sugar hydrolase; P  89.8     1.5 4.6E-05   23.6  11.1  113   93-208     1-125 (148)
 46 >2rgw_A Aspartate carbamoyltra  89.2     1.7   5E-05   23.4   7.4   79   91-184     3-82  (134)
 47 >2uz1_A Benzaldehyde lyase; th  89.0     1.2 3.6E-05   24.4   5.9   84   79-163    10-102 (186)
 48 >3l49_A ABC sugar (ribose) tra  88.9     1.8 5.2E-05   23.2   6.8  100   93-199     6-109 (150)
 49 >3hut_A Putative branched-chai  88.6     1.8 5.4E-05   23.1   7.3   91   90-182    14-104 (119)
 50 >3etn_A Putative phosphosugar   88.5     1.9 5.5E-05   23.0  11.2   98   76-185    42-148 (220)
 51 >3brq_A HTH-type transcription  88.0       2 5.9E-05   22.8   7.4  102   85-189    10-117 (144)
 52 >3jy6_A Transcriptional regula  87.6     2.1 6.2E-05   22.6  10.7  123   90-217     5-130 (159)
 53 >3fkj_A Putative phosphosugar   87.3     2.2 6.4E-05   22.5   7.0  128   56-198     6-142 (173)
 54 >2nyd_A UPF0135 protein SA1388  87.2    0.82 2.4E-05   25.8   4.1   72  107-183    39-118 (118)
 55 >1tjy_A Sugar transport protei  87.2     2.2 6.5E-05   22.5   6.3   75  112-188    25-100 (165)
 56 >2fyw_A Conserved hypothetical  86.7     1.1 3.4E-05   24.7   4.6   85   94-183    29-123 (123)
 57 >3csu_A Protein (aspartate car  86.7     2.3 6.9E-05   22.3   8.5   80   91-185     2-82  (134)
 58 >2q28_A Oxalyl-COA decarboxyla  86.5     2.4   7E-05   22.2   8.4  135   80-231     8-147 (177)
 59 >8abp_A L-arabinose-binding pr  86.3     2.4 7.2E-05   22.1   6.2   92   93-188     3-97  (138)
 60 >2fts_A Gephyrin; gephyrin, ne  85.9     2.3 6.7E-05   22.4   5.7   95   71-171     2-110 (174)
 61 >1nmo_A Hypothetical protein Y  85.7     2.6 7.7E-05   21.9   6.3   45  134-183    71-115 (115)
 62 >2e4u_A Metabotropic glutamate  85.6     2.6 7.8E-05   21.8   8.4   90   91-181    16-109 (177)
 63 >1pea_A Amidase operon; gene r  85.5     1.4 4.1E-05   24.1   4.5   85   90-174    12-96  (179)
 64 >2gx8_A NIF3-related protein;   85.2    0.89 2.6E-05   25.5   3.4   73  106-183    33-113 (113)
 65 >1q6z_A BFD, BFDC, benzoylform  85.1     2.7 8.1E-05   21.7   7.2   84   79-163    14-107 (168)
 66 >3lop_A Substrate binding peri  84.9     2.8 8.3E-05   21.6   8.9   98   81-180     7-105 (162)
 67 >3e61_A Putative transcription  84.8     2.7   8E-05   21.8   5.7   88   92-184     8-97  (120)
 68 >2ioy_A Periplasmic sugar-bind  83.7     3.1 9.2E-05   21.3  10.2  101   93-197     2-105 (150)
 69 >3i45_A Twin-arginine transloc  83.5     3.2 9.4E-05   21.2   8.7   89   85-175     9-101 (200)
 70 >1ovm_A Indole-3-pyruvate deca  82.9     3.3 9.8E-05   21.0   9.3  137   77-229    14-162 (169)
 71 >2d59_A Hypothetical protein P  82.9     3.3 9.8E-05   21.0   6.0  114   83-199    13-132 (144)
 72 >1u9y_A RPPK;, ribose-phosphat  82.9    0.69 2.1E-05   26.4   2.0   76   89-164    45-130 (156)
 73 >3g98_A Alanyl-tRNA synthetase  82.8     3.4 9.9E-05   21.0   7.9  100  365-465     6-110 (111)
 74 >2o55_A Putative glycerophosph  82.4     1.9 5.8E-05   22.9   4.1   28  161-188    24-51  (258)
 75 >3knz_A Putative sugar binding  81.9     3.6 0.00011   20.8  13.1  105   82-199     5-117 (149)
 76 >3eag_A UDP-N-acetylmuramate:L  81.9     3.6 0.00011   20.8   5.8   83   90-177     2-94  (105)
 77 >1jye_A Lactose operon repress  81.9     3.6 0.00011   20.8   7.5  141   30-183     6-152 (219)
 78 >2zj3_A Glucosamine--fructose-  81.6     3.7 0.00011   20.7   7.0   95   73-184    45-146 (216)
 79 >3e0f_A Putative metal-depende  81.5     3.7 0.00011   20.7   5.7   58  121-178    13-72  (220)
 80 >1c4o_A DNA nucleotide excisio  81.4     3.8 0.00011   20.6   8.6   78   77-161    15-92  (255)
 81 >2pgn_A Cyclohexane-1,2-dione   81.2     3.8 0.00011   20.6   9.9  135   79-230    10-155 (190)
 82 >2q5c_A NTRC family transcript  80.8     3.9 0.00012   20.5   6.1   82   82-179     6-88  (90)
 83 >3dfz_A SIRC, precorrin-2 dehy  80.6     2.7 8.1E-05   21.7   4.4   86   91-181    30-123 (126)
 84 >2w37_A Ornithine carbamoyltra  80.3     4.1 0.00012   20.4   8.7   78   91-184     2-83  (159)
 85 >3cf4_G Acetyl-COA decarbonyla  80.0     3.5  0.0001   20.9   4.8  102   80-182    22-140 (170)
 86 >3jx9_A Putative phosphoheptos  79.9     3.7 0.00011   20.6   4.9   95   77-189     4-101 (112)
 87 >2wv9_A Flavivirin protease NS  79.9     4.2 0.00012   20.3   7.2   63   85-158    26-88  (159)
 88 >1qpz_A PURA, protein (purine   79.7     4.2 0.00013   20.2   7.1   74  112-188    23-96  (151)
 89 >3h75_A Periplasmic sugar-bind  79.6     4.2 0.00013   20.2   6.7  107  107-219    21-129 (208)
 90 >2iht_A Carboxyethylarginine s  78.9     4.4 0.00013   20.1   8.7   87   76-163    14-115 (170)
 91 >2vk8_A Pyruvate decarboxylase  78.7     4.5 0.00013   20.0   8.6  138   77-230    11-160 (165)
 92 >3dlj_A Beta-Ala-His dipeptida  78.6     4.5 0.00013   20.0  10.6  123   57-182    31-231 (267)
 93 >1nri_A Hypothetical protein H  78.4     4.6 0.00014   19.9  11.7  148   75-226    54-225 (233)
 94 >2pju_A Propionate catabolism   77.7     4.8 0.00014   19.8   6.0   80   83-178     7-87  (89)
 95 >2gzm_A Glutamate racemase; en  77.6     4.8 0.00014   19.8   6.1   82   91-177     2-93  (156)
 96 >1tks_A 3,4-dihydroxy-2-butano  77.3     0.9 2.7E-05   25.5   1.1   95   78-172     4-113 (204)
 97 >1tk9_A Phosphoheptose isomera  77.0       5 0.00015   19.7  11.3  107   74-184    24-149 (188)
 98 >2dwu_A Glutamate racemase; is  76.9       5 0.00015   19.7   5.2   85   89-178     4-98  (164)
 99 >2a3n_A Putative glucosamine-f  76.9       5 0.00015   19.6   9.0  105   80-197    42-154 (192)
100 >3dah_A Ribose-phosphate pyrop  76.8       5 0.00015   19.6   7.6   74   91-164    53-140 (176)
101 >2f00_A UDP-N-acetylmuramate--  76.2     5.2 0.00015   19.5   6.9   78   90-177     2-91  (102)
102 >1o97_D Electron transferring   75.5     2.5 7.3E-05   22.1   2.9   96   84-182     5-102 (132)
103 >1oth_A Protein (ornithine tra  74.8     5.6 0.00017   19.3   7.0   76   91-183     2-81  (128)
104 >2wje_A CPS4B, tyrosine-protei  74.7     1.5 4.6E-05   23.6   1.7   28  157-184    17-49  (247)
105 >1dku_A Protein (phosphoribosy  74.6     5.7 0.00017   19.2   7.9   74   91-164    55-141 (175)
106 >2nxw_A Phenyl-3-pyruvate deca  74.4     5.8 0.00017   19.2   6.9   87   77-164     9-106 (163)
107 >1byk_A Protein (trehalose ope  74.3     5.8 0.00017   19.2   5.7   67  112-184    24-90  (130)
108 >1n4w_A CHOD, cholesterol oxid  74.2     4.9 0.00014   19.7   4.2   37  150-187     6-42  (207)
109 >3fj1_A Putative phosphosugar   74.1     5.9 0.00017   19.1  12.4  132   80-227    31-171 (193)
110 >1ozh_A ALS, acetolactate synt  74.0     5.9 0.00017   19.1   9.9  136   79-231     8-154 (180)
111 >3gbv_A Putative LACI-family t  73.7       6 0.00018   19.0   8.8  123   94-233    10-139 (167)
112 >1duv_G Octase-1, ornithine tr  73.5       6 0.00018   19.0   7.9   78   91-184     2-83  (126)
113 >2vbf_A Branched-chain alpha-k  73.3     6.1 0.00018   19.0   8.4   87   77-165    12-110 (163)
114 >2vbi_A Pyruvate decarboxylase  72.6     6.3 0.00019   18.9   8.1   85   78-163    12-107 (165)
115 >3ksm_A ABC-type sugar transpo  72.5     6.3 0.00019   18.9   6.0   82  112-198    22-108 (140)
116 >2h06_A Ribose-phosphate pyrop  72.4     6.4 0.00019   18.8   7.4   73   92-164    50-135 (181)
117 >2r7a_A Bacterial heme binding  72.4     6.4 0.00019   18.8   4.4   68  112-181    12-90  (91)
118 >3hn7_A UDP-N-acetylmuramate-L  72.4     6.4 0.00019   18.8   8.1   76   90-177    17-108 (119)
119 >3ist_A Glutamate racemase; st  72.3     6.4 0.00019   18.8   6.2   87   90-181     3-99  (157)
120 >3egc_A Putative ribose operon  72.1     6.5 0.00019   18.8   6.6  104   90-199     6-111 (159)
121 >1vlv_A Otcase, ornithine carb  72.0     6.5 0.00019   18.8   8.5   76   91-182     2-81  (130)
122 >2iks_A DNA-binding transcript  72.0     6.5 0.00019   18.8   6.8  100   85-188    11-115 (163)
123 >2pqm_A Cysteine synthase; OAS  71.5     6.6  0.0002   18.7   8.8   88   81-179     8-103 (109)
124 >2r79_A Periplasmic binding pr  71.2     6.8  0.0002   18.6   4.4   38  142-180    52-89  (91)
125 >1y81_A Conserved hypothetical  71.2     6.8  0.0002   18.6   5.5   94   83-179     5-99  (138)
126 >1vim_A Hypothetical protein A  70.7     6.9  0.0002   18.6   8.5   88   80-184    35-128 (200)
127 >3i3w_A Phosphoglucosamine mut  70.7     6.9  0.0002   18.6   5.2   76   79-158     3-88  (104)
128 >3ek6_A Uridylate kinase; UMPK  70.5       7 0.00021   18.5   6.6   66  110-175    89-159 (243)
129 >2aml_A SIS domain protein; 46  70.1     7.1 0.00021   18.5  11.6  105   80-198    12-124 (157)
130 >2jfg_A UDP-N-acetylmuramoylal  69.9     7.1 0.00021   18.4   5.5   80   91-177     5-93  (103)
131 >2vvt_A Glutamate racemase; is  69.9     7.2 0.00021   18.4   6.0   84   89-177    21-114 (179)
132 >2pjk_A 178AA long hypothetica  69.8     7.2 0.00021   18.4   4.7   51  107-163    40-93  (178)
133 >3kfv_A Tight junction protein  69.8     7.2 0.00021   18.4   6.8   74   93-177     3-78  (150)
134 >1ka9_F Imidazole glycerol pho  69.5     7.3 0.00022   18.4   6.9   68  110-178   155-223 (252)
135 >1kwg_A Beta-galactosidase; TI  69.4     7.3 0.00022   18.4   5.8   89   93-181     4-122 (198)
136 >1iuk_A Hypothetical protein T  69.3     2.7 7.9E-05   21.8   1.9  120   83-204     4-130 (140)
137 >2yyb_A Hypothetical protein T  69.1     4.8 0.00014   19.8   3.2   38  143-183    73-110 (111)
138 >2bcg_G Secretory pathway GDP   69.1       2 5.8E-05   22.8   1.2   43  149-192    11-53  (152)
139 >1p3d_A UDP-N-acetylmuramate--  69.1     7.4 0.00022   18.3   8.0   78   90-177    16-105 (116)
140 >3i09_A Periplasmic branched-c  69.0     7.4 0.00022   18.3   9.5   92   82-175     6-99  (191)
141 >3fxa_A SIS domain protein; YP  68.5     7.6 0.00023   18.2  11.7   94   80-185    32-132 (201)
142 >1m65_A Hypothetical protein Y  68.5     3.9 0.00012   20.5   2.6   30  157-186    14-45  (245)
143 >2is8_A Molybdopterin biosynth  67.7     6.1 0.00018   19.0   3.5   50  107-162    21-73  (164)
144 >1p3w_B Cysteine desulfurase;   67.6     7.9 0.00023   18.1   9.0  132   76-219     8-153 (167)
145 >1g57_A DHBP synthase, 3,4-dih  67.6     6.2 0.00018   18.9   3.5  100   72-171     6-120 (217)
146 >3kjx_A Transcriptional regula  67.6     7.9 0.00023   18.1   6.4   79  113-197    31-109 (140)
147 >2v1x_A ATP-dependent DNA heli  67.5     7.9 0.00023   18.1   6.7   71   80-161    20-94  (138)
148 >2pan_A Glyoxylate carboligase  67.2       8 0.00024   18.0   9.3  131   79-226     9-152 (220)
149 >2g2c_A Putative molybdenum co  67.1     5.5 0.00016   19.3   3.2   63   95-163    10-81  (167)
150 >1zuw_A Glutamate racemase 1;   66.8     8.2 0.00024   18.0   6.1   82   91-177     2-94  (160)
151 >3loq_A Universal stress prote  66.8     8.2 0.00024   18.0   7.0   39  368-406   252-293 (294)
152 >1j6u_A UDP-N-acetylmuramate-a  66.7     8.2 0.00024   18.0   8.5   76   89-177     9-99  (113)
153 >3ff4_A Uncharacterized protei  66.5     8.3 0.00024   17.9   7.2   86   90-177     2-109 (122)
154 >2h0a_A TTHA0807, transcriptio  66.1     8.4 0.00025   17.9   5.9   68  113-184    22-89  (142)
155 >3ke8_A 4-hydroxy-3-methylbut-  66.1     8.4 0.00025   17.9   4.5   42   77-123     4-46  (86)
156 >1dxh_A Ornithine carbamoyltra  66.0     8.4 0.00025   17.9   8.5   80   91-186     2-85  (122)
157 >2rgy_A Transcriptional regula  66.0     8.4 0.00025   17.9   5.5  117   92-222     8-127 (132)
158 >3gd5_A Otcase, ornithine carb  65.9     8.5 0.00025   17.9   8.7   75   91-182     2-80  (128)
159 >2csu_A 457AA long hypothetica  65.7     6.1 0.00018   19.0   3.2   89   89-179     5-94  (126)
160 >2duw_A Putative COA-binding p  65.4     8.7 0.00026   17.8   6.3   95   85-182     6-103 (145)
161 >1m3s_A Hypothetical protein Y  65.0     8.8 0.00026   17.7   9.3  103   79-198    24-132 (186)
162 >2o3j_A UDP-glucose 6-dehydrog  64.9     8.2 0.00024   18.0   3.7   95   79-186     7-115 (169)
163 >3dbi_A Sugar-binding transcri  64.4       9 0.00027   17.7   6.7  147   30-190     6-160 (185)
164 >2anu_A Hypothetical protein T  64.4     3.9 0.00011   20.5   2.0   31  157-187    32-63  (255)
165 >1k4i_A 3,4-dihydroxy-2-butano  64.2     5.9 0.00017   19.1   2.9   28   73-104    10-37  (233)
166 >3d02_A Putative LACI-type tra  64.0     9.2 0.00027   17.6   5.5   82  112-197    26-109 (154)
167 >3isx_A Endoglucanase; TM1050,  63.9     9.2 0.00027   17.6   5.3   57   90-148    62-136 (253)
168 >3k8a_A Putative primosomal re  63.8     9.2 0.00027   17.6   6.4   50  540-594    54-103 (103)
169 >1tuo_A Putative phosphomannom  63.7     9.2 0.00027   17.6   4.6   44  144-187    16-60  (110)
170 >1pvv_A Otcase, ornithine carb  63.5     9.3 0.00028   17.5   8.8   76   91-183     2-81  (128)
171 >2h3h_A Sugar ABC transporter,  63.2     9.4 0.00028   17.5   7.3   84  111-197    21-105 (147)
172 >2pbq_A Molybdenum cofactor bi  63.0     9.5 0.00028   17.5   4.0   58   95-156    10-75  (178)
173 >1fuk_A Eukaryotic initiation   61.8      10 0.00029   17.3   5.6   79   76-161    12-92  (165)
174 >1rdu_A Conserved hypothetical  61.5     9.5 0.00028   17.5   3.5   56  126-184    39-94  (116)
175 >1ylo_A Hypothetical protein S  61.3     7.3 0.00022   18.3   2.9   31   90-120    55-100 (263)
176 >3ks9_A Mglur1, metabotropic g  61.1      10  0.0003   17.2   7.4  102   80-183     6-114 (190)
177 >2wvg_A PDC, pyruvate decarbox  60.7      10 0.00031   17.2  10.6   85   78-164    15-111 (177)
178 >3eme_A Rhodanese-like domain   60.1     8.6 0.00026   17.8   3.1   34  148-181    55-88  (103)
179 >1snn_A DHBP synthase, 3,4-dih  60.0      11 0.00031   17.1   5.5   91   82-172     4-126 (227)
180 >3i32_A Heat resistant RNA dep  60.0      11 0.00031   17.1   8.6   70   85-161    19-90  (180)
181 >1b73_A Glutamate racemase; is  59.9      11 0.00031   17.1   4.5   79   94-177     2-90  (135)
182 >2i6u_A Otcase, ornithine carb  59.8      11 0.00032   17.1   9.1   78   91-184     2-83  (129)
183 >2cf4_A Protein PH0519, phtet1  59.7     8.1 0.00024   18.0   2.9   31   90-120    52-97  (240)
184 >2hqb_A Transcriptional activa  59.3      11 0.00032   17.0  10.2  102   82-187     7-109 (120)
185 >1mb4_A Aspartate-semialdehyde  59.0      11 0.00033   17.0   3.6   86   94-182     2-97  (149)
186 >1vkf_A Glycerol uptake operon  59.0      11 0.00033   17.0   7.0   86   89-184    28-117 (188)
187 >1nmo_A Hypothetical protein Y  58.8     9.8 0.00029   17.4   3.2   30  150-182    36-65  (132)
188 >2rgh_A Alpha-glycerophosphate  58.5      11 0.00033   16.9   5.2  112   76-197    16-128 (200)
189 >2oho_A Glutamate racemase; is  57.8      11 0.00034   16.8   7.0   82   90-177    10-102 (142)
190 >2ayx_A Sensor kinase protein   57.2     7.3 0.00022   18.4   2.3   79   91-183    11-95  (137)
191 >2jfz_A Glutamate racemase; ce  57.2      12 0.00035   16.8   4.5  118   94-219     2-131 (139)
192 >2j3h_A NADP-dependent oxidore  57.2      12 0.00035   16.8   6.4   78   89-179    23-101 (179)
193 >2o20_A Catabolite control pro  57.1      12 0.00035   16.7   9.7  144   30-188     8-157 (202)
194 >2r00_A Aspartate-semialdehyde  56.9      12 0.00035   16.7   3.4  104   92-198     3-115 (150)
195 >2ji4_A Phosphoribosyl pyropho  56.8      12 0.00035   16.7   7.8   71   92-162    79-161 (203)
196 >2hsg_A Glucose-resistance amy  56.6      12 0.00035   16.7   6.2   74  112-189    24-97  (124)
197 >2otd_A Glycerophosphodiester   56.5      12 0.00036   16.7   4.6   28  161-188    22-49  (247)
198 >3k4h_A Putative transcription  56.1      12 0.00036   16.6   6.7   69  113-185    36-104 (160)
199 >1t4b_A Aspartate-semialdehyde  56.1      11 0.00033   16.9   3.1   88   93-183     2-99  (147)
200 >2e1m_A L-glutamate oxidase; L  56.0      12 0.00036   16.6   4.5   79  149-229     5-84  (127)
201 >2fyw_A Conserved hypothetical  55.8      11 0.00034   16.9   3.1   29  151-182    19-47  (123)
202 >1zun_A Sulfate adenylyltransf  55.5      12 0.00037   16.6   7.1  108   72-184    26-157 (325)
203 >2pc8_A Hypothetical protein X  55.4      12 0.00037   16.6   3.3   54  135-188    73-142 (400)
204 >1y5e_A Molybdenum cofactor bi  55.4      13 0.00037   16.5   4.9   63   95-163    18-84  (169)
205 >1mkz_A Molybdenum cofactor bi  55.3      13 0.00037   16.5   4.8   66  107-179    28-100 (172)
206 >3eua_A Putative fructose-amin  54.9      13 0.00038   16.5  11.0  115   75-201     6-130 (155)
207 >2ep5_A 350AA long hypothetica  54.7      11 0.00031   17.1   2.8   88   91-182     3-112 (169)
208 >2yxo_A Histidinol phosphatase  54.5      11 0.00033   16.9   2.9   29  158-186    13-43  (267)
209 >2yyb_A Hypothetical protein T  54.5      13 0.00038   16.4   3.4   29  150-181    37-65  (131)
210 >1zcz_A Bifunctional purine bi  54.3      13 0.00038   16.4   4.0  103   70-180    12-123 (129)
211 >1nul_A XPRT, xanthine-guanine  54.2     9.3 0.00028   17.5   2.5   99   76-179     2-106 (123)
212 >3huu_A Transcription regulato  54.1      13 0.00039   16.4   6.2   80  113-198    50-129 (176)
213 >3l6u_A ABC-type sugar transpo  53.9      13 0.00039   16.4   9.4   92   90-184     6-100 (155)
214 >2fqx_A Membrane lipoprotein T  53.7      13 0.00039   16.4   7.3   85   91-181     3-94  (147)
215 >2ax3_A Hypothetical protein T  53.6      13 0.00039   16.3   6.7   82  319-404     6-88  (213)
216 >3c3k_A Alanine racemase; stru  53.6      13 0.00039   16.3   7.1   71  113-188    31-101 (154)
217 >3g68_A Putative phosphosugar   53.4      13  0.0004   16.3  11.6  136   80-229    22-164 (188)
218 >2bpl_A Glucosamine--fructose-  53.1      13  0.0004   16.3   8.9   89   83-184    40-136 (206)
219 >2p1z_A Phosphoribosyltransfer  52.9      14  0.0004   16.3   5.1  128   41-178     8-146 (180)
220 >1wv2_A Thiazole moeity, thiaz  52.8      14  0.0004   16.3   5.2  104   83-187    63-170 (265)
221 >1gd9_A Aspartate aminotransfe  52.5      14 0.00041   16.2   6.9  104   73-183    20-132 (192)
222 >2o8n_A APOA-I binding protein  52.0      14 0.00041   16.2   7.2   38  366-404    78-115 (265)
223 >1tlt_A Putative oxidoreductas  52.0      14 0.00041   16.2   4.2   80   94-178     7-94  (184)
224 >2qv0_A Protein MRKE; structur  51.9      12 0.00035   16.8   2.7   22  163-184    45-66  (143)
225 >2d7d_A Uvrabc system protein   51.8      14 0.00042   16.1   8.3   78   77-161    15-92  (187)
226 >1wly_A CAAR, 2-haloacrylate r  51.5      14 0.00042   16.1   6.0   76   90-179     2-78  (132)
227 >1di6_A MOGA, molybdenum cofac  51.4      14 0.00042   16.1   3.6  114   95-220     8-143 (195)
228 >2pz0_A Glycerophosphoryl dies  51.0      14 0.00041   16.2   3.0   29  161-189    27-55  (252)
229 >2gx8_A NIF3-related protein;   51.0      12 0.00037   16.6   2.7   28  151-181    66-93  (170)
230 >2o2e_A Tryptophan synthase be  50.7      15 0.00043   16.0   7.7   86   80-171     8-93  (115)
231 >3eiq_A Eukaryotic initiation   50.7      15 0.00043   16.0   3.5   60   94-160     2-61  (64)
232 >1s8n_A Putative antiterminato  50.7      10  0.0003   17.3   2.2   76   90-178    11-90  (143)
233 >3hz7_A Uncharacterized protei  50.6      15 0.00043   16.0   3.1   44  140-183    20-63  (87)
234 >3eq2_A Probable two-component  50.4      15 0.00044   16.0   3.6   67  106-182    15-86  (167)
235 >1nkt_A Preprotein translocase  50.1      15 0.00044   16.0   9.3   72   77-159    19-92  (160)
236 >2oca_A DAR protein, ATP-depen  50.1      15 0.00044   15.9   6.0   74   78-158    44-118 (221)
237 >1v5e_A Pyruvate oxidase; oxid  50.0      15 0.00044   15.9  10.5  132   80-231    11-153 (222)
238 >2jlq_A Serine protease subuni  49.8      15 0.00044   15.9   6.8   64   85-159    25-88  (158)
239 >3ics_A Coenzyme A-disulfide r  49.5      15 0.00045   15.9   2.9   32  149-180    54-85  (86)
240 >1p6q_A CHEY2; chemotaxis, sig  49.5      11 0.00033   16.9   2.2   69   90-171     4-72  (129)
241 >3i42_A Response regulator rec  49.4      15 0.00045   15.9   3.1   79   91-183     2-87  (127)
242 >1vho_A Endoglucanase; structu  49.4      15 0.00044   16.0   2.9   31   90-120    57-101 (259)
243 >2jfq_A Glutamate racemase; ce  49.3      15 0.00045   15.9   6.3   78   88-171    18-105 (174)
244 >2hnh_A DNA polymerase III alp  49.2      15 0.00045   15.8   3.7   55  123-177     7-65  (277)
245 >3fho_A ATP-dependent RNA heli  49.2      11 0.00032   17.0   2.2   72   81-159    18-91  (182)
246 >1a53_A IGPS, indole-3-glycero  49.0      15 0.00046   15.8   8.9   95   81-182    40-137 (223)
247 >3hv2_A Response regulator/HD   48.8      15 0.00045   15.9   2.9   79   90-182    12-95  (153)
248 >1wp9_A ATP-dependent RNA heli  48.8      16 0.00046   15.8   8.9   79   77-159    18-103 (168)
249 >2qen_A Walker-type ATPase; un  48.7      16 0.00046   15.8   4.9   56   70-128     9-64  (202)
250 >1jbe_A Chemotaxis protein CHE  48.4      12 0.00034   16.8   2.2   57   92-162     4-61  (128)
251 >1jlj_A Gephyrin; globular alp  48.4      16 0.00047   15.8   4.0   58   95-156    19-85  (189)
252 >1tmo_A TMAO reductase, trimet  48.3      16 0.00047   15.8   4.6   63  132-198     6-89  (154)
253 >2a9o_A Response regulator; es  47.9      13 0.00039   16.4   2.4   27  161-187    33-59  (120)
254 >3h5t_A Transcriptional regula  47.4      16 0.00048   15.6   4.3   93   91-188     7-106 (160)
255 >3kbq_A Protein TA0487; struct  47.0      17 0.00049   15.6   5.0   57   95-156     8-69  (172)
256 >2v03_A Cysteine synthase B; p  47.0      17 0.00049   15.6   9.3   81   81-172     8-92  (109)
257 >2g4r_A MOGA, molybdopterin bi  46.7      17 0.00049   15.6   3.3   54   95-156     8-69  (160)
258 >1uz5_A MOEA protein, 402AA lo  46.4      17  0.0005   15.5   4.8  128   77-219     8-152 (168)
259 >1byr_A Protein (endonuclease)  46.2      17  0.0005   15.5   7.9   51   80-130    41-91  (155)
260 >1zrn_A L-2-haloacid dehalogen  46.1      17  0.0005   15.5   7.3   99   73-183    23-126 (160)
261 >3bic_A Methylmalonyl-COA muta  45.9      17  0.0005   15.5   9.3   98   77-181     3-111 (179)
262 >3eaf_A ABC transporter, subst  45.8      17 0.00051   15.5   3.2   83   92-178    20-107 (181)
263 >1p5d_X PMM, phosphomannomutas  45.7      11 0.00033   16.9   1.8   25  379-403    26-50  (130)
264 >3e38_A Two-domain protein con  45.7      14 0.00041   16.2   2.3   28  157-184    31-59  (240)
265 >3l12_A Putative glycerophosph  45.6      17 0.00051   15.5   8.3   27  162-188    34-60  (256)
266 >3hix_A ALR3790 protein; rhoda  45.6      17 0.00051   15.4   3.1   47   77-127    37-83  (106)
267 >3k9f_C DNA topoisomerase 4 su  45.5      15 0.00045   15.9   2.4   28   92-119   119-146 (187)
268 >3ct6_A PTS-dependent dihydrox  45.4      17 0.00051   15.4   6.0   58  113-171    19-79  (131)
269 >1vky_A S-adenosylmethionine:t  45.0      18 0.00052   15.4   3.0  112   89-203    69-212 (250)
270 >1dxl_A Dihydrolipoamide dehyd  45.0      16 0.00046   15.8   2.4   94   89-195    17-115 (118)
271 >3eaq_A Heat resistant RNA dep  44.7      18 0.00053   15.4   6.6   64   90-160    29-92  (184)
272 >1we3_A CPN60(groel); chaperon  44.7      18 0.00053   15.3   6.2  103   73-183    34-139 (146)
273 >3grc_A Sensor protein, kinase  44.7      17 0.00049   15.6   2.5   82   88-183     2-91  (140)
274 >3g1w_A Sugar ABC transporter;  44.6      18 0.00053   15.3   6.3  105   78-182     5-115 (134)
275 >1gud_A ALBP, D-allose-binding  44.6      18 0.00053   15.3   6.7   73  113-187    24-98  (153)
276 >2rir_A Dipicolinate synthase,  44.5      18 0.00053   15.3   4.9   63   91-161     6-72  (156)
277 >3ch0_A Glycerophosphodiester   44.4      18 0.00053   15.3   2.9   28  161-188    24-51  (272)
278 >1oi7_A Succinyl-COA synthetas  44.4      18 0.00053   15.3   5.2   86   91-179     6-94  (122)
279 >3bc8_A O-phosphoseryl-tRNA(SE  44.2      18 0.00053   15.3   5.9   99   80-184    17-125 (180)
280 >3gk5_A Uncharacterized rhodan  44.0      18 0.00054   15.3   4.8   32  149-180    55-86  (108)
281 >3cu5_A Two component transcri  44.0      18 0.00053   15.3   2.6   25  160-184    36-60  (141)
282 >1w0m_A TIM, triosephosphate i  44.0      18 0.00054   15.3   4.4   13  167-179   108-120 (226)
283 >2yv2_A Succinyl-COA synthetas  43.5      18 0.00055   15.2   4.0   56  364-419    74-132 (168)
284 >1t5i_A C_terminal domain of A  43.3      19 0.00055   15.2   8.3   72   83-161    20-93  (172)
285 >2him_A L-asparaginase 1; hydr  43.3      19 0.00055   15.2   5.3   87  136-223    12-106 (130)
286 >2r25_B Osmosensing histidine   43.3      19 0.00055   15.2   3.7   12  110-121    16-27  (133)
287 >3fgn_A Dethiobiotin synthetas  43.2      19 0.00055   15.2   6.7   37   93-129    27-64  (251)
288 >1mio_B Nitrogenase molybdenum  42.9      19 0.00056   15.2   7.6   84   91-184     2-87  (109)
289 >2v6o_A Thioredoxin glutathion  42.9      19 0.00056   15.2   5.1   49   75-127     1-49  (106)
290 >1kid_A Groel (HSP60 class); c  42.8      19 0.00056   15.1   4.6  102   74-183    53-157 (203)
291 >2jk1_A HUPR, hydrogenase tran  42.7      19 0.00056   15.1   4.5   46  138-187    13-58  (139)
292 >2rjo_A Twin-arginine transloc  42.3      19 0.00057   15.1   8.7  119   92-218     5-130 (152)
293 >2i4i_A ATP-dependent RNA heli  42.3      19 0.00057   15.1   6.0   76   77-159    16-91  (139)
294 >1eg5_A Aminotransferase; PLP-  42.2      19 0.00057   15.1  11.5  103   75-183     7-119 (162)
295 >1qor_A Quinone oxidoreductase  42.1      19 0.00057   15.1   5.9   76   89-178     2-78  (132)
296 >3c97_A Signal transduction hi  42.1      19 0.00057   15.1   4.7   43  138-184    22-65  (65)
297 >1bjt_A Topoisomerase II; quat  41.9      19 0.00055   15.2   2.4   14   95-108   113-126 (202)
298 >2yv1_A Succinyl-COA ligase [A  41.8      19 0.00058   15.0   6.0   87   90-179    11-100 (128)
299 >3clk_A Transcription regulato  41.8      20 0.00058   15.0   6.3   89   93-184     9-99  (159)
300 >2d6f_A Glutamyl-tRNA(Gln) ami  41.8      20 0.00058   15.0   4.8   87  136-223    12-104 (135)
301 >3kke_A LACI family transcript  41.7      20 0.00058   15.0   7.3   69  112-184    37-105 (166)
302 >1h5y_A HISF; histidine biosyn  41.2      20 0.00059   15.0   6.7   43  135-178   183-225 (253)
303 >1g8m_A Aicar transformylase-I  41.1      20 0.00059   15.0   3.8   48  133-180   143-190 (196)
304 >2yxb_A Coenzyme B12-dependent  41.0      20 0.00059   14.9   4.3   76   78-161     4-80  (161)
305 >1dxy_A D-2-hydroxyisocaproate  40.9      20 0.00059   14.9   4.0   69  136-227    55-123 (136)
306 >1xyg_A Putative N-acetyl-gamm  40.9      20 0.00059   14.9   5.6   86   89-178    13-110 (191)
307 >1wls_A L-asparaginase; struct  40.7      20  0.0006   14.9   5.1   87  136-222    12-105 (130)
308 >2zjt_A DNA gyrase subunit B;   40.7      20  0.0006   14.9   2.6   28   92-119    83-110 (192)
309 >2z0f_A Putative phosphoglucom  40.5      20  0.0006   14.9   3.7   32  148-179    21-52  (233)
310 >1uuy_A CNX1, molybdopterin bi  40.5      20  0.0006   14.9   2.6   51  102-156    24-78  (167)
311 >3foj_A Uncharacterized protei  40.5      20  0.0006   14.9   2.7   33  149-181    56-88  (100)
312 >1thf_D HISF protein; thermoph  40.4      20  0.0006   14.9   6.9   70  108-178   152-222 (253)
313 >2vw9_A Single-stranded DNA bi  40.3      21 0.00061   14.9   5.4   55  540-596    50-109 (134)
314 >2fep_A Catabolite control pro  40.2      21 0.00061   14.9  10.2  127   84-231     6-137 (156)
315 >2bdq_A Copper homeostasis pro  39.9      21 0.00061   14.8   8.3   14  388-401   193-206 (224)
316 >3hvb_A Protein FIMX; EAL phos  39.5      21 0.00062   14.8   6.1   67  292-362   197-268 (437)
317 >3hl2_A O-phosphoseryl-tRNA(SE  39.4      17  0.0005   15.5   1.9   37  434-470    68-113 (150)
318 >1mb3_A Cell division response  39.3      18 0.00054   15.2   2.1   80   92-185     1-88  (124)
319 >2qv5_A AGR_C_5032P, uncharact  39.1      21 0.00063   14.7   3.2   46  104-153    38-83  (261)
320 >1n2z_A Vitamin B12 transport   39.1      21 0.00063   14.7   3.9   43  141-184    49-91  (131)
321 >3grf_A Ornithine carbamoyltra  39.1      21 0.00063   14.7   5.0   78   91-184     3-88  (135)
322 >3d3j_A Enhancer of mRNA-decap  39.0      21 0.00063   14.7   6.9   90  313-406    72-170 (306)
323 >1mio_B Nitrogenase molybdenum  39.0      21 0.00063   14.7   6.5  116   41-181    24-158 (160)
324 >1ys7_A Transcriptional regula  38.9      21 0.00063   14.7   2.7   79   91-183     6-90  (131)
325 >1pjq_A CYSG, siroheme synthas  38.8      21 0.00064   14.7   7.4   85   91-181    11-105 (108)
326 >1wqa_A Phospho-sugar mutase;   38.8      21 0.00064   14.7   4.1   40  143-182    16-55  (139)
327 >2pw9_A Putative formate dehyd  38.8      22 0.00064   14.7   3.7   14  389-402   200-213 (237)
328 >2egu_A Cysteine synthase; O-a  38.7      22 0.00064   14.7   8.9   81   81-172     8-92  (106)
329 >1xea_A Oxidoreductase, GFO/ID  38.4      22 0.00064   14.7   3.7   95  162-271    37-132 (184)
330 >2r7r_A RNA-dependent RNA poly  38.4      15 0.00044   16.0   1.5   57   43-103    42-106 (120)
331 >2hqb_A Transcriptional activa  38.3      22 0.00065   14.6   5.5   89   90-183     3-97  (148)
332 >1kq3_A Glycerol dehydrogenase  38.3     9.6 0.00028   17.4   0.5   96   82-182    11-108 (150)
333 >1wv9_A Rhodanese homolog TT16  38.2      22 0.00065   14.6   3.2   46  137-182    39-86  (94)
334 >1vdc_A NTR, NADPH dependent t  38.2      22 0.00065   14.6   3.9   75  145-222     4-80  (179)
335 >1txy_A Primosomal replication  38.2      22 0.00065   14.6   6.0   54  540-595    49-103 (104)
336 >2dph_A Formaldehyde dismutase  38.1      22 0.00065   14.6   5.6   53   89-154    18-70  (174)
337 >1yt8_A Thiosulfate sulfurtran  38.0      22 0.00065   14.6   3.2   29  152-180    85-113 (127)
338 >2zzc_A Thioredoxin reductase   38.0      22 0.00065   14.6   4.1   66   90-164    10-79  (113)
339 >1eqq_A Single stranded DNA bi  38.0      14 0.00043   16.1   1.3   53  540-594    55-112 (178)
340 >3hcw_A Maltose operon transcr  37.7      22 0.00066   14.6   6.2   72  114-189    36-107 (163)
341 >3d4o_A Dipicolinate synthase   37.7      22 0.00066   14.6   8.8   63   91-160     4-69  (149)
342 >1v8z_A Tryptophan synthase be  37.5      22 0.00066   14.6   8.8   86   81-172     8-93  (109)
343 >2w6r_A Imidazole glycerol pho  37.5      22 0.00066   14.6   6.7   42  136-178    60-101 (266)
344 >1rrm_A Lactaldehyde reductase  37.2      23 0.00067   14.5   3.9   64   92-159    31-98  (183)
345 >2an1_A Putative kinase; struc  37.0      23 0.00067   14.5   3.0   84   93-178     6-92  (138)
346 >2j8z_A Quinone oxidoreductase  36.9      23 0.00068   14.5   6.4   74   90-178     3-78  (131)
347 >3kcq_A Phosphoribosylglycinam  36.9      23 0.00068   14.5   6.2   91   89-188     5-99  (215)
348 >1xi9_A Putative transaminase;  36.8      23 0.00068   14.5   7.8  136   76-219    10-161 (186)
349 >2iye_A Copper-transporting AT  36.8      23 0.00068   14.5   3.0   28  151-178    29-58  (164)
350 >1edg_A Endoglucanase A; famil  36.6      23 0.00069   14.4   2.6   54  135-188    60-129 (380)
351 >3f2b_A DNA-directed DNA polym  36.5      23 0.00069   14.4   3.3   56  123-178     7-66  (295)
352 >3beo_A UDP-N-acetylglucosamin  36.4      23 0.00069   14.4   5.5   41  143-183    89-129 (211)
353 >1qz9_A Kynureninase; kynureni  36.3      23 0.00069   14.4   2.4   59  410-468   131-193 (206)
354 >1m1n_A Nitrogenase molybdenum  36.3      23 0.00069   14.4   4.3   79   90-179     5-84  (86)
355 >1z9f_A Single-strand binding   36.3      23 0.00069   14.4   4.9   54  540-595    64-122 (153)
356 >3cg4_A Response regulator rec  36.2      23 0.00069   14.4   2.5   82   90-185     5-94  (142)
357 >3eya_A Pyruvate dehydrogenase  36.1      24  0.0007   14.4   9.7   81   79-163    14-105 (180)
358 >1e3j_A NADP(H)-dependent keto  35.8      24  0.0007   14.4   3.4   77   89-179    24-104 (173)
359 >2hdo_A Phosphoglycolate phosp  35.8      24  0.0007   14.4   6.1  112   72-196    22-139 (149)
360 >2j5c_A 1,8-cineole synthase;   35.7      20  0.0006   14.9   1.8   37  100-136     1-37  (106)
361 >1t9b_A Acetolactate synthase,  35.6      24 0.00071   14.3   9.7   84   76-160    15-109 (197)
362 >1zgz_A Torcad operon transcri  35.6      24 0.00071   14.3   2.5   18  167-184    40-57  (122)
363 >3bc8_A O-phosphoseryl-tRNA(SE  35.6      20  0.0006   14.9   1.8   35  434-468    68-111 (117)
364 >1eu1_A Dimethyl sulfoxide red  35.3      24 0.00071   14.3   5.9   67  132-203    17-98  (265)
365 >1ko7_A HPR kinase/phosphatase  35.3      24 0.00072   14.3   3.8   41  142-182    73-113 (129)
366 >2gwr_A DNA-binding response r  35.2      24 0.00072   14.3   2.7   65   91-169     4-68  (124)
367 >2b5w_A Glucose dehydrogenase;  35.1      24  0.0007   14.4   2.1   35   89-127    27-62  (185)
368 >1a9x_A Carbamoyl phosphate sy  35.0      24 0.00072   14.3   5.5   21  162-182    60-80  (140)
369 >2d8a_A PH0655, probable L-thr  35.0      24 0.00072   14.3   6.1   87   80-180    11-98  (169)
370 >1kp8_A Groel protein; chapero  35.0      24 0.00072   14.3   3.3  102   74-183    37-141 (185)
371 >3dmy_A Protein FDRA; predicte  35.0      24 0.00072   14.3   2.9   87  103-198    18-109 (132)
372 >2wdc_A SOXB, sulfur oxidation  34.6      25 0.00073   14.2   4.6   23  479-501   255-277 (358)
373 >2poc_A D-fructose-6-, isomera  34.6      25 0.00073   14.2  12.3   91   82-184    40-136 (206)
374 >1j7j_A HPRT, hypoxanthine pho  34.5      18 0.00054   15.3   1.4   20  120-139     2-21  (39)
375 >2q2e_A Type II DNA topoisomer  34.4      25 0.00074   14.2   2.1   36  368-403    78-113 (156)
376 >1vd6_A Glycerophosphoryl dies  34.4      25 0.00074   14.2   5.1   28  161-188    23-50  (224)
377 >2gre_A Deblocking aminopeptid  34.4      25 0.00074   14.2   4.7  132   91-223    60-244 (251)
378 >2au3_A DNA primase; zinc ribb  34.4      25 0.00074   14.2   5.8   41   89-129    60-100 (125)
379 >3ks6_A Glycerophosphoryl dies  34.3      25 0.00074   14.2   7.2   24  315-338   190-213 (217)
380 >1n1b_A (+)-bornyl diphosphate  34.2      22 0.00065   14.6   1.8   25  100-124     1-25  (109)
381 >2cul_A Glucose-inhibited divi  34.0      25 0.00075   14.2   3.4   41  149-190     3-43  (169)
382 >1pq4_A Periplasmic binding pr  34.0      25 0.00075   14.2   4.8   62  115-181    15-80  (82)
383 >2vp8_A Dihydropteroate syntha  33.8      25 0.00075   14.1  10.4  112   59-179    46-166 (318)
384 >1zmd_A Dihydrolipoyl dehydrog  33.8      25 0.00075   14.1   2.6   41  147-188     4-44  (197)
385 >1t9b_A Acetolactate synthase,  33.8      25 0.00075   14.1   4.5   70  380-466   155-226 (258)
386 >3bre_A Probable two-component  33.6      16 0.00048   15.6   1.1   27  163-189    53-79  (147)
387 >3d8x_A Thioredoxin reductase   33.5      26 0.00076   14.1   5.2   42  147-189     8-49  (169)
388 >3kf8_A Protein STN1; OB fold;  33.5      26 0.00076   14.1   6.0   81  510-592    36-141 (179)
389 >1vjz_A Endoglucanase; TM1752,  33.4      26 0.00076   14.1   5.8   90  134-230    34-140 (341)
390 >1wu2_A MOEA protein, molybdop  33.4      26 0.00076   14.1   5.3   84   78-168    10-109 (164)
391 >3cwn_A Transaldolase B; direc  33.3      26 0.00076   14.1   5.7   99   71-177    87-195 (337)
392 >2pl1_A Transcriptional regula  33.3      26 0.00076   14.1   2.9   55   94-162     2-56  (121)
393 >3k9c_A Transcriptional regula  33.3      26 0.00077   14.1   7.3  111   90-219    10-123 (159)
394 >1t6t_1 Putative protein; stru  33.1      26 0.00077   14.1   3.7   45   84-128    54-98  (118)
395 >2ozp_A N-acetyl-gamma-glutamy  33.0      26 0.00077   14.0   4.7   85   90-178     2-97  (176)
396 >3gfp_A DEAD box protein 5; mR  33.0      26 0.00077   14.0   8.5   73   82-161    25-99  (189)
397 >1gu7_A 2,4-dienoyl-COA reduct  32.9      26 0.00077   14.0   2.6   14  114-127    38-51  (181)
398 >3fbg_A Putative arginate lyas  32.9      26 0.00077   14.0   8.5   75   89-178    29-103 (157)
399 3ckm_A The Yram C-Terminal Dom  32.9      26 0.00077   14.0   6.5   87   94-183     4-92  (327)
400 >1j5x_A Glucosamine-6-phosphat  32.8      26 0.00078   14.0   5.5  102   85-198     2-110 (139)
401 >1efv_A Electron transfer flav  32.6     5.9 0.00017   19.1  -1.3   93   86-182     7-101 (132)
402 >2oog_A Glycerophosphoryl dies  32.4      27 0.00079   14.0   3.7   38  152-189    24-68  (287)
403 >1ybh_A Acetolactate synthase,  32.2      27 0.00079   13.9  10.3   82   80-164     4-95  (174)
404 >1c4k_A Protein (ornithine dec  32.1      27  0.0008   13.9   2.2   42  149-197    79-131 (158)
405 >1v3u_A Leukotriene B4 12- hyd  32.0      27  0.0008   13.9   7.7   89   81-183    15-105 (182)
406 >2qzj_A Two-component response  31.9      27  0.0008   13.9   2.0   77   93-183     5-86  (136)
407 >1i6p_A Carbonic anhydrase; me  31.9      24  0.0007   14.4   1.7   22  162-183    51-73  (194)
408 >1dz3_A Stage 0 sporulation pr  31.9      27  0.0008   13.9   3.1   26  161-186    36-61  (109)
409 >2vt3_A REX, redox-sensing tra  31.8      27 0.00081   13.9   3.8   84   94-182     2-93  (130)
410 >2rdm_A Response regulator rec  31.8      27 0.00081   13.9   2.8   73   92-178     5-84  (132)
411 >2az4_A Hypothetical protein E  31.4      12 0.00035   16.7   0.1   53  147-199    31-97  (119)
412 >3c8y_A Iron hydrogenase 1; di  31.3      28 0.00082   13.8   4.6   93   82-176     2-111 (122)
413 >1zq1_A Glutamyl-tRNA(Gln) ami  31.3      28 0.00082   13.8   5.5   87  136-223    12-104 (135)
414 >1dd9_A DNA primase, DNAG; top  31.2      28 0.00082   13.8   3.4   30  134-163    46-75  (140)
415 >1coy_A Cholesterol oxidase; o  31.2      28 0.00082   13.8   4.6   30  156-185    17-46  (196)
416 >1zcc_A Glycerophosphodiester   31.2      28 0.00082   13.8   4.1   28  161-188    17-44  (248)
417 >2vbi_A Pyruvate decarboxylase  31.1      28 0.00083   13.8   4.2   67  107-179     4-71  (183)
418 >2a87_A TRXR, TR, thioredoxin   31.1      28 0.00083   13.8   3.3   50  146-196    11-60  (190)
419 >1efp_A ETF, protein (electron  31.0     9.6 0.00028   17.4  -0.5   93   86-182     6-100 (128)
420 >2etv_A Iron(III) ABC transpor  31.0      28 0.00083   13.8   4.6   39  142-182    89-127 (175)
421 >3klj_A NAD(FAD)-dependent deh  31.0      28 0.00083   13.8   9.3   85   73-165     3-91  (102)
422 >1pg5_A Aspartate carbamoyltra  30.9      28 0.00083   13.8   7.7   78   91-185     3-80  (123)
423 >3gms_A Putative NADPH:quinone  30.8      28 0.00083   13.8   4.6   77   89-178    16-92  (149)
424 >2iv2_X Formate dehydrogenase   30.8      28 0.00083   13.8   7.9  125  134-277     2-140 (218)
425 >1wsa_A Asparaginase, asparagi  30.8      28 0.00083   13.8   4.7   49  135-183    20-73  (125)
426 >3dla_A Glutamine-dependent NA  30.8      28 0.00084   13.8   3.1   57  141-197    37-113 (322)
427 >3gnn_A Nicotinate-nucleotide   30.8      28 0.00084   13.8   2.7   45  140-186    77-121 (165)
428 >2cbn_A Ribonuclease Z; phosph  30.7      12 0.00037   16.6   0.1   46  136-182    19-67  (130)
429 >2e5v_A L-aspartate oxidase; a  30.7      28 0.00084   13.8   3.4   54  153-206     2-55  (294)
430 >1h4p_A Glucan 1,3-beta-glucos  30.4      29 0.00085   13.7   2.3   53  136-188    73-142 (408)
431 >2uzz_A N-methyl-L-tryptophan   30.4      29 0.00085   13.7   2.8   36  151-187     4-39  (154)
432 >1efv_A Electron transfer flav  30.2      29 0.00085   13.7   3.3   10  248-257   112-121 (183)
433 >2qu7_A Putative transcription  30.1      29 0.00085   13.7   5.2   40  141-183    55-94  (152)
434 >1iok_A Chaperonin 60; chapero  30.1      29 0.00085   13.7   2.0   81   75-161    35-116 (182)
435 >1a2o_A CHEB methylesterase; b  30.1      29 0.00086   13.7   4.5   50  138-188    15-64  (144)
436 >1eo1_A Hypothetical protein M  30.1      29 0.00086   13.7   3.1   48  134-184    50-97  (124)
437 >3gk0_A PNP synthase, pyridoxi  30.0      29 0.00086   13.7   5.0   86   80-177    84-180 (278)
438 >2j6i_A Formate dehydrogenase;  29.9      29 0.00086   13.7   3.6   42  137-181    74-115 (168)
439 >3f8d_A Thioredoxin reductase   29.8      29 0.00086   13.7   3.6   68  148-223    14-81  (193)
440 >2ivf_A Ethylbenzene dehydroge  29.7      29 0.00087   13.6   6.4   59  134-197    13-78  (208)
441 >1cdo_A Alcohol dehydrogenase;  29.6      29 0.00087   13.6   7.4   83   89-184    22-105 (154)
442 >3dnf_A ISPH, LYTB, 4-hydroxy-  29.6      29 0.00087   13.6   5.1   66   77-152     5-81  (86)
443 >1req_B Methylmalonyl-COA muta  29.6      29 0.00087   13.6   5.4  115   77-198    17-145 (163)
444 >1ym3_A Carbonic anhydrase (ca  29.6      29 0.00087   13.6   1.9   20  164-183    93-113 (215)
445 >3ldt_A Outer membrane protein  29.4      30 0.00088   13.6   5.4   83   73-160    64-164 (169)
446 >2yrr_A Aminotransferase, clas  29.3      30 0.00088   13.6   3.9   55  411-465    55-117 (119)
447 >1zjj_A Hypothetical protein P  29.2      30 0.00088   13.6   2.5   87   69-181    13-99  (131)
448 >1ea5_A Acetylcholinesterase;   29.1      30 0.00089   13.6   2.6   13  393-405   314-326 (429)
449 >2esb_A Dual specificity prote  29.0      30 0.00089   13.6   5.2   26   73-98     78-103 (188)
450 >3eod_A Protein HNR; response   29.0      30 0.00089   13.6   2.0   78   91-182     6-88  (130)
451 >1j4a_A D-LDH, D-lactate dehyd  29.0      30 0.00089   13.6   4.0   41  136-177    57-97  (136)
452 >1ow3_A RHO-GTPase-activating   28.7      30  0.0009   13.5   2.8   47   71-119    22-68  (71)
453 >3goh_A Alcohol dehydrogenase,  28.6      30 0.00089   13.6   1.7   31   92-127     3-33  (114)
454 >2ef0_A Ornithine carbamoyltra  28.6      30  0.0009   13.5   5.4   71   91-183     2-72  (119)
455 >1zmd_A Dihydrolipoyl dehydrog  28.6      31  0.0009   13.5   4.3   96   90-195    18-117 (120)
456 >2dwc_A PH0318, 433AA long hyp  28.6      31  0.0009   13.5   6.4   79   92-176    19-108 (108)
457 >1kgs_A DRRD, DNA binding resp  28.5      31 0.00091   13.5   2.9   24  163-186    36-59  (124)
458 >2dkj_A Serine hydroxymethyltr  28.4      31 0.00091   13.5   6.1  107   75-184    59-170 (244)
459 >2eih_A Alcohol dehydrogenase;  28.0      31 0.00092   13.4   6.1   82   89-184    16-97  (145)
460 >2c0c_A Zinc binding alcohol d  28.0      29 0.00087   13.7   1.6   75   89-178    21-96  (179)
461 >1xa0_A Putative NADPH depende  27.9      31 0.00093   13.4   1.8   54   89-155    26-79  (172)
462 >3gqv_A Enoyl reductase; mediu  27.8      31 0.00093   13.4   7.1   37   89-129    35-71  (156)
463 >3c24_A Putative oxidoreductas  27.8      31 0.00093   13.4   4.9   88   91-184    10-103 (195)
464 >3iau_A Threonine deaminase; p  27.7      32 0.00093   13.4   4.8   76   81-169     8-84  (98)
465 >1nsj_A PRAI, phosphoribosyl a  27.6      32 0.00094   13.4   2.4   25  158-182     7-31  (205)
466 >1d4d_A Flavocytochrome C fuma  27.5      32 0.00094   13.4   3.6   41  146-187    27-67  (309)
467 >2fvy_A D-galactose-binding pe  27.5      32 0.00094   13.4   5.9   73  113-188    25-99  (164)
468 >3jyn_A Quinone oxidoreductase  27.5      32 0.00094   13.4   5.9   80   89-182     2-82  (132)
469 >2gkg_A Response regulator hom  27.4      32 0.00094   13.4   1.7   81   91-185     4-92  (127)
470 >2vi8_A Serine hydroxymethyltr  27.4      32 0.00094   13.4   5.3  108   74-184    58-170 (243)
471 >1mw9_X DNA topoisomerase I; d  27.4      32 0.00094   13.4   5.0   63   77-148    32-97  (100)
472 >1o89_A YHDH, B3253, YHDH; str  27.3      31 0.00092   13.4   1.6   10   90-99     27-36  (172)
473 >2dpl_A GMP synthetase, GMP sy  27.3      32 0.00095   13.3   8.6  103   77-184     2-131 (189)
474 >2bs2_A Quinol-fumarate reduct  27.1      32 0.00095   13.3   2.8   42  147-189     3-44  (309)
475 >2yw2_A Phosphoribosylamine--g  27.0      32 0.00096   13.3   5.2   67   94-180     2-69  (97)
476 >2eg4_A Probable thiosulfate s  26.9      32 0.00096   13.3   2.3   33   90-126    73-105 (121)
477 >1dlj_A UDP-glucose dehydrogen  26.9      33 0.00096   13.3   6.1   39   91-129     2-45  (96)
478 >2fuv_A Phosphoglucomutase; st  26.9      33 0.00096   13.3   3.7   32  148-179    21-52  (150)
479 >4pga_A Glutaminase-asparagina  26.8      33 0.00096   13.3   4.6   49  135-183    20-73  (126)
480 >1pii_A N-(5'phosphoribosyl)an  26.8      33 0.00096   13.3   2.8  129   51-196    21-155 (212)
481 >1hwx_A GDH, glutamate dehydro  26.8      33 0.00097   13.3   5.2   43  381-428    12-54  (131)
482 >1trb_A Thioredoxin reductase;  26.8      33 0.00097   13.3   3.3   42  150-192     6-47  (168)
483 >3c5e_A Acyl-coenzyme A synthe  26.7      33 0.00097   13.3   9.9  100   76-186     2-108 (123)
484 >2z5b_A Protein YPL144W, DMP1;  26.7      33 0.00097   13.3   1.8   52  375-430    92-143 (151)
485 >3fht_A ATP-dependent RNA heli  26.7      33 0.00097   13.3   7.2   77   76-159    39-117 (203)
486 >3fem_A Pyridoxine biosynthesi  26.6      33 0.00097   13.3   4.2   42  137-179    61-102 (297)
487 >1tmy_A CHEY protein, TMY; che  26.6      33 0.00097   13.3   7.6   78   92-182     2-84  (120)
488 >3l8m_A Probable thiamine pyro  26.5      33 0.00098   13.2   3.4  117   64-191    15-140 (212)
489 >2p6n_A ATP-dependent RNA heli  26.5      33 0.00098   13.2   6.8   73   80-159    41-114 (191)
490 >3lab_A Putative KDPG (2-keto-  26.3      33 0.00098   13.2   3.5   46  136-183     1-48  (217)
491 >3gux_A Putative Zn-dependent   26.2      33 0.00099   13.2   5.6   49   72-125    20-69  (314)
492 >2gz1_A Aspartate beta-semiald  26.1      33 0.00099   13.2   2.3  133   93-232     3-146 (165)
493 >1ddz_A Carbonic anhydrase; al  26.1      34 0.00099   13.2   1.8   22  162-183    43-65  (254)
494 >1toa_A Tromp-1, protein (peri  26.1      34 0.00099   13.2   4.5   99   91-199    35-139 (195)
495 >3hww_A 2-succinyl-5-enolpyruv  26.1      34 0.00099   13.2   5.1   17  317-333    46-62  (195)
496 >1hi9_A Dciaa, dipeptide trans  26.0      34   0.001   13.2   5.6   30  166-195    43-78  (274)
497 >2ez9_A Pyruvate oxidase; TPP   26.0      34   0.001   13.2  11.0  135   78-232    10-155 (229)
498 >2f7l_A 455AA long hypothetica  26.0      34   0.001   13.2   4.6   34  147-180    21-54  (136)
499 >3ip1_A Alcohol dehydrogenase,  26.0      34   0.001   13.2   7.0   77   89-178    31-107 (183)
500 >1ryi_A Glycine oxidase; flavo  25.9      34   0.001   13.2   3.2   34  153-186    20-53  (228)

No 1  
>>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A (A:49-242)
Probab=99.96  E-value=2.9e-28  Score=240.47  Aligned_cols=192  Identities=32%  Similarity=0.477  Sum_probs=174.0

Q ss_pred             CHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             95561487999999999997799799994078861528999999999769947998078743366889789887420268
Q gi|254780901|r   71 DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA  150 (600)
Q Consensus        71 dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~  150 (600)
                      +|++|++|+++++++.++++++++|+|++|+|+||.+++++|..+|...|..+.+++|++..++||++...+++..++ +
T Consensus         3 ~~~~~~~m~~~~~~l~~~l~~~~~i~I~~H~d~Dgda~~s~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~   81 (194)
T 2zxr_A            3 ALLPLKGLREAAALLEEALRQGKRIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHRLEEGYGVLMERVPEHLEA-S   81 (194)
T ss_dssp             CCCCCTTHHHHHHHHHHHHHTTCEEEEECCSSHHHHHHHHHHHHHHHHTTCEEEECCC---------------------C
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHC-C
T ss_conf             338865899999999999976997999960585077999999999998899769987786656888799999998608-9


Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             68999648876234555554179827996154476555672565237888864334430478899999999999702148
Q gi|254780901|r  151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN  230 (600)
Q Consensus       151 ~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~  230 (600)
                      +++|+||||+.+..+...+++.|.++||+|||.+++..+ ..+++||++.+  ++++.+|++|++|.+++.+.+.++...
T Consensus        82 d~vi~vD~~~~~~~~~~~~~~~~~~viiIDHH~~~~~~~-~~~~vn~~~~~--~~~~~~~~~~~~~~l~~~~~~~~~~~~  158 (194)
T 2zxr_A           82 DLFLTVDCGITNHAELRELLENGVEVIVTDHHTPGKTPP-PGLVVHPALTP--DLKEKPTGAGVAFLLLWALHERLGLPP  158 (194)
T ss_dssp             CEEEESCCC--------------CEEEEECCCC---------CEECGGGST--TCCCCCCHHHHHHHHHHHHHHHTTCCC
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCEEEEECCCCCCCCCC-CCEEECCCCCC--CCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             989997488334899998986799899949799987787-54576456577--653345221799999999874344433


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             8764077999999987754201111444118999987887751
Q gi|254780901|r  231 KVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR  273 (600)
Q Consensus       231 ~~~~~~~l~~~ldlvaiGTvaD~vpL~~eNR~lvk~GL~~l~~  273 (600)
                      .       .++.+++++|.++|.+++.++||.++++|++.|+.
T Consensus       159 ~-------~~~a~~l~~Gi~~Dt~~f~~~~~~~~~~a~~~L~a  194 (194)
T 2zxr_A          159 P-------LEYADLAAVGTIADVAPLWGWNRALVKEGLARIPA  194 (194)
T ss_dssp             C-------GGGHHHHHHHHHHTTCCCSHHHHHHHHHHHHHGGG
T ss_pred             H-------HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             9-------99998977765324435407789998756665303


No 2  
>>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A (A:327-422)
Probab=99.90  E-value=8.2e-24  Score=205.67  Aligned_cols=94  Identities=29%  Similarity=0.476  Sum_probs=88.7

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHHCEEEEEEECCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             47502620578581222222789988420107998863798379998648986188888853033530115653222314
Q gi|254780901|r  367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGL  446 (600)
Q Consensus       367 ~~~~ivv~~~~wh~GViGIVAsrL~e~y~kP~iv~s~~~dg~~kGS~RSi~g~~l~~~l~~~~~~~ll~~~GGH~~AaG~  446 (600)
                      +++++|+++++||+||+|||||||+++|+||+||++.     .|||+||++|+|++++|+.|++  ++.+||||++||||
T Consensus         2 ~~~~iv~~~~~~~~Gi~GiVA~rl~~~~~kP~iv~~~-----~kGS~Rs~~g~~l~~~l~~~~~--~l~~~GGH~~AaG~   74 (96)
T 2zxr_A            2 EAKAIVLLDPEGHPGVMGIVASRILEATLRPVFLVAQ-----GKGTVRSLAPISAVEALRSAED--LLLRYGGHKEAAGF   74 (96)
T ss_dssp             TCSSEEEECTTCCHHHHHHHHHHHHHHHCSCEEEEET-----TEEEEECCTTCCHHHHHHHTGG--GCSEEEECSSEEEE
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHCCEEEEEEEC-----CCEEEECCCCCCHHHHHHHHHH--HHHHCCCCCCCCEE
T ss_conf             5536998667665006889989999765710899961-----6320557788787999998667--77417983001301


Q ss_pred             EECCCCHHHHHHHHHHHHHHH
Q ss_conf             642221588999999999862
Q gi|254780901|r  447 TVERVNFGRLCDFFQKFAHNI  467 (600)
Q Consensus       447 ti~~~~l~~f~~~l~~~~~~~  467 (600)
                      |++++++++|++.+++++.+.
T Consensus        75 ~i~~~~~~~f~~~l~~~~~~~   95 (96)
T 2zxr_A           75 AMDEALFPAFKARVEAYAARF   95 (96)
T ss_dssp             ECCGGGHHHHHHHHHHHHHTS
T ss_pred             EECHHHHHHHHHHHHHHHHHH
T ss_conf             656643799999999999853


No 3  
>>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A (A:1-48,A:423-534)
Probab=99.87  E-value=1.1e-21  Score=188.94  Aligned_cols=111  Identities=20%  Similarity=0.322  Sum_probs=103.3

Q ss_pred             HCCCCEEEEEEECHHHCCHHHHHHHHHCCCCCCCCCCCEEEECCEEEEEEEEECCCEEEEEEECCCCCEEEEEEECCCCC
Q ss_conf             33771476044346897999999998518467899984684278099888884796499999849987799999778787
Q gi|254780901|r  472 ITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGT  551 (600)
Q Consensus       472 ~~~~~l~iD~el~~~~i~~~l~~~L~~lePFG~gNpeP~F~~~~~~i~~~r~vGk~Hlkl~l~~~~g~~i~aI~Fn~~~~  551 (600)
                      ++++.+.+|++++++++|.+++++|++|+|||+|||+|+|+++++++.+.+.+||+|+++.+.+     +++|+||..+.
T Consensus        49 d~~~~i~iD~eL~~~~i~~eli~~L~~LePFG~GNpePiF~~~~v~I~~~r~iGk~Hlkl~L~~-----~~aI~Fn~~~~  123 (160)
T 2zxr_A           49 DPVREVALLDLLPEPGLLPQVFRELALLEPYGEGNPEPLFLLFGAPEEARRLGEGRHLAFRLKG-----VRVLAWKQGDL  123 (160)
T ss_dssp             CCCEEEEECEECCCGGGHHHHHHHHGGGCSCSSSSCCCCEEEEECCEEEEESSSSSEEEEEETT-----EEEEEECCSSC
T ss_pred             HHCCHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEECCCEEEEEEECCCCEEEEEEEC-----CCEEEECCCCC
T ss_conf             0000022220147241139999999961977899998679734858998896278479999867-----99899889865


Q ss_pred             CHHHHHHCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEECCCC
Q ss_conf             01235530699879999997665457811058999980111311
Q gi|254780901|r  552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH  595 (600)
Q Consensus       552 ~~~~~~~~~~g~~idii~~l~~N~~~G~~s~QL~I~Di~p~e~~  595 (600)
                              ..+..+|++|++++|+|||++++|++|+|++|++..
T Consensus       124 --------~~~~~idiv~~l~~N~yrG~~s~Ql~I~Dir~a~~~  159 (160)
T 2zxr_A          124 --------ALPPEVEVAGLLSENAWNGHLAYEVQAVDLRKPEAL  159 (160)
T ss_dssp             --------SCCSSEEEEEEEEEEEETTEEEEEEEEEEEESCCCC
T ss_pred             --------CCCCEEEEEEEEEEEEECCEEEEEEEEEECCCCCCC
T ss_conf             --------679879999997178669974599999980574331


No 4  
>>3dma_A Exopolyphosphatase-related protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.25A {Bacteroides fragilis} (A:1-214)
Probab=99.81  E-value=2.2e-19  Score=170.99  Aligned_cols=176  Identities=14%  Similarity=0.057  Sum_probs=141.8

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEECC--CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHH--------
Q ss_conf             56148799999999999779979999407--88615289999999997699479980787433668897898--------
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIFGDY--DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLM--------  142 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~gDy--D~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i--------  142 (600)
                      ..+++|++++++|.++++++++|+|+|++  |+||++|++.|.++|+.+|.++.+++|.+..++|++.....        
T Consensus         2 ~~~~~~~~~~~~l~~~i~~~~~i~I~~h~~pD~D~i~Sa~~l~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (214)
T 3dma_A            2 LTKVIAQAHIDHFTKWFERADKIVIVSHVSPDGDAIGSSLGLYHFLDSQDKIVNVIVPNAFPDFLKWXPGSKDILLYDRY   81 (214)
T ss_dssp             CCCCSCHHHHHHHHHHHHHCSEEEEEECSSCCHHHHHHHHHHHHHHHHTSCEEEEEESSCCCGGGTTSTTGGGCEETTTC
T ss_pred             CCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCHHHHCCCC
T ss_conf             52599999999999998559949999589984689999999999999769988999799972788751243012210231


Q ss_pred             ---HHHHHCCCCEEEEECCCCCC--HHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             ---87420268689996488762--3455555417982799615447655567256523788886433443047889999
Q gi|254780901|r  143 ---EKFINEGAQLIITVDCGSTS--YDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL  217 (600)
Q Consensus       143 ---~~~~~~g~~LiItvD~Gi~~--~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~  217 (600)
                         ......+++++|+||||+.+  .+.++.++..+++++|+|||.++...++...+++|....|.+.++.+|+.|+.|+
T Consensus        82 ~~~~~~~~~~~d~vi~vD~~~~~~~~~~~~~~~~~~~~viviDHH~~~~~~~~~~~i~~~~~s~~~iv~~~l~~~g~~~~  161 (214)
T 3dma_A           82 QEFADKLIXEADVICCLDFNALKRIDEXSDIVAASPGRKIXIDHHLYPEDFCRITISHPEISSTSELVFRLICRXGYFSD  161 (214)
T ss_dssp             HHHHHHHHHHCSEEEEESCSSGGGGTTCHHHHHHCCSEEEEEECCSSCCSCSSEEEECTTSSCHHHHHHHHHHHTTCGGG
T ss_pred             HHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             76776406675199996688403321345544056761664466777788654036415777415799999998640378


Q ss_pred             HHHHHHHHH-----CCCCCC----CCHHHHHHHHHHHHHH
Q ss_conf             999999970-----214887----6407799999998775
Q gi|254780901|r  218 VLVLIYRIL-----RQDNKV----PLNFDLLSLLDLVALA  248 (600)
Q Consensus       218 l~~al~~~l-----~~~~~~----~~~~~l~~~ldlvaiG  248 (600)
                      +...+...+     .+-+.+    ....++..+.+|+++|
T Consensus       162 ~~~~~A~~l~~gi~~DT~~f~~~~~~~~d~~~~~~L~~~G  201 (214)
T 3dma_A          162 ISKEGAECIYTGXXTDTGGFTYNSNNREIYFIISELLSKG  201 (214)
T ss_dssp             CCHHHHHHHHHHHHHHTTTTTSSCCCHHHHHHHHHHHTTT
T ss_pred             CCHHHHHHHHHHHEECCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             8888999998653430364556788853677766776348


No 5  
>>3dev_A SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435} (A:1-196)
Probab=99.77  E-value=3.9e-18  Score=161.28  Aligned_cols=163  Identities=17%  Similarity=0.104  Sum_probs=136.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCH--HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHH-HHHHCCCCEEEEE
Q ss_conf             99999999997799799994078861--52899999999976994799807874336688978988-7420268689996
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDG--AASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLME-KFINEGAQLIITV  156 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DG--itstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~-~~~~~g~~LiItv  156 (600)
                      +++++|.++++++++|+|+|+.|+||  ++|+.+|..+|+.+|.++.+++|+++.+++++.....+ .....+++++|+|
T Consensus         3 ~~~~~l~~~i~~~~~ivI~~H~~~D~Dal~Sa~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v   82 (196)
T 3dev_A            3 EIFNEIXQRVKEAETIIIHRHVRPDPDAYGSQLGLKLYLERKFPEKNIYATGEAEPSLSFIGDLDEIDDSVYSDALVIVC   82 (196)
T ss_dssp             CHHHHHHHHHHTCSEEEEECBSSCCHHHHHHHHHHHHHHHHHCTTSEEEECCCCCGGGTTTCCCCCCCSSTTTTCEEEEE
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHCCCCHHHHHHHCCCCCEEEEC
T ss_conf             99999999996599299997998876999999999999997499869998999982544041023303321565278853


Q ss_pred             CCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHH
Q ss_conf             48876234555554179827996154476555672565237888864334430478899999999999702148876407
Q gi|254780901|r  157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF  236 (600)
Q Consensus       157 D~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~~~~  236 (600)
                      |||+.+....+. ...+..+||+|||.++...|+...+.+|          ..|+|++.|.+++++..    ....+   
T Consensus        83 D~~~~~~~~~~~-~~~~~~~iviDHH~~~~~~~~~~~i~~~----------~~S~s~iv~~l~~~~~~----~~~~~---  144 (196)
T 3dev_A           83 DTANAPRIDDQR-YLNGQSLIKIDHHPATDQYGDVNFVNTE----------ASSTSEIIFDFISHFND----LSIID---  144 (196)
T ss_dssp             SCSSGGGBSSGG-GGSSSCEEEEECSCSSCCCSSEEEECTT----------SSCHHHHHHHHHHTTTC----TTTCC---
T ss_pred             CCCCHHHHHHHH-HHCCCEEEEEECCCCCCCCCCCCCCCCC----------CCCCHHHHHHHHHHHHH----CCCCC---
T ss_conf             675044554788-8629829997346665554321222223----------56504799999997541----25899---


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHH
Q ss_conf             79999999877542011114441189
Q gi|254780901|r  237 DLLSLLDLVALATVCDVVPLIGLNRA  262 (600)
Q Consensus       237 ~l~~~ldlvaiGTvaD~vpL~~eNR~  262 (600)
                        .++..+.++|.++|.+++.++||.
T Consensus       145 --~~~a~ll~~Gi~~Dt~~l~~~~~t  168 (196)
T 3dev_A          145 --EHVARVLYLGIVGDTGRFLFSNTS  168 (196)
T ss_dssp             --HHHHHHHHHHHHHHTTTTTSTTCC
T ss_pred             --HHHHHHHHHHEEECCCCCCCCCCC
T ss_conf             --999998755505315775335665


No 6  
>>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A (A:243-326)
Probab=99.70  E-value=7.6e-18  Score=159.01  Aligned_cols=83  Identities=35%  Similarity=0.496  Sum_probs=78.2

Q ss_pred             CCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68874357898708886424234566677430623331212222100203425899999999998999999999999999
Q gi|254780901|r  274 QGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQ  353 (600)
Q Consensus       274 ~~~~gl~~L~~~~~~~~~i~~~di~f~iaPrINAaGRl~~a~~av~lL~~~d~~~a~~la~~L~~lN~~Rk~~e~~i~~~  353 (600)
                      ++||||++|++.+++  +++++||||.|||||||+|||++|..|++||+++|..+|..++.+|+++|++||++|++++++
T Consensus         1 T~~~Gl~~L~~~~~~--~~~~~di~f~iaP~iNA~GRl~~a~~av~lL~~~d~~~a~~~a~~l~~~N~~Rk~~~~~i~~~   78 (84)
T 2zxr_A            1 SSWVGLRLLAEAVGY--TGKAVEVAFRIAPRINAASRLGEAEKALRLLLTDDAAEAQALVGELHRLNARRQTLEEAMLRK   78 (84)
T ss_dssp             CSSHHHHHHHHHTTC--CSCHHHHHHTHHHHHHHHHHTTCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHC--CCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             678228999733440--574666666676440534432202443454405888999999999986328999999999999


Q ss_pred             HHHHH
Q ss_conf             99998
Q gi|254780901|r  354 AEAKV  358 (600)
Q Consensus       354 a~~~~  358 (600)
                      |.+++
T Consensus        79 a~~~~   83 (84)
T 2zxr_A           79 LLPQA   83 (84)
T ss_dssp             HTTSS
T ss_pred             HHHHH
T ss_conf             87654


No 7  
>>2eb0_A Manganese-dependent inorganic pyrophosphatase; DHH domain, DHHA2 domain, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} (A:1-191)
Probab=99.60  E-value=3.9e-17  Score=153.48  Aligned_cols=170  Identities=16%  Similarity=0.056  Sum_probs=133.7

Q ss_pred             EEEEE--CCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHC
Q ss_conf             99994--0788615289999999997699479980787433668897898874202686899964887623455555417
Q gi|254780901|r   95 IMIFG--DYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQ  172 (600)
Q Consensus        95 I~I~g--DyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~  172 (600)
                      |.|+|  ++|+||++|+..++.+|+.+|.++.+++|+|+.++|+++....+.....+.+++|+||||  +.+.+..+.+.
T Consensus         2 iiV~gh~~~D~D~i~Sa~~l~~~l~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~ii~vD~~--~~~~~~~~~~~   79 (191)
T 2eb0_A            2 RYVVGHKNPDTDSIASAIVLAYFLDCYPARLGDINPETEFVLRKFGVMEPELIESAKGKEIILVDHS--EKSQSFDDLEE   79 (191)
T ss_dssp             EEEECCSSCCHHHHHHHHHHHHHHTSEEEESSCCCHHHHHHHHHHTCCCCEECCCCTTCEEEEESCC--CGGGSCTTGGG
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCCHHHCCCCCCCEEEEECCC--CHHHCHHHHHH
T ss_conf             7985799953789999999999986189706978848899998779985565145678889997899--53314356864


Q ss_pred             CCCEEEECCCCCCCCCCCCEEEECCCCC-CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9827996154476555672565237888-864334430478899999999999702148876407799999998775420
Q gi|254780901|r  173 GIDVIVIDHHQVKSEEIPAYALVNPNRL-DDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC  251 (600)
Q Consensus       173 GidvIVtDHH~~~~~~p~a~aivNP~~~-~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~~~~~l~~~ldlvaiGTva  251 (600)
                      +..++|+|||.++...|++..+++|... .|...+..++++|+.|+..+.          .+..   .+...+.+.|.+.
T Consensus        80 ~~~~~viDHH~~~~~~~~~~~~i~~~~~S~~tlv~~~l~~~~~~~~~~~~----------~~i~---~~~A~~l~~gI~~  146 (191)
T 2eb0_A           80 GKLIAIIDHHKVGLTTTEPILYYAKPVGSTATVIAELYFKDAIDLIGGKK----------KELK---PDLAGLLLSAIIS  146 (191)
T ss_dssp             SEEEEEEESSCCCCCCSSCCEEEECSSSCHHHHHHHHHHTTCGGGGTCCC----------CCCC---HHHHHHHHHHHHH
T ss_pred             CCEEEEEECCCCCCCCCCCCEEECCCCCCHHHHHHHHHHHHCCCCCCCCC----------CCCC---HHHHHHHHHHHHH
T ss_conf             66279982455567776651686487370999999999983844011224----------4689---9999998647998


Q ss_pred             CCCCCCCC-----CHHHHHHHHHHHHHCCCCCH
Q ss_conf             11114441-----18999987887751688743
Q gi|254780901|r  252 DVVPLIGL-----NRAYVVKGLMVARRQGNPGL  279 (600)
Q Consensus       252 D~vpL~~e-----NR~lvk~GL~~l~~~~~~gl  279 (600)
                      |...+...     ++..++.-++..+...+..+
T Consensus       147 DT~~f~~~~~t~~d~~~~~~L~~~~~~~~~~~~  179 (191)
T 2eb0_A          147 DTVLFKSPTTTDLDKEMAKKLAEIAGISNIEEF  179 (191)
T ss_dssp             HHTTTTSTTCCHHHHHHHHHHHHHHTCSCHHHH
T ss_pred             HHCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHH
T ss_conf             726378898888899999998865698549999


No 8  
>>2haw_A Manganese-dependent inorganic pyrophosphatase; substrate complex, hydrolase; HET: 1PE PG4; 1.75A {Bacillus subtilis} (A:1-192)
Probab=98.82  E-value=1.8e-08  Score=85.61  Aligned_cols=146  Identities=18%  Similarity=0.182  Sum_probs=97.1

Q ss_pred             CCEEEEECC--CCCHHHHHHHHHHHHHHCCCCEEEEECCCC-------CCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             979999407--886152899999999976994799807874-------33668897898874202686899964887623
Q gi|254780901|r   93 EKIMIFGDY--DVDGAASVALMMRFLSHCSVNANMYIPDRI-------VDGYGPNPSLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        93 ekI~I~gDy--D~DGitstail~~~L~~~g~~v~~~IP~R~-------~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      ++|.|.|+.  |.|+++|+..+..+|+.+|.++..+.|...       .+.+++...........+.+++|+|||+  +.
T Consensus         2 ~~i~V~gh~~pD~Dsi~Sa~ala~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~ii~vD~~--~~   79 (192)
T 2haw_A            2 EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHN--ER   79 (192)
T ss_dssp             CCEEEECCSSCCHHHHHHHHHHHHHHHHTTCCEEEEESSCCCHHHHHHHHHTTCCCCEECSCSTTTCSEEEEESCC--CG
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCCHHHHHHHCCCCCCEEECCCC--CH
T ss_conf             9689962999737999999999999997199869998899996899999877985303554320136521566789--94


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCCC-CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHH
Q ss_conf             455555417982799615447655567-2565237888864334430478899999999999702148876407799999
Q gi|254780901|r  164 DALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL  242 (600)
Q Consensus       164 e~i~~a~~~GidvIVtDHH~~~~~~p~-a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~~~~~l~~~l  242 (600)
                      +.+....+.+..++|+|||...+..+. ....+.|..         -|.+.+.+.+.+..    +  ..+  .   .+..
T Consensus        80 ~~~~~~~~~~~~~~viDHH~~~~~~~~~~~~~~~~~~---------~S~~~lv~~~~~~~----~--~~~--~---~~~a  139 (192)
T 2haw_A           80 QQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPV---------GCTATILNKMYKEN----N--VKI--E---KEIA  139 (192)
T ss_dssp             GGSCTTGGGSEEEEEEECSCCCSCCCSSCCEEEECCS---------SCHHHHHHHHHHHT----T--CCC--C---HHHH
T ss_pred             HHHHHHHHHCCEEEEEECCCCCCCCCCCCCEEECCCC---------CCHHHHHHHHHHHC----C--CCC--C---HHHH
T ss_conf             5544668657608998357777877667515741786---------84899999999973----9--998--9---9999


Q ss_pred             HHHHHHHHHCCCCCCCCC
Q ss_conf             998775420111144411
Q gi|254780901|r  243 DLVALATVCDVVPLIGLN  260 (600)
Q Consensus       243 dlvaiGTvaD~vpL~~eN  260 (600)
                      .+.+.|.+.|-.-+...|
T Consensus       140 ~ll~~gI~~DT~~f~~~~  157 (192)
T 2haw_A          140 GLMLSAIISDSLLFKSPT  157 (192)
T ss_dssp             HHHHHHHHHHHTTTTSTT
T ss_pred             HHHHHHHHHHHHHCCCCC
T ss_conf             999879998752227799


No 9  
>>1wpn_A Manganese-dependent inorganic pyrophosphatase; metal binding, hydrolase; 1.30A {Bacillus subtilis} (A:)
Probab=98.79  E-value=4.3e-08  Score=82.74  Aligned_cols=146  Identities=18%  Similarity=0.170  Sum_probs=95.7

Q ss_pred             CCEEEEEC--CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-------CCCCCCHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             97999940--78861528999999999769947998078743-------3668897898874202686899964887623
Q gi|254780901|r   93 EKIMIFGD--YDVDGAASVALMMRFLSHCSVNANMYIPDRIV-------DGYGPNPSLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        93 ekI~I~gD--yD~DGitstail~~~L~~~g~~v~~~IP~R~~-------eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      ++|.|+|+  .|.|+++|+..+..+|+.+|.++..+.|....       +.+|+.............+++|+|||+  +.
T Consensus         2 ~~i~V~gH~~pD~Dsi~Sa~ala~~l~~~g~~~~~~~~~~i~~~~~~~~~~~~i~~~~~~~~~~~~~~~~i~vD~~--~~   79 (188)
T 1wpn_A            2 EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHN--ER   79 (188)
T ss_dssp             CCEEEECCSSCCHHHHHHHHHHHHHHHHTTCCEEEEESSCCCHHHHHHHHHTTCCCCEECSCSTTTCSEEEEESCC--CG
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCEEECCCC--CH
T ss_conf             8499948999975899999999999998199869997899997999999876775422001010101202302588--75


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCCC-CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHH
Q ss_conf             455555417982799615447655567-2565237888864334430478899999999999702148876407799999
Q gi|254780901|r  164 DALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL  242 (600)
Q Consensus       164 e~i~~a~~~GidvIVtDHH~~~~~~p~-a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~~~~~l~~~l  242 (600)
                      +.+....+..-.++|+|||..++..++ ....++|..         -|.+-+.|.++..+    +    .+...   +..
T Consensus        80 ~~~~~~~~~~~~~~iIDHH~~~~~~~~~~~~~v~~~~---------~st~~lv~~~l~~~----~----~~i~~---~~a  139 (188)
T 1wpn_A           80 QQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPV---------GCTATILNKMYKEN----N----VKIEK---EIA  139 (188)
T ss_dssp             GGSCTTGGGSEEEEEEECSCCCSCCCSSCCEEEECSS---------SCHHHHHHHHHHHT----T----CCCCH---HHH
T ss_pred             HHHHHHHHHCCEEEEEECCCCCCCCCCCCCEECCCCC---------CCHHHHHHHHHHHC----C----CCCCH---HHH
T ss_conf             4446778527818997356765666433220037764---------65999999999981----9----98899---999


Q ss_pred             HHHHHHHHHCCCCCCCCC
Q ss_conf             998775420111144411
Q gi|254780901|r  243 DLVALATVCDVVPLIGLN  260 (600)
Q Consensus       243 dlvaiGTvaD~vpL~~eN  260 (600)
                      .+...|.+.|-.-+.-.|
T Consensus       140 ~ll~~gI~~DT~~f~~~~  157 (188)
T 1wpn_A          140 GLMLSAIISDSLLFKSPT  157 (188)
T ss_dssp             HHHHHHHHHHHTTTTSTT
T ss_pred             HHHHHHHHHHHCCCCCCC
T ss_conf             999869999827567899


No 10 
>>3dev_A SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435} (A:197-320)
Probab=98.17  E-value=7.5e-06  Score=65.22  Aligned_cols=85  Identities=19%  Similarity=0.165  Sum_probs=65.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHCEE-EEEEECCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEECC-CCHH
Q ss_conf             8581222222789988420107-9988637983799986489861888888530335301156532223146422-2158
Q gi|254780901|r  377 RWHPGIVGLLAARLKEKFGRPS-FAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER-VNFG  454 (600)
Q Consensus       377 ~wh~GViGIVAsrL~e~y~kP~-iv~s~~~dg~~kGS~RSi~g~~l~~~l~~~~~~~ll~~~GGH~~AaG~ti~~-~~l~  454 (600)
                      ++..+-+..+++.+....+.++ +++.. .++..++|+|| .++|+.++....       .+|||+.|||++++. +.++
T Consensus        36 g~~~~~~~~~~~~l~~i~~~~i~~~~~e-~~~~~~vs~RS-~~~~v~~ia~~f-------GGGGH~~AAg~~i~~~~~~~  106 (124)
T 3dev_A           36 DIQPNEASQFVNTVADISGLKIWXFGVD-EGDQIRCRIRS-KGITINDVANQF-------GGGGHPNASGVSVYSWDEFE  106 (124)
T ss_dssp             TCCHHHHTTCGGGSTTBTTCCEEEEEEE-CSSSEEEEEEE-SSSCCHHHHHHT-------TCEEETTEEEEEESSHHHHH
T ss_pred             CCCCHHHHHHHHHHCCCCCCEEEEEEEE-ECCEEEEEEEC-CCCCHHHHHHHC-------CCCCCHHHHEEEECCCCCHH
T ss_conf             2563146678887546268459999999-89989999978-998899999880-------99988687178857865299


Q ss_pred             HHHHHHHHHHHHHCCH
Q ss_conf             8999999999862264
Q gi|254780901|r  455 RLCDFFQKFAHNIVPA  470 (600)
Q Consensus       455 ~f~~~l~~~~~~~~~~  470 (600)
                      .+.+.+.+.+.+....
T Consensus       107 ~~~~~l~~~i~~~~~~  122 (124)
T 3dev_A          107 ELAQALRQKLLEHHHH  122 (124)
T ss_dssp             HHHHHHHHHTTSCC--
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999764034


No 11 
>>1k20_A Manganese-dependent inorganic pyrophosphatase; family II ppase, binuclear metal centre, hydrolase; 1.50A {Streptococcus gordonii} (A:1-192)
Probab=98.13  E-value=0.00011  Score=55.99  Aligned_cols=146  Identities=18%  Similarity=0.163  Sum_probs=87.6

Q ss_pred             CCEEEEEC--CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC--------CCCCCCHH-HHHHHHHCCCCEEEEECCCCC
Q ss_conf             97999940--78861528999999999769947998078743--------36688978-988742026868999648876
Q gi|254780901|r   93 EKIMIFGD--YDVDGAASVALMMRFLSHCSVNANMYIPDRIV--------DGYGPNPS-LMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        93 ekI~I~gD--yD~DGitstail~~~L~~~g~~v~~~IP~R~~--------eGYGl~~~-~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      .+|.|.|+  -|.|+++|+..++.+|+..|.+...++|....        +..++... .+........+++|+|||+  
T Consensus         1 ~~iiv~gh~~pD~Dai~Sa~a~a~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~iilvD~~--   78 (192)
T 1k20_A            1 SKILVFGHQNPDSDAIGSSYAFAYLAREAYGLDTEAVALGEPNEETAFVLDYFGVAAPRVITSAKAEGAEQVILTDHN--   78 (192)
T ss_dssp             CCEEEECCSSCCHHHHHHHHHHHHHHHHHHCCCEEECBSSCCCHHHHHHHHHHTCCCCCBCSCTGGGTCSEEEEESCC--
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCCHHHHCCCCCCCCCCEEECCCC--
T ss_conf             979998899988099999999999999737997399978999979999997679973244300011135613777888--


Q ss_pred             CHHHHHHHHHCCCCEEEECCCCCCCCCCC-CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHH
Q ss_conf             23455555417982799615447655567-25652378888643344304788999999999997021488764077999
Q gi|254780901|r  162 SYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS  240 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIVtDHH~~~~~~p~-a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~~~~~l~~  240 (600)
                      +.+.+....+..--++|+|||...+..+. ....+.|..         -|.+.+.|.+++..    +  ..+  ..... 
T Consensus        79 ~~~~~~~~~~~~~~~~vIDHH~~~~~~~~~~~~~~~~~~---------gS~~tiv~~~~~~~----~--~~i--~~~~A-  140 (192)
T 1k20_A           79 EFQQSVADIAEVEVYGVVDHHRVANFETANPLYMRLEPV---------GSASSIVYRMFKEH----S--VAV--SKEIA-  140 (192)
T ss_dssp             CGGGSCTTGGGSEEEEEEECSCCCSCCCSSCCEEEECSS---------SCHHHHHHHHHHHT----T--CCC--CHHHH-
T ss_pred             CHHHHHHHHHHCCEEEEEEECCCCCCCCCCCEEEECCCC---------CCHHHHHHHHHHHC----C--CCC--CHHHH-
T ss_conf             733445678536605898602467776667417864776---------84899999999971----8--998--99999-


Q ss_pred             HHHHHHHHHHHCCCCCCCCC
Q ss_conf             99998775420111144411
Q gi|254780901|r  241 LLDLVALATVCDVVPLIGLN  260 (600)
Q Consensus       241 ~ldlvaiGTvaD~vpL~~eN  260 (600)
                        .+.+.|.+.|-..+.-.|
T Consensus       141 --~ll~~gI~~DT~~f~~~~  158 (192)
T 1k20_A          141 --GLMLSGLISDTLLLKSPT  158 (192)
T ss_dssp             --HHHHHHHHHHHTTTTSTT
T ss_pred             --HHHHHHHHHHHCCCCCCC
T ss_conf             --998758978627778999


No 12 
>>3dma_A Exopolyphosphatase-related protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.25A {Bacteroides fragilis} (A:215-343)
Probab=98.04  E-value=6.9e-05  Score=57.68  Aligned_cols=82  Identities=15%  Similarity=0.056  Sum_probs=56.7

Q ss_pred             HHHHHHHHHHHHHHHHCEE-EEEEECCC-CEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCHHHHH
Q ss_conf             1222222789988420107-99886379-837999864898618888885303353011565322231464222158899
Q gi|254780901|r  380 PGIVGLLAARLKEKFGRPS-FAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLC  457 (600)
Q Consensus       380 ~GViGIVAsrL~e~y~kP~-iv~s~~~d-g~~kGS~RSi~g~~l~~~l~~~~~~~ll~~~GGH~~AaG~ti~~~~l~~f~  457 (600)
                      ..-+..+++.+..--+..+ +++...+| +..++|+||.+.+|+.++..+      +..+|||+.|||++++... +++.
T Consensus        41 ~~~~~~~~~~l~~i~gv~~~~~~~~~~d~~~i~vs~RS~~~idv~~ia~~------~~gGGGH~~AAg~~i~~~~-~~~~  113 (129)
T 3dma_A           41 KGDSEGFVNIPLSIKNVCFSCFLREDTEKKXIKISLRSVGKFPCNRLAAE------FFNGGGHLNASGGEFYGTX-EEAV  113 (129)
T ss_dssp             TTTTTTGGGGGGGSTTCCEEEEEEECCCC--EEEEEEESSSCCHHHHHHH------HTSCEECSSEEEEEECSCH-HHHH
T ss_pred             HHHHHHHHHHHCCCCCEEEEEEEEEECCCCEEEEEEECCCCCCHHHHHHH------HCCCCCCHHHCEEEECCCH-HHHH
T ss_conf             57777766554151675589999997579989999984998789999998------6699882775115757989-9999


Q ss_pred             HHHHHHHHHHC
Q ss_conf             99999998622
Q gi|254780901|r  458 DFFQKFAHNIV  468 (600)
Q Consensus       458 ~~l~~~~~~~~  468 (600)
                      +.+.+.+.+.+
T Consensus       114 ~~l~~~i~~~~  124 (129)
T 3dma_A          114 KVFEQALEKYK  124 (129)
T ss_dssp             HHHHHHHHHSH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 13 
>>2qb7_A Exopolyphosphatase; A/B/A structure, DHH family phosphatase, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2qb6_A 2qb8_A* (A:1-255)
Probab=97.27  E-value=0.0009  Score=48.96  Aligned_cols=159  Identities=14%  Similarity=0.024  Sum_probs=82.6

Q ss_pred             HHHHHHHHCCCCEEEEECC--CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC----------CCCCHHHH--------
Q ss_conf             9999999779979999407--886152899999999976994799807874336----------68897898--------
Q gi|254780901|r   83 RRIVQAIYNSEKIMIFGDY--DVDGAASVALMMRFLSHCSVNANMYIPDRIVDG----------YGPNPSLM--------  142 (600)
Q Consensus        83 ~ri~~ai~~~ekI~I~gDy--D~DGitstail~~~L~~~g~~v~~~IP~R~~eG----------YGl~~~~i--------  142 (600)
                      +.+.+.+++.+.|.|.|+-  |.|++.|+.-+..+|+..|.++..+.|.....-          .=++++..        
T Consensus        18 ~~l~~~i~~~~~iiv~gH~~pD~Dai~Saiala~~l~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   97 (255)
T 2qb7_A           18 LPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKI   97 (255)
T ss_dssp             SCHHHHSBTTEEEEEECCTTCCHHHHHHHHHHHHHHHHHHHSGGGSSSCCCCCCEEECSSCGGGGGGCHHHHHHHHHTTC
T ss_pred             HHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCEEECCCHHHCCCCHHHHHHHHHCCC
T ss_conf             89999753699889969999878899999999999996499844761378765301221550103357578999987599


Q ss_pred             -----------HHH----HHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCC-EEEECCCCCCCCCCC
Q ss_conf             -----------874----2026868999648876234555554179827996154476555672-565237888864334
Q gi|254780901|r  143 -----------EKF----INEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA-YALVNPNRLDDLSGQ  206 (600)
Q Consensus       143 -----------~~~----~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a-~aivNP~~~~~~~p~  206 (600)
                                 +..    .......++.||.--.  .+ ..-...+-.|+|+|||......+++ ..++.|-        
T Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~--~~-~~~~~~~~~v~iIDHH~~~~~~~~~~~~~i~~~--------  166 (255)
T 2qb7_A           98 KEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDT--PK-NLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVS--------  166 (255)
T ss_dssp             CGGGSCCHHHHHHHHHHSCTTCEEEEEEESCSSC--CG-GGTTTCCEEEEEEECSCCCCCCTTCSSEEECCC--------
T ss_pred             CHHHEEEHHCCHHHHHHHCCCCCCEEEEEECCCC--HH-HHHHHHCCEEEEECCCCCCCCCCCCCEEEECCC--------
T ss_conf             6153563101056665311245531999867861--44-332100232588504321356788770463687--------


Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHH
Q ss_conf             43047889999999999970214887640779999999877542011114441189
Q gi|254780901|r  207 GHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRA  262 (600)
Q Consensus       207 ~~l~gaGvaf~l~~al~~~l~~~~~~~~~~~l~~~ldlvaiGTvaD~vpL~~eNR~  262 (600)
                       .=|.+-|+++|..++..      ..+...   ....+...|.+.|-.-+......
T Consensus       167 -gsstt~i~~~l~~~~~~------~~~i~~---~~A~~L~~gIl~DT~~f~~~~t~  212 (255)
T 2qb7_A          167 -GSCSSLVFNYWYEKLQG------DREVVM---NIAPLLMGAILIDTSNMRRKVEE  212 (255)
T ss_dssp             -SCHHHHHHHHHHHHTTT------CHHHHH---HHHHHHHHHHHHHTTTTTSSCCH
T ss_pred             -CCHHHHHHHHHHHHHCC------CCCCHH---HHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             -62799999999987405------787609---99999999999865144788981


No 14 
>>2zvf_A Alanyl-tRNA synthetase; C-terminal, oligomerization domain, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 3.20A {Archaeoglobus fulgidus} (A:27-171)
Probab=96.18  E-value=0.13  Score=32.00  Aligned_cols=138  Identities=15%  Similarity=0.106  Sum_probs=85.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCEEEEEEECCC
Q ss_conf             89999999999899999999999999999998752112434750262057858122222278998842010799886379
Q gi|254780901|r  327 QELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED  406 (600)
Q Consensus       327 ~~a~~la~~L~~lN~~Rk~~e~~i~~~a~~~~~~~~~~~~~~~~ivv~~~~wh~GViGIVAsrL~e~y~kP~iv~s~~~d  406 (600)
                      +....+.+++..++++.+.+..++.....+.+.....+. +...+++...+...-.+-.+|..+.+++  |+++++..++
T Consensus         6 ~~v~~l~~e~k~l~k~~~~l~~~l~~~~~~~l~~~~~~~-~~~~~~~~~~~~~~~~l~~~~~~l~~~~--~~~~~~~~~~   82 (145)
T 2zvf_A            6 KTVERFFEEWKDQRKEIERLKSVIADLWADILXERAEEF-DSXKVVAEVVDADXQALQKLAERLAEKG--AVGCLXAKGE   82 (145)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCEES-SSCEEEEEECSCCHHHHHHHHHHHHHTT--EEEEEEEECS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCEEEEEEECCCHHHHHHHHHHHHCCC--CEEEEEECCC
T ss_conf             999999999999999999999999998788898654503-7950688662589899999999984347--7488761268


Q ss_pred             CEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEE-CCCCHHHHHHHHHHHHHHHC
Q ss_conf             837999864898618888885303353011565322231464-22215889999999998622
Q gi|254780901|r  407 GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTV-ERVNFGRLCDFFQKFAHNIV  468 (600)
Q Consensus       407 g~~kGS~RSi~g~~l~~~l~~~~~~~ll~~~GGH~~AaG~ti-~~~~l~~f~~~l~~~~~~~~  468 (600)
                      +....=+....+++..+.+...... +-.++||-+.-|-=+. ..++++++.+.+.+++.+.+
T Consensus        83 ~k~~~~~~~~~~l~a~~~~k~~~~~-~~GkGGGk~~~AQG~~~~~~~l~~~l~~~~~~l~~~L  144 (145)
T 2zvf_A           83 GKVFVVTFSGQKYDARELLREIGRV-AKGSGGGRKDVAQGAVQQLLDREEXLDVIFRFLSEHE  144 (145)
T ss_dssp             SSEEEEEEESSSSCHHHHHHHHHHH-HTEECCBCSSEEEEEESSCCCHHHHHHHHHHHHHHHT
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHH-CCCCCCCCHHHEEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             8515886067777799999999987-4998689658704379986689999999999998725


No 15 
>>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxane, DNA binding protein; 2.00A {Homo sapiens} (A:)
Probab=96.16  E-value=0.13  Score=32.17  Aligned_cols=85  Identities=14%  Similarity=0.256  Sum_probs=64.1

Q ss_pred             CCCEEEECCEEEEEEEEECC--------CEEEEEEECCCCCEEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECC
Q ss_conf             98468427809988888479--------6499999849987799999778787012355306998799999976654578
Q gi|254780901|r  507 PNPVFAFPNHKLQSIRVVNL--------AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG  578 (600)
Q Consensus       507 peP~F~~~~~~i~~~r~vGk--------~Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G  578 (600)
                      ++..|.+.+..+..++++|.        ..+.+.+.|..|..+.++||.-.............|..+.++++++.  |+|
T Consensus        60 ~~~~~~i~g~~v~~V~ivG~V~~i~~~~~~~~~~idDgTG~~i~v~~~~~~~~~~~~~~~i~~g~yVrV~G~lk~--f~~  137 (270)
T 2pi2_A           60 VDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRS--FQN  137 (270)
T ss_dssp             ETTEEEETTEEESEEEEEEEEEEEEECSSEEEEEEECSSSSCEEEEEECC-------CCCCCTTCEEEEEEEEEE--ETT
T ss_pred             CCCCEEECCEEEEEEEEEEEEEEEEECCCEEEEEEECCCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEECC--CCC
T ss_conf             799769999998999999999689865866899997799984799997179986444651447988999999732--398


Q ss_pred             CCEEEEEEEEEEECCCC
Q ss_conf             11058999980111311
Q gi|254780901|r  579 SKRCQLRVLDASPVEGH  595 (600)
Q Consensus       579 ~~s~QL~I~Di~p~e~~  595 (600)
                      +  .++.+..|+|++..
T Consensus       138 ~--~~i~~~~I~~V~d~  152 (270)
T 2pi2_A          138 K--KSLVAFKIMPLEDM  152 (270)
T ss_dssp             E--EEEEEEEEEECSCT
T ss_pred             E--EEEEEEEEEEECCC
T ss_conf             5--78999999990685


No 16 
>>2zj3_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* (A:217-375)
Probab=94.66  E-value=0.4  Score=28.24  Aligned_cols=133  Identities=11%  Similarity=0.143  Sum_probs=66.0

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH--HHHHHHC-CCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             79999999999977997999940788615289999--9999976-99479980787433668897898874202686899
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALM--MRFLSHC-SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLII  154 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail--~~~L~~~-g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiI  154 (600)
                      +++..+++.+.+.+.++|.|+|   + |.+...-.  ..-|..+ |..+..+-+..+..      ..+..+.++  +++|
T Consensus         1 ~e~~~~~~~~~l~~a~~i~i~G---~-G~s~~~A~~~~~kl~~~~~~~~~~~~~~~~~~------~~~~~~~~~--d~vi   68 (159)
T 2zj3_A            1 MDDEIQKLATELYHQKSVLIMG---R-GYHYATCLEGALKIKEITYMHSEGILAGELKH------GPLALVDKL--MPVI   68 (159)
T ss_dssp             THHHHHHHHHHHTTCSEEEEEE---C-GGGHHHHHHHHHHHHHHHCCEEEEEEGGGGGG------TGGGGCSTT--SCEE
T ss_pred             CCHHHHHHHHHHHHCCCCEEEC---C-CCCHHHHHHHHHHHHHHHCEEEEEECHHHHHC------CCHHHCCCC--CCEE
T ss_conf             2034567899975354554756---8-74378999999999886351347722576407------526650799--7189


Q ss_pred             EE-CCCCC-C-H-HHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             96-48876-2-3-455555417982799-61544765556725652378888643344304788999999999997
Q gi|254780901|r  155 TV-DCGST-S-Y-DALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRI  225 (600)
Q Consensus       155 tv-D~Gi~-~-~-e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~  225 (600)
                      .. -.|-+ . . +.++.++++|+.||+ |+....+-.....+.++.|.. +..  +.....+.....++..+...
T Consensus        69 ~is~~g~t~e~~~~~~~~~k~~g~~vi~it~~~~s~l~~~~d~~l~~~~~-~~~--~~~~~~~~~~~~l~~~~~~~  141 (159)
T 2zj3_A           69 MIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHS-VDC--LQGILSVIPLQLLAFHLAVL  141 (159)
T ss_dssp             EEECSSTTHHHHHHHHHHHHHTTCCCEEEEETTCHHHHHHCSSEEEECCC-CTT--THHHHHTHHHHHHHHHHHHH
T ss_pred             EEECCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHCCCEEEECCCC-CHH--HHHHHHHHHHHHHHHHHHHH
T ss_conf             99757314788999999999779968999878722333145708985897-343--78999999999999999998


No 17 
>>3kf6_A Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} (A:)
Probab=94.58  E-value=0.41  Score=28.12  Aligned_cols=86  Identities=12%  Similarity=0.120  Sum_probs=63.9

Q ss_pred             CCCCCEEEECCEEEEEEEEEC--------CCEEEEEEECCCCCEEEEEEECCCCCCHHH-HHHCCCCCEEEEEEEEEEEE
Q ss_conf             999846842780998888847--------964999998499877999997787870123-55306998799999976654
Q gi|254780901|r  505 GNPNPVFAFPNHKLQSIRVVN--------LAHLQMTFESQDSETLQAIAFRVYGTPLGE-FLMQSRGKRMHVTGHLCVNY  575 (600)
Q Consensus       505 gNpeP~F~~~~~~i~~~r~vG--------k~Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~-~~~~~~g~~idii~~l~~N~  575 (600)
                      ++++-.|...+..+..++++|        ++...+.+.|..|..++++.|........+ ......|..+.+.|++..  
T Consensus        34 ~~~~~~~~~~~~~i~~V~ivG~V~~~~~~~~~~~~~IdD~TG~~i~~~~~~~~~~~~~~~~~~i~~G~~V~V~G~i~~--  111 (159)
T 3kf6_A           34 HLQRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINS--  111 (159)
T ss_dssp             C---CCEEETTEEECEEEEEEEEEEEEEETTEEEEEEECSSSCEEEEEEEGGGCHHHHHHHTTCCTTCEEEEEEEEEC--
T ss_pred             CCCCCEEEECCEEEEEEEEEEEEEEEEEECCEEEEEEECCCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEE--
T ss_conf             866647999999889999999999899954559999988999917999987677433443556899959999999966--


Q ss_pred             ECCCCEEEEEEEEEEECCC
Q ss_conf             5781105899998011131
Q gi|254780901|r  576 WRGSKRCQLRVLDASPVEG  594 (600)
Q Consensus       576 ~~G~~s~QL~I~Di~p~e~  594 (600)
                      |+|.  .|+.+..+++++.
T Consensus       112 ~~~~--~~i~~~~i~~v~d  128 (159)
T 3kf6_A          112 FRSE--VELIAQSFEELRD  128 (159)
T ss_dssp             SSSS--CEEEEEEEEEECS
T ss_pred             CCCE--EEEEEEEEEEECC
T ss_conf             2988--8999999999099


No 18 
>>1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} (A:)
Probab=94.44  E-value=0.44  Score=27.88  Aligned_cols=146  Identities=14%  Similarity=0.112  Sum_probs=72.0

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHH--HHHHHHHCCCCEEEEECCCC-------------CCCCCCCHH
Q ss_conf             487999999999997799799994078861528999--99999976994799807874-------------336688978
Q gi|254780901|r   76 TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVAL--MMRFLSHCSVNANMYIPDRI-------------VDGYGPNPS  140 (600)
Q Consensus        76 ~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstai--l~~~L~~~g~~v~~~IP~R~-------------~eGYGl~~~  140 (600)
                      +.++++++.+.+.+.+.++|.|+|    -|.+..+-  +...|...|....+.+|...             .++|.....
T Consensus        29 ~~~~~~~~~~~~~i~~~~~I~i~G----~G~S~~~a~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  104 (199)
T 1x92_A           29 PYIEQASLVMVNALLNEGKILSCG----NGGSAGDAQHFSSELLNRFERERPSLPAVALTTDSSTITSIANDYSYNEVFS  104 (199)
T ss_dssp             HHHHHHHHHHHHHHHTTCCEEEEC----STHHHHHHHHHHHHHHTCSSSCCCCCCEEETTCCHHHHHHHHHHTCGGGTTH
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEC----CCCCHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCHHHHHHCCCCCHHHHHH
T ss_conf             999999999999998699899988----8760888867877753332235200334302221012555305457999999


Q ss_pred             HHHHHHHCCCCEEEEECCCCC---CHHHHHHHHHCCCCEEE-ECCCCCC-CCCCCCEEEECCCCCCCCCCCCCHHHHHHH
Q ss_conf             988742026868999648876---23455555417982799-6154476-555672565237888864334430478899
Q gi|254780901|r  141 LMEKFINEGAQLIITVDCGST---SYDALQYATNQGIDVIV-IDHHQVK-SEEIPAYALVNPNRLDDLSGQGHLCAAGVV  215 (600)
Q Consensus       141 ~i~~~~~~g~~LiItvD~Gi~---~~e~i~~a~~~GidvIV-tDHH~~~-~~~p~a~aivNP~~~~~~~p~~~l~gaGva  215 (600)
                      ......-..-+++|.+..+-.   -.+.+++|+++|+.+|. |+....+ ...- -+++.-|..+.-..+....|..-+.
T Consensus       105 ~~~~~~~~~~dlvi~iS~sG~t~~~~~~~~~ak~~g~~~i~iT~~~~s~L~~~a-d~~l~~~~~~~~~~~~s~~~~~~~l  183 (199)
T 1x92_A          105 KQIRALGQPGDVLLAISTSGNSANVIQAIQAAHDREMLVVALTGRDGGGMASLL-LPEDVEIRVPSKITARIQEVHLLAI  183 (199)
T ss_dssp             HHHHHHCCTTCEEEEECSSSCCHHHHHHHHHHHHTTCEEEEEECTTCHHHHHHC-CTTCEEEECSCSCHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCEEEEEEECCCCCHHHHC-CCCCEEEEECCCCHHHHHHHHHHHH
T ss_conf             999984578838999965888530168999998626569999916884176505-6788899958997299999999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999970
Q gi|254780901|r  216 FLVLVLIYRIL  226 (600)
Q Consensus       216 f~l~~al~~~l  226 (600)
                      ..|+.++.+++
T Consensus       184 ~~L~~~~~~~~  194 (199)
T 1x92_A          184 HCLCDLIDRQL  194 (199)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999984


No 19 
>>2poc_A D-fructose-6-, isomerase domain of glutamine-fructose-6- phosphate transaminase (isomerizing); glucosamine-6-phosphate synthase; HET: BG6 UD1; 1.80A {Candida albicans SC5314} PDB: 2put_A* 2puv_A* 2puw_A* (A:207-367)
Probab=93.89  E-value=0.56  Score=27.09  Aligned_cols=137  Identities=9%  Similarity=0.042  Sum_probs=69.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH--HHH-HCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             999999999997799799994078861528999999--999-76994799807874336688978988742026868999
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMR--FLS-HCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIIT  155 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~--~L~-~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiIt  155 (600)
                      ++..+++.+.+.+.++|.++|    -|.+...-.+-  .|. ..|..+..+-+.-+.      ...+..+-++  +++|.
T Consensus         3 ~~~~~~~~~~l~~a~~I~i~G----~G~s~~~a~~~~~~l~~~~~~~~~~~~~~~~~------~~~~~~~~~~--d~vi~   70 (161)
T 2poc_A            3 NKIKDLCNSSLNDQKSLLLLG----RGYQFATALEGALKIKEISYMHSEGVLAGELK------HGILALVDED--LPIIA   70 (161)
T ss_dssp             HHHHHHHHSGGGGCSEEEEEE----CGGGHHHHHHHHHHHHHHHCCEEEEEETTCC-------------------CCEEE
T ss_pred             HHHHHHHHHHHCCCCCEEEEC----CCCCCHHHHHHHHHHHHCCEECCCCCCHHHHH------CCHHHHCCCC--CCEEE
T ss_conf             577888887523565279976----87885057899999862257314457789986------0405415699--74478


Q ss_pred             EC-CC-CCC-HH-HHHHHHHCCCCEEEE-CCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             64-88-762-34-555554179827996-15447655567256523788886433443047889999999999970214
Q gi|254780901|r  156 VD-CG-STS-YD-ALQYATNQGIDVIVI-DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD  229 (600)
Q Consensus       156 vD-~G-i~~-~e-~i~~a~~~GidvIVt-DHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~  229 (600)
                      .. .| +.. .. .++.++++|..||++ +-+..+-.......++.|..  ++.......-..+...++..+....+.+
T Consensus        71 iS~sg~t~e~~~~~~~~~k~~g~~vi~It~~~~s~l~~~~~~~l~~~~~--~~~~~~~~~~~~~~~~l~~~l~~~~~~~  147 (161)
T 2poc_A           71 FATRDSLFPKVMSAIEQVTARDGRPIVICNEGDAIISNDKVHTTLEVPE--TVDCLQGLLNVIPLQLISYWLAVNRGID  147 (161)
T ss_dssp             ECCGGGCCHHHHHHHHHHHHTTCCCEEEEETTCCSCC---CCEEEEECC--CCGGGHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred             EECCCCHHHHHHHHHHHHHHCCCEEEEEEECCCHHCCCCCCCEEEECCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             8358710344454799999669818999937840103455433897279--6355789999999999999999984999


No 20 
>>1moq_A Glucosamine 6-phosphate synthase; glutamine amidotransferase; HET: GLP MES; 1.57A {Escherichia coli} (A:211-368)
Probab=93.84  E-value=0.57  Score=27.02  Aligned_cols=134  Identities=11%  Similarity=0.125  Sum_probs=70.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH---HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             9999999999977997999940788615289999---9999976994799807874336688978988742026868999
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALM---MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIIT  155 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail---~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiIt  155 (600)
                      |+.++++.+++.+-++|.|+|-    |.+...-.   +++.+..|..+..+-+.-+..  |    ....+.++  +++|.
T Consensus         1 e~~i~~~~~~l~~a~~i~i~G~----G~s~~~A~~~~~kl~~~~g~~~~~~~~~~~~~--~----~~~~~~~~--d~vi~   68 (158)
T 1moq_A            1 DKRIEALAEDFSDKHHALFLGR----GDQYPIALEGALKLKEISYIHAEAYAAGELKH--G----PLALIDAD--MPVIV   68 (158)
T ss_dssp             TTHHHHHHHHHTTCSEEEEEEC----GGGHHHHHHHHHHHHHHHCCEEEEEEGGGGGG--T----GGGGCSTT--SCEEE
T ss_pred             HHHHHHHHHHHHCCCCCEEECC----CCCHHHHHHHHHHHHHHHCCEEEECCHHHHCC--C----CHHHHCCC--CEEEE
T ss_conf             4377789999743755336426----66579999999999986440224343888444--9----79882899--73899


Q ss_pred             ECC-CCCC---HHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             648-8762---3455555417982799-6154476555672565237888864334430478899999999999702
Q gi|254780901|r  156 VDC-GSTS---YDALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR  227 (600)
Q Consensus       156 vD~-Gi~~---~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~  227 (600)
                      +.. |-+.   .+.++.++++|+.+|. ||-...+-....-+.+..|......   ..+........++..+...++
T Consensus        69 is~~g~t~e~~~~~~~~~k~~g~~~i~it~~~~s~~~~~~d~~l~~~~~~~~~---~~~~~~~~~~~~~~~l~~~~~  142 (158)
T 1moq_A           69 VAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVI---APIFYTVPLQLLAYHVALIKG  142 (158)
T ss_dssp             ESCCHHHHHHHHHHHHHTGGGTCCEEEEEEGGGCCCCBTTEEEEEECCCCGGG---HHHHHHHHHHHHHHHHHHHHT
T ss_pred             EECCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEECCCCCHHH---HHHHHHHHHHHHHHHHHHHCC
T ss_conf             70586688999999999996499299996687222455775699779975667---799999999999999999819


No 21 
>>2bpl_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing]; amidotransferase, ammonia channeling, glucosamine 6- phosphate synthase; HET: F6R; 2.05A {Escherichia coli} (A:450-608)
Probab=93.59  E-value=0.63  Score=26.72  Aligned_cols=138  Identities=9%  Similarity=0.065  Sum_probs=71.6

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE-C
Q ss_conf             999999999997799799994078861528999999999769947998078743366889789887420268689996-4
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV-D  157 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv-D  157 (600)
                      ++-.+++.+.+.+-++|.|+|- -.-+..+--+-+++.+..|..+..+-+.-+.      ...+..+-++  +++|.. .
T Consensus         2 ~~~~~~~~~~l~~a~~i~i~G~-G~s~~~A~~~~~kl~~~~~~~~~~~~~~~~~------~~~~~~~~~~--d~vi~is~   72 (159)
T 2bpl_A            2 DKRIEALAEDFSDKHHALFLGR-GDQYPIALEGALKLKEISYIHAEAYAAGELK------HGPLALIDAD--MPVIVVAP   72 (159)
T ss_dssp             HHHHHHHHGGGTTCCEEEEEEC-GGGHHHHHHHHHHHHHHHCCEEEEEEGGGGG------GTGGGGCCTT--CEEEEEEC
T ss_pred             HHHHHHHHHHHHCCCCEEEEEC-CCCHHHHHHHHHHHHHHHCCEEEECCHHHHH------CCCHHHCCCC--CEEEEEEC
T ss_conf             6677667898745765158726-8722999999999987617214764388830------4758660799--70999977


Q ss_pred             CCCCC---HHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             88762---3455555417982799-61544765556725652378888643344304788999999999997021
Q gi|254780901|r  158 CGSTS---YDALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ  228 (600)
Q Consensus       158 ~Gi~~---~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~  228 (600)
                      .|-+.   .+.++.+++.|+.+|. ||.+..+-..-..+.+..|....   .+..+....+...++..+....+.
T Consensus        73 ~g~~~e~~~~~~~~ak~~g~~vi~it~~~~s~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~l~~~i~~~~g~  144 (159)
T 2bpl_A           73 NNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEE---VIAPIFYTVPLQLLAYHVALIKGT  144 (159)
T ss_dssp             SSTTHHHHHHHHHHHHHTTCEEEEEEETTSCCCCBTTEEEEEECCCCG---GGHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             CCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEECCCCCH---HHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             973699999999999966995999975873324456640797799745---576799999999999999998398


No 22 
>>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} (A:194-372)
Probab=93.53  E-value=0.57  Score=27.02  Aligned_cols=137  Identities=12%  Similarity=0.053  Sum_probs=81.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCCCCHHHHHHHHHCCCCEEEEEC
Q ss_conf             999999999977997999940788615289999999997699479980787--433668897898874202686899964
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVDGYGPNPSLMEKFINEGAQLIITVD  157 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~eGYGl~~~~i~~~~~~g~~LiItvD  157 (600)
                      .+++++.+.|.+-++.+|+..+.+..--+..-+.++.+.+|+-|....-.|  +.+.|-+.....-...-..+||||.+.
T Consensus         8 ~~i~~~~~~L~~A~rPvIi~G~~~~~~~a~~~l~~lae~~giPv~~~~~~kg~~p~~~p~~~g~~~~~~~~~aDlil~iG   87 (179)
T 2c31_A            8 DAIARAADLIKNAKRPVIMLGKGAAYAQCDDEIRALVEETGIPFLPMGMAKGLLPDNHPQSAAATRAFALAQCDVCVLIG   87 (179)
T ss_dssp             HHHHHHHHHHHTCSSEEEEECHHHHHHTCHHHHHHHHHHHTCCEEECGGGTTSSCTTCTTBCGGGHHHHHHHCSEEEEES
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCC
T ss_conf             99999999986168958999623113447899988787418651222012455664343221000132224551210236


Q ss_pred             CCCCCHHHHHHHH---HCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             8876234555554---1798279961544765556725652378888643344304788999999999997021488
Q gi|254780901|r  158 CGSTSYDALQYAT---NQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNK  231 (600)
Q Consensus       158 ~Gi~~~e~i~~a~---~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~  231 (600)
                      |-.....-.-+..   ..+..+|.+|.              +|...+..|+ .++.-+|-+=.++.+|.+.+.....
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~vi~id~--------------d~~~~~~~~~-~d~~i~~d~~~~l~~L~~~l~~~~~  149 (179)
T 2c31_A           88 ARLNWLMQHGKGKTWGDELKKYVQIDI--------------QANEMDSNQP-IAAPVVGDIKSAVSLLRKALKGAPK  149 (179)
T ss_dssp             CCCSGGGGGGCSGGGTTSCCEEEEEES--------------CGGGTTSSSC-CSEEEESCHHHHHHHHHHHHTTCCC
T ss_pred             CCCCEEECCCCCCCCCCCCCCEEEECC--------------CCCCCCCCCC-CCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             652000115632100124430364113--------------5431223454-3200002258899999987653201


No 23 
>>2fn9_A Ribose ABC transporter, periplasmic ribose- binding protein; RBP, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima MSB8} PDB: 2fn8_A* (A:1-106,A:247-290)
Probab=93.17  E-value=0.59  Score=26.93  Aligned_cols=103  Identities=14%  Similarity=0.113  Sum_probs=68.1

Q ss_pred             CEEEEE-CCCCCHHHHH-HHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC-HHHHHHHH
Q ss_conf             799994-0788615289-99999999769947998078743366889789887420268689996488762-34555554
Q gi|254780901|r   94 KIMIFG-DYDVDGAASV-ALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS-YDALQYAT  170 (600)
Q Consensus        94 kI~I~g-DyD~DGitst-ail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~-~e~i~~a~  170 (600)
                      +|.+.- +.+-.-.++. .-+-+.++..|.++.+.-++.-.+   -....++.+...+++-||.+-...++ .+.++.+.
T Consensus         4 ~Igvi~~~~~~~f~~~i~~gie~aa~~~G~~v~l~~~~~d~~---~~~~~i~~l~~~~vdgIIi~~~~~~~~~~~i~~l~   80 (150)
T 2fn9_A            4 KMAIVISTLNNPWFVVLAETAKQRAEQLGYEATIFDSQNDTA---KESAHFDAIIAAGYDAIIFNPTDADGSIANVKRAK   80 (150)
T ss_dssp             EEEEEESCSSSHHHHHHHHHHHHHHHHTTCEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEECCSCTTTTHHHHHHHH
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             899994899898999999999999998599899996899989---99999999996599869873156521499999999


Q ss_pred             HCCCCEEEECCCCCCCCCCCCEEEECCCC
Q ss_conf             17982799615447655567256523788
Q gi|254780901|r  171 NQGIDVIVIDHHQVKSEEIPAYALVNPNR  199 (600)
Q Consensus       171 ~~GidvIVtDHH~~~~~~p~a~aivNP~~  199 (600)
                      +.|+-|+.+|.+..+....-.+.-.+|+.
T Consensus        81 ~~gIPvV~id~~~~~~~~~~~~V~~Dp~~  109 (150)
T 2fn9_A           81 EAGIPVFCVDRGINARGLAVAQIYSDPKL  109 (150)
T ss_dssp             HTTCCEEEESSCCSCSSSSSEEEEECHHH
T ss_pred             HCCCCCEEECCCCCCCCCCCCEECCCHHH
T ss_conf             75996256436765455666666010999


No 24 
>>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} PDB: 2pqa_A 1quq_A 1l1o_B (D:)
Probab=93.05  E-value=0.75  Score=26.11  Aligned_cols=83  Identities=14%  Similarity=0.264  Sum_probs=58.3

Q ss_pred             CEEEECCEEEEEEEEECC--------CEEEEEEECCCCCEEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCCC
Q ss_conf             468427809988888479--------649999984998779999977878701235530699879999997665457811
Q gi|254780901|r  509 PVFAFPNHKLQSIRVVNL--------AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSK  580 (600)
Q Consensus       509 P~F~~~~~~i~~~r~vGk--------~Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~~  580 (600)
                      =.|.+.+..+..++++|.        ....+.+.|..|......||.-......+......|..+.+.++++.  |+|+ 
T Consensus        22 ~~~~i~~~~i~~V~ivG~V~~v~~~~~~~~y~idDgTG~i~~~~~~~~~~~~~~~~~~i~~g~~V~V~G~i~~--~~~~-   98 (132)
T 3kdf_D           22 EVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDXTAAPXDVRQWVDTDDTSSENTVVPPETYVKVAGHLRS--FQNK-   98 (132)
T ss_dssp             SCEEETTEECCEEEEEEEEEEEEECSSEEEEEEECSSSSCEEEEEEC---------CCCCTTCEEEEEEEEEE--ETTE-
T ss_pred             CCEEECCEEEEEEEEEEEEEEEEECCCEEEEEEECCCCCCEEEEEECCCCCCCCCCCCCCCCCEEEEEEEEEE--CCCE-
T ss_conf             9789999999999999999899977877999998899995899997896757120332668989999999950--1985-


Q ss_pred             EEEEEEEEEEECCCC
Q ss_conf             058999980111311
Q gi|254780901|r  581 RCQLRVLDASPVEGH  595 (600)
Q Consensus       581 s~QL~I~Di~p~e~~  595 (600)
                       .|+.+..++|++..
T Consensus        99 -~~i~~~~i~~v~d~  112 (132)
T 3kdf_D           99 -KSLVAFKIXPLEDX  112 (132)
T ss_dssp             -EEEEEEEEEECSST
T ss_pred             -EEEEEEEEEECCCC
T ss_conf             -89999999990795


No 25 
>>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} (A:125-258,A:355-392)
Probab=92.99  E-value=0.76  Score=26.05  Aligned_cols=91  Identities=13%  Similarity=0.152  Sum_probs=70.9

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             79979999407886152899999999976994799807874336688978988742026868999648876234555554
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYAT  170 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~  170 (600)
                      ..++|.|+.+-|.-|.....-+.+.|+..|.++.+.+.  +..+-.=-...+.++++.+++.|+..-.+..+..-+..++
T Consensus        18 g~k~Vaii~~d~~~G~~~~~~f~~~l~~~G~evv~~~~--~~~~~~d~s~~i~~ik~a~pdvVv~~~~~~~~~~ilk~a~   95 (172)
T 3lkb_A           18 KGAKVALVVHPSPFGRAPVEDARKAARELGLQIVDVQE--VGSGNLDNTALLKRFEQAGVEYVVHQNVAGPVANILKDAK   95 (172)
T ss_dssp             TTCEEEEEECSSHHHHTTHHHHHHHHHHHTCEEEEEEE--CCTTCCCCHHHHHHHHHTTCCEEEEESCHHHHHHHHHHHH
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEE--CCCCCCHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHH
T ss_conf             89779999335630389999999999874987999981--4899723557888765369989999366267999999999


Q ss_pred             HCCCCEEEE--CCCC
Q ss_conf             179827996--1544
Q gi|254780901|r  171 NQGIDVIVI--DHHQ  183 (600)
Q Consensus       171 ~~GidvIVt--DHH~  183 (600)
                      ++|++..++  |--.
T Consensus        96 ~~G~~~~~i~~~~~~  110 (172)
T 3lkb_A           96 RLGLKMRHLGAHYTG  110 (172)
T ss_dssp             HTTCCCEEEECGGGC
T ss_pred             HCCCCCEEEEECCCC
T ss_conf             839996499955678


No 26 
>>2e5f_A Hypothetical protein PH0510; structural genomics, sugar binding protein, NPPSFA; 1.35A {Pyrococcus horikoshii OT3} PDB: 2dec_A* 2df8_A 2cb0_A* (A:12-157)
Probab=92.91  E-value=0.53  Score=27.30  Aligned_cols=99  Identities=10%  Similarity=0.065  Sum_probs=67.6

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHH-HHCCC
Q ss_conf             61487999999999997799799994078861528--9999999997699479980787433668897898874-20268
Q gi|254780901|r   74 ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKF-INEGA  150 (600)
Q Consensus        74 ~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~-~~~g~  150 (600)
                      .++.+++..+++.+.+.+.++|.|+|-    |.++  +--+...|..+|..+..+....     .   ...... .-+.-
T Consensus         2 t~~~i~~~i~~~~~~i~~a~~I~i~G~----G~S~~~a~~~~~~l~~~g~~~~~~~~~~-----~---~~~~~~~~~~~~   69 (146)
T 2e5f_A            2 GIIKADKVFNKVKDKISLPNRILYLGC----GSSHFLSKLLAMVTNMHGGLGIALPCSE-----F---LYSKETYPIGEV   69 (146)
T ss_dssp             HHHHHHHHHHHHTTTCCCCSEEEEEES----THHHHHHHHHHHHHHHTTSEEEEEEHHH-----H---HHHGGGSCCCSC
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEC----CHHHHHHHHHHHHHHHHCCCCEEEECHH-----H---HHCCCCCCCCCC
T ss_conf             999999999999998567996999988----3699999999999999639998996788-----7---732766768998


Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             6899964887623455555417982799615447
Q gi|254780901|r  151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       151 ~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      +++|.+...=.+.+-++.++..+-.+.+|..-..
T Consensus        70 dvvi~iS~sG~t~~~~~~~~~a~~~i~it~~~~s  103 (146)
T 2e5f_A           70 ELAVGISRSGETTEILLALEKINVKKLGITTRES  103 (146)
T ss_dssp             SEEEEECSSSCCHHHHHHHHTCCSCEEEEESSSC
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             2899977899826799999985553115543034


No 27 
>>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} (A:1-104,A:237-271)
Probab=92.54  E-value=0.87  Score=25.61  Aligned_cols=103  Identities=13%  Similarity=0.128  Sum_probs=72.3

Q ss_pred             CCCEEEEECCCCCHHHHHH--HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH-HHHHH
Q ss_conf             9979999407886152899--99999997699479980787433668897898874202686899964887623-45555
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVA--LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY-DALQY  168 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitsta--il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~-e~i~~  168 (600)
                      +.+|++.-..-.|...+..  =+.+.++..|.++.++-.++-.+   --.+.++.+.+.+++-+|..-++.+.. +.+..
T Consensus         1 K~tIgvi~~~~~~~f~~~i~~gi~~~a~~~G~~l~i~~~~~~~~---~~~~~i~~li~~~vdgiIi~~~~~~~~~~~l~~   77 (139)
T 2dri_A            1 KDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNLVVLDSQNNPA---KELANVQDLTVRGTKILLINPTDSDAVGNAVKM   77 (139)
T ss_dssp             CCEEEEEESCSSSHHHHHHHHHHHHHHHHHTCEEEEEECTTCHH---HHHHHHHHHTTTTEEEEEECCSSTTTTHHHHHH
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             98899992889898999999999999998599899995899999---999999999861876443212222231689999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCEEEECCC
Q ss_conf             541798279961544765556725652378
Q gi|254780901|r  169 ATNQGIDVIVIDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       169 a~~~GidvIVtDHH~~~~~~p~a~aivNP~  198 (600)
                      +.+.|+-||..|.+......+ ++...||.
T Consensus        78 l~~~gIPvV~id~~~~~~~~~-~~v~~d~~  106 (139)
T 2dri_A           78 ANQANIPVITLDRQATKGEVV-SHIASDPD  106 (139)
T ss_dssp             HHHTTCCEEEESSCCSSSCCS-EEEEECHH
T ss_pred             HHHCCCCCCCCCCCCCCCCCC-EEEEECHH
T ss_conf             986377532356555545542-37852299


No 28 
>>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} (A:1-171,A:340-364)
Probab=92.49  E-value=0.88  Score=25.57  Aligned_cols=95  Identities=11%  Similarity=0.068  Sum_probs=65.3

Q ss_pred             HCCCCEEEEECCCCCHHHHHH-HHHHHHHHCCCCEEEEECCCCC-------CCCC---C--------C------------
Q ss_conf             779979999407886152899-9999999769947998078743-------3668---8--------9------------
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVA-LMMRFLSHCSVNANMYIPDRIV-------DGYG---P--------N------------  138 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitsta-il~~~L~~~g~~v~~~IP~R~~-------eGYG---l--------~------------  138 (600)
                      .++.||++++. ..-|.+..+ -|.+.|...|.+|.++.+.+-.       +|+-   +        .            
T Consensus         4 ~~~mrIL~v~~-~~gG~~~~~~~la~~L~~~G~eV~v~~~~~~~~~~~~~~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~   82 (196)
T 1f0k_A            4 GQGKRLMVMAG-GTGGHVFPGLAVAHHLMAQGWQVRWLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIF   82 (196)
T ss_dssp             ---CEEEEECC-SSHHHHHHHHHHHHHHHTTTCEEEEEECTTSTHHHHGGGGTCEEEECCCCCCTTCCHHHHHTCHHHHH
T ss_pred             CCCCEEEEECC-CCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             99987999917-84687999999999999788979999788706554444429708998457867777899998699999


Q ss_pred             ---HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             ---789887420268689996488762345555541798279961544765
Q gi|254780901|r  139 ---PSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       139 ---~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                         ....+-+.+..+|+|++ .+...+.-....++..|+.+|++.|+....
T Consensus        83 ~~~~~l~~~l~~~kpDiI~~-~~~~~~~~~~~~~~~~~ip~v~~~h~~~~~  132 (196)
T 1f0k_A           83 NAWRQARAIMKAYKPDVVLG-MGGYVSGPGGLAAWSLGIPVVLHEQNGIAG  132 (196)
T ss_dssp             HHHHHHHHHHHHHCCSEEEE-CSSTTHHHHHHHHHHTTCCEEEEECSSSCC
T ss_pred             HHHHHHHHHHHCCCCCEEEE-CCCCCHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99999999975029978997-897341999999986699889982687743


No 29 
>>2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar binding protein, DNAA binding protein; 1.85A {Escherichia coli} (A:)
Probab=92.27  E-value=0.93  Score=25.37  Aligned_cols=146  Identities=12%  Similarity=0.073  Sum_probs=76.7

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH--HHHHHHCCCCEEEEECCC-C------------CCCCCCCHH
Q ss_conf             4879999999999977997999940788615289999--999997699479980787-4------------336688978
Q gi|254780901|r   76 TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALM--MRFLSHCSVNANMYIPDR-I------------VDGYGPNPS  140 (600)
Q Consensus        76 ~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail--~~~L~~~g~~v~~~IP~R-~------------~eGYGl~~~  140 (600)
                      ..+++.++.+.+.+.+.++|.++|    -|.+..+-.  ...|..+|....+.+|.- +            .+.|+...-
T Consensus        25 ~~~~~~~~~~~~~l~~~~~I~i~G----~G~S~~~a~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  100 (196)
T 2yva_A           25 DAISRAAMTLVQSLLNGNKILCCG----NGTSAANAQHFAASMINRFETERPSLPAIALNTDNVVLTAIANDRLHDEVYA  100 (196)
T ss_dssp             HHHHHHHHHHHHHHHTTCCEEEEE----STHHHHHHHHHHHHHHTCSSSCCCCCCEEESSCCHHHHHHHTTSTTGGGHHH
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEE----CCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHCCCCCHHHHHHH
T ss_conf             999999999999998799799997----8801776877898999887413433321034455200111135302778899


Q ss_pred             HHHHHHHCCCCEEEEECCCCC---CHHHHHHHHHCCCCEE-EECCCCCC-CCCCCCEE-EECCCCCCCCCCCCCHHHHHH
Q ss_conf             988742026868999648876---2345555541798279-96154476-55567256-523788886433443047889
Q gi|254780901|r  141 LMEKFINEGAQLIITVDCGST---SYDALQYATNQGIDVI-VIDHHQVK-SEEIPAYA-LVNPNRLDDLSGQGHLCAAGV  214 (600)
Q Consensus       141 ~i~~~~~~g~~LiItvD~Gi~---~~e~i~~a~~~GidvI-VtDHH~~~-~~~p~a~a-ivNP~~~~~~~p~~~l~gaGv  214 (600)
                      ......-..-+++|.+..+-.   -.+.++.|+++|+.+| ||+...-+ .+.  ++. +..|.......+....+..-+
T Consensus       101 ~~~~~~~~~~dlvi~iS~sG~t~~~~~~~~~ak~~g~~~i~IT~~~~s~l~~~--sd~~l~~~~~~~~~~~~s~~~~~~~  178 (196)
T 2yva_A          101 KQVRALGHAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGL--LGPQDVEIRIPSHRSARIQEMHMLT  178 (196)
T ss_dssp             HHHHHHCCTTCEEEEECSSSCCHHHHHHHHHHHHTTCEEEEEECTTCHHHHTT--CCTTSEEEECSCSCHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHH--CCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             99998627884799984477520256899999973481899982588457762--4658889994899809999999999


Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999999702
Q gi|254780901|r  215 VFLVLVLIYRILR  227 (600)
Q Consensus       215 af~l~~al~~~l~  227 (600)
                      ...|+..+....+
T Consensus       179 ~~~L~~~~~~~~~  191 (196)
T 2yva_A          179 VNCLCDLIDNTLF  191 (196)
T ss_dssp             HHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999999875


No 30 
>>2vbc_A Dengue 4 NS3 FULL-length protein; transmembrane, RNA replication, NS2B-NS3 protease; 3.15A {Dengue virus type 4} (A:324-425,A:465-481)
Probab=92.26  E-value=0.93  Score=25.36  Aligned_cols=88  Identities=14%  Similarity=0.047  Sum_probs=64.1

Q ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             99999779979999407886152899999999976994799807874336688978988742026868999648876234
Q gi|254780901|r   85 IVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYD  164 (600)
Q Consensus        85 i~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e  164 (600)
                      +......+++++||    |.....+--|++.|+..|..+..+-...       -..+++.+.....+.||+.|+.     
T Consensus        25 ~~~~~~~~~~~lIF----~~s~~~ae~l~~~L~~~g~~~~~lhg~~-------R~~~~~~f~~g~~~vLVaTdil-----   88 (119)
T 2vbc_A           25 FDWITDYQGKTVWF----VPSIKAGNDIANCLRKSGKRVIQLSRKT-------FDTEYPKTKLTDWDFVVTTDIS-----   88 (119)
T ss_dssp             CHHHHHCCSCEEEE----CSSHHHHHHHHHHHHTTTCCEEEECTTT-------HHHHTHHHHHSCCSEEEECGGG-----
T ss_pred             HHHHHHCCCCEEEE----ECCHHHHHHHHHHHHHCCCEEEEECCCC-------CHHHHHHCCCCCCEEEEECHHH-----
T ss_conf             99998568999999----5988999999999973898299927999-------8777824679995399986587-----


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCEEEEC-CCCCCCCCCCC
Q ss_conf             55555417982799615447655567256523-78888643344
Q gi|254780901|r  165 ALQYATNQGIDVIVIDHHQVKSEEIPAYALVN-PNRLDDLSGQG  207 (600)
Q Consensus       165 ~i~~a~~~GidvIVtDHH~~~~~~p~a~aivN-P~~~~~~~p~~  207 (600)
                            +.|+|+            | ...||| |.+.|+.|-|.
T Consensus        89 ------~rGiDi------------~-v~~VI~~~~~~~~~~~~~  113 (119)
T 2vbc_A           89 ------EMGANF------------R-AGRVIDPPAQEDDQYVFS  113 (119)
T ss_dssp             ------GTTCCC------------C-CSEEEECCCSSCEEEEEC
T ss_pred             ------HHCCCC------------C-CEEEEECCCCCCCEEEEC
T ss_conf             ------618535------------9-179997988887489977


No 31 
>>3g1w_A Sugar ABC transporter; sugar-binding protein, target 11229F, transport protein, structural genomics, PSI-2; 2.02A {Bacillus halodurans c-125} (A:1-108,A:243-305)
Probab=92.18  E-value=0.58  Score=26.95  Aligned_cols=82  Identities=13%  Similarity=0.106  Sum_probs=56.0

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCC-CHHHHHHHHHCCCCEEEECCCCCCCCCCCC
Q ss_conf             9999976994799807874336688978988742026868999648876-234555554179827996154476555672
Q gi|254780901|r  113 MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST-SYDALQYATNQGIDVIVIDHHQVKSEEIPA  191 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~-~~e~i~~a~~~GidvIVtDHH~~~~~~p~a  191 (600)
                      -.+++..|.++.+.-|.+...  --....++.+..++++-||..-.... ..+.++.|++.||-||.+|...++.. ..+
T Consensus        27 e~aa~~~G~~~~~~~~~~~d~--~~q~~~ie~li~~~vdGIii~p~d~~~~~~~i~~a~~~gIPVV~id~~~~~~~-~~~  103 (171)
T 3g1w_A           27 EDAAQALNVTVEYRGAAQYDI--QEQITVLEQAIAKNPAGIAISAIDPVELTDTINKAVDAGIPIVLFDSGAPDSH-AHS  103 (171)
T ss_dssp             HHHHHHHTCEEEEEECSSSCH--HHHHHHHHHHHHHCCSEEEECCSSTTTTHHHHHHHHHTTCCEEEESSCCTTSC-CSC
T ss_pred             HHHHHHCCCEEEEEECCCCCH--HHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCC-CCE
T ss_conf             999997299799997999999--99999999999779999999678737789999999986992999816777677-642


Q ss_pred             EEEECC
Q ss_conf             565237
Q gi|254780901|r  192 YALVNP  197 (600)
Q Consensus       192 ~aivNP  197 (600)
                      +.-.||
T Consensus       104 ~V~~D~  109 (171)
T 3g1w_A          104 FLGTNT  109 (171)
T ss_dssp             EEECCH
T ss_pred             EEEECH
T ss_conf             995169


No 32 
>>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} (A:160-248)
Probab=92.18  E-value=0.95  Score=25.30  Aligned_cols=64  Identities=22%  Similarity=0.240  Sum_probs=46.3

Q ss_pred             CCEEEEEEECCCCCEEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEECCC
Q ss_conf             964999998499877999997787870123553069987999999766545781105899998011131
Q gi|254780901|r  526 LAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG  594 (600)
Q Consensus       526 k~Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~~s~QL~I~Di~p~e~  594 (600)
                      ++-+.+.+.|..| .++++|||..-....  .....|..+-+.++++.+.|+|+  +|+.--++++.|+
T Consensus        26 ~~~~~~~l~D~tg-~i~~v~F~~~~~~~~--~~l~~g~~~~v~Gkv~~~~~~g~--~~i~~p~~~~~dG   89 (89)
T 1gm5_A           26 MNILTAVLSDGLV-HVPLKWFNQDYLQTY--LKQLTGKEVFVTGTVKSNAYTGQ--YEIHNAEVTPKEG   89 (89)
T ss_dssp             CEEEEEEECCSSC-CEEEEECSCCTTHHH--HHTTCSSCEEEEEEECSCCTTSS--CCEEEEEEECSCC
T ss_pred             CCEEEEEEEECCE-EEEEEEECCHHHHHH--HHHCCCCEEEEEEEEEECCCCCE--EEEECCEEECCCC
T ss_conf             7118999998986-899999798799976--50359998999999987687886--9962987743564


No 33 
>>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} (A:1-109,A:242-289)
Probab=91.58  E-value=1  Score=25.06  Aligned_cols=95  Identities=6%  Similarity=0.009  Sum_probs=63.0

Q ss_pred             CCCCEEEEE-CCCCCHHHHHH-HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             799799994-07886152899-9999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   91 NSEKIMIFG-DYDVDGAASVA-LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        91 ~~ekI~I~g-DyD~DGitsta-il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      +...|.+.- |.+-.-.+... =+.+.++..|.++.+..-+.-.+   -....++.+.+.+++-||.+.+..++...++.
T Consensus         6 ~s~~Igviip~~~~~f~~~~~~gi~~~a~~~g~~v~i~~~~~~~~---~~~~~i~~l~~~~vDGiIi~~~~~~~~~~~~~   82 (157)
T 1dbq_A            6 HTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLE---KQRAYLSMMAQKRVDGLLVMCSEYPEPLLAML   82 (157)
T ss_dssp             --CEEEEEESCTTSHHHHHHHHHHHHHHHHHTCEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEEECSCCCHHHHHHH
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEECCCCCCHHHHHHH
T ss_conf             999799995999898999999999999998699999996899989---99999999884587668842655650578999


Q ss_pred             HHHCCCCEEEECCCCCCCCC
Q ss_conf             54179827996154476555
Q gi|254780901|r  169 ATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       169 a~~~GidvIVtDHH~~~~~~  188 (600)
                      +++.|+-||++|++......
T Consensus        83 l~~~~iPvV~id~~~~~~~~  102 (157)
T 1dbq_A           83 EEYRHIPMVVMDWGEAKADF  102 (157)
T ss_dssp             HHTTTSCEEEEECSSCCSSS
T ss_pred             HHHCCCCEEEEEECCCCCCC
T ss_conf             86069968998503688998


No 34 
>>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* (A:1-110)
Probab=91.49  E-value=1.1  Score=24.75  Aligned_cols=78  Identities=10%  Similarity=0.058  Sum_probs=51.4

Q ss_pred             EEEEEEEEC-C-C--EEEEEEECCCCCEEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEC
Q ss_conf             998888847-9-6--49999984998779999977878701235530699879999997665457811058999980111
Q gi|254780901|r  517 KLQSIRVVN-L-A--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV  592 (600)
Q Consensus       517 ~i~~~r~vG-k-~--Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~~s~QL~I~Di~p~  592 (600)
                      .|.+.+... + +  =..+.|.+..| .+++++|...+....-......|..+-+-++++.+.|+|.  +|+.+..+.|+
T Consensus        25 ~V~~~~~~~tK~G~~~~~~~l~D~tg-~ie~~~F~~~~~~~~~~~~l~~g~~v~v~G~v~~~~~~~~--~~l~v~~i~~i  101 (110)
T 3f2b_A           25 YVFDAEVSELKSGRTLLTMKITDYTN-SILVKMFSRDKEDAELMSGVKKGMWVKVRGSVQNDTFVRD--LVIIANDLNEI  101 (110)
T ss_dssp             EEEEEEEEECTTSCEEEEEEEECSSC-EEEEEEECSSHHHHHHHHTCCTTCEEEEEEEEEEETTTTE--EEEEEEEEEEE
T ss_pred             EEEEEEEEEECCCCEEEEEEEEECCC-CEEEEEECCCCCHHHHHHHCCCCCEEEEEEEEECCCCCCC--EEEEEEEEEEC
T ss_conf             99877878705898899999982788-6899995587432889850679968999998851577774--27872123654


Q ss_pred             CCCCC
Q ss_conf             31126
Q gi|254780901|r  593 EGHHF  597 (600)
Q Consensus       593 e~~~~  597 (600)
                      +...-
T Consensus       102 ~~~~~  106 (110)
T 3f2b_A          102 AANER  106 (110)
T ss_dssp             CCCCC
T ss_pred             CCCCC
T ss_conf             77554


No 35 
>>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} (A:153-276)
Probab=91.35  E-value=0.79  Score=25.94  Aligned_cols=80  Identities=19%  Similarity=0.295  Sum_probs=58.9

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             79979999407886152899999999976994799807874336688978988742026868999648876234555554
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYAT  170 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~  170 (600)
                      ++.+|++.||  .--.-..--+..++..+|.++...-|.    ||.+..+.++.+.+.|.++.+|-|-.    +++    
T Consensus         2 ~glkia~vGd--~~~~rv~~Sl~~~~~~~g~~~~~~~P~----~~~~~~~~~~~~~~~g~~~~~~~d~~----ea~----   67 (124)
T 1ml4_A            2 DGLKIGLLGD--LKYGRTVHSLAEALTFYDVELYLISPE----LLRMPRHIVEELREKGMKVVETTTLE----DVI----   67 (124)
T ss_dssp             SSEEEEEESC--TTTCHHHHHHHHHGGGSCEEEEEECCG----GGCCCHHHHHHHHHTTCCEEEESCTH----HHH----
T ss_pred             CCCEEEECCC--CCCCHHHHHHHHHHHHCCCCEEEECCH----HHCCCHHHHHHHHHCCCCEEECCCHH----HHH----
T ss_conf             4676652068--641233887999999789919997963----65387999999997198212128989----963----


Q ss_pred             HCCCCEEEECCCCCC
Q ss_conf             179827996154476
Q gi|254780901|r  171 NQGIDVIVIDHHQVK  185 (600)
Q Consensus       171 ~~GidvIVtDHH~~~  185 (600)
                       .|.|||.||-....
T Consensus        68 -~~aDvvy~~~w~~~   81 (124)
T 1ml4_A           68 -GKLDVLYVTRIQKE   81 (124)
T ss_dssp             -TTCSEEEECCCCGG
T ss_pred             -CCCCEEECCEECCC
T ss_conf             -05751212200235


No 36 
>>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A (A:1-48,A:423-534)
Probab=91.33  E-value=0.33  Score=28.93  Aligned_cols=39  Identities=13%  Similarity=0.110  Sum_probs=32.5

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHCCCC
Q ss_conf             8873411578889889999998819999999999967889
Q gi|254780901|r   14 SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS   53 (600)
Q Consensus        14 ~~~rW~~~~~~~~~~~~~~l~~~~~~~~~~a~iL~~Rgi~   53 (600)
                      +--||..++..+ ..+-..+...+|++|..|.++++||+.
T Consensus         3 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~   41 (160)
T 2zxr_A            3 DRVRWRVLSLPP-LAQWREVMAALEVGPEAALAYWHRGFR   41 (160)
T ss_dssp             TTEEEEECCCCC-HHHHHHHHHHHTCCHHHHHHHHHTTCC
T ss_pred             CCCCEEECCCCC-HHHHHHHHHHCCCCHHHHHHHHHCCCC
T ss_conf             786101269999-799999999819699999999967998


No 37 
>>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} (A:1-108,A:251-276)
Probab=91.25  E-value=0.93  Score=25.37  Aligned_cols=120  Identities=13%  Similarity=0.133  Sum_probs=71.9

Q ss_pred             CEEEEECCCCCHHHHHHHH---HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC-CCHHHHHHH
Q ss_conf             7999940788615289999---999997699479980787433668897898874202686899964887-623455555
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALM---MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS-TSYDALQYA  169 (600)
Q Consensus        94 kI~I~gDyD~DGitstail---~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi-~~~e~i~~a  169 (600)
                      +|.+.-. |.+.--.+.++   .+.++..|.++..+-.+.-.+   .....++.+.+.+++-||.+-... ...+.++.+
T Consensus         4 ~Igvi~~-~~~~~f~~~i~~gi~~~a~~~G~~l~i~~~~~d~~---~e~~~i~~l~~~~vDGIIi~~~~~~~~~~~i~~~   79 (134)
T 2vk2_A            4 TVGFSQV-GSESGWRAAETNVAKSEAEKRGITLKIADGQQKQE---NQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEA   79 (134)
T ss_dssp             EEEEEEC-CCCSHHHHHHHHHHHHHHHHHTCEEEEEECTTCHH---HHHHHHHHHHHHTCSEEEECCSSSSSCHHHHHHH
T ss_pred             EEEEEEC-CCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHH
T ss_conf             9999968-99899999999999999998599899995899999---9999999999759999998325654116889999


Q ss_pred             HHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             4179827996154476555672565237888864334430478899999999999702148876
Q gi|254780901|r  170 TNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP  233 (600)
Q Consensus       170 ~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~  233 (600)
                      ++.|+.||+.|.+.+....   .++++..       ..+.  +|-||--+    +++.+++..|
T Consensus        80 ~~~~iPVV~id~~~~~~~~---~~vv~~d-------~~~~--~~~~~~~~----~~~~~~~~~~  127 (134)
T 2vk2_A           80 KDAEIPVFLLDRSIDVKDK---SLYMTTV-------TADM--AGPAFDAL----EKYKKDGTMP  127 (134)
T ss_dssp             HHTTCCEEEESSCCCCSCG---GGSSEEE-------ECCC--HHHHHHHH----HHHHHHCCCC
T ss_pred             HHCCCCEEEECCCCCCCCC---CCCCEEE-------ECCH--HHHHHHHH----HHHHHCCCCC
T ss_conf             8619975774454455556---6652058-------4269--99999999----9998579999


No 38 
>>2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A (A:)
Probab=90.64  E-value=1.3  Score=24.17  Aligned_cols=124  Identities=14%  Similarity=0.144  Sum_probs=62.8

Q ss_pred             CHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHH--HHHHHHHHHCCCCEEEEECCC-----------CC-CCCC
Q ss_conf             955614879999999999977997999940788615289--999999997699479980787-----------43-3668
Q gi|254780901|r   71 DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASV--ALMMRFLSHCSVNANMYIPDR-----------IV-DGYG  136 (600)
Q Consensus        71 dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitst--ail~~~L~~~g~~v~~~IP~R-----------~~-eGYG  136 (600)
                      +.......+++++.+.+.+.+.++|.++|   + |.+..  .-+...|.++|..+.+.+|.-           .. ..|+
T Consensus        43 ~~~~~~~~~~~~~~i~~~i~~a~rI~~~G---~-G~S~~~a~~~~~~l~~~g~~~~~~~~~~~l~~~~~~~~~~~~~~~~  118 (212)
T 2i2w_A           43 DDANIHAIQRAAVLLADSFKAGGKVLSCG---N-GGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFN  118 (212)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHTTCCEEEEE---S-THHHHHHHHHHHHHHHHHCTTSSSCSEEECCCTTCGGGGSCCCSCS
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCEEEEEE---C-CCCHHHHHHHHHHHCCCCCCCCCCHHEECCCCCHHHHHHHCCCCHH
T ss_conf             66539999999999999998699899984---8-8632679899998628853346521201057702566764255578


Q ss_pred             CCHHHHHHHHHCCCCEEEEECCCCC---CHHHHHHHHHCCCCEE-EECCCCCCCCCCCCEEEECCC
Q ss_conf             8978988742026868999648876---2345555541798279-961544765556725652378
Q gi|254780901|r  137 PNPSLMEKFINEGAQLIITVDCGST---SYDALQYATNQGIDVI-VIDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       137 l~~~~i~~~~~~g~~LiItvD~Gi~---~~e~i~~a~~~GidvI-VtDHH~~~~~~p~a~aivNP~  198 (600)
                      -.........-..-+++|....+-.   -.+.+++|+++|+.+| |||...-|=-.-.-..+.-|.
T Consensus       119 ~~~~~~~~~~~~~~dv~i~iS~sG~t~~~~~~~~~ak~~g~~ii~IT~~~~s~la~~ad~~l~v~~  184 (212)
T 2i2w_A          119 DIFSRYVEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPH  184 (212)
T ss_dssp             SHHHHHHHHHCCTTCEEEEECSSSCCHHHHHHHHHHHHHTCEEEEEEETTCGGGTTCSSEEEEECC
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCEEEECCC
T ss_conf             898888886167786799970685200224689999987996999957998605562999998699


No 39 
>>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; HET: MSE; 2.88A {Vibrio parahaemolyticus} (A:1-102,A:224-275)
Probab=90.64  E-value=0.84  Score=25.73  Aligned_cols=103  Identities=11%  Similarity=0.078  Sum_probs=69.8

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCC
Q ss_conf             99999976994799807874336688978988742026868999648876234555554179827996154476555672
Q gi|254780901|r  112 MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA  191 (600)
Q Consensus       112 l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a  191 (600)
                      +.+.++..|.++..+.-+.-.+   .....++.+...+++-+|..- ...+.+.++.+.+.|+-++..|.+..+...+.-
T Consensus        25 i~~~a~~~gy~~~i~~~~~~~~---~~~~~i~~l~~~~vdGiIi~~-~~~~~~~~~~l~~~~iP~V~~~~~~~~~~~~~V  100 (154)
T 3d8u_A           25 FQQALNKAGYQLLLGYSDYSIE---QEEKLLSTFLESRPAGVVLFG-SEHSQRTHQLLEASNTPVLEIAELSSKASYLNI  100 (154)
T ss_dssp             HHHHHHHTSCEECCEECTTCHH---HHHHHHHHHHTSCCCCEEEES-SCCCHHHHHHHHHHTCCEEEESSSCSSSSSEEE
T ss_pred             HHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHHCCCEEEEEC-CCCHHHHHHHHHHCCCCCEECCCCCCCCCCCEE
T ss_conf             9999998699899996899989---999999999970998787301-210157999998528862000112357888888


Q ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             565237888864334430478899999
Q gi|254780901|r  192 YALVNPNRLDDLSGQGHLCAAGVVFLV  218 (600)
Q Consensus       192 ~aivNP~~~~~~~p~~~l~gaGvaf~l  218 (600)
                      ...+.|.+.--..|..++.-..+-.++
T Consensus       101 ~~~~~P~LTTv~~~~~~~g~~A~~~l~  127 (154)
T 3d8u_A          101 GVHAYPSLTSAEFDYERXGTKAAEKLL  127 (154)
T ss_dssp             CBTSSSCCEEEECCHHHHHHHHHHHHH
T ss_pred             EEHCCCCCEEEEECHHHHHHHHHHHHH
T ss_conf             631689944998499999999999999


No 40 
>>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} (A:122-254,A:330-346)
Probab=90.52  E-value=1.4  Score=24.10  Aligned_cols=116  Identities=15%  Similarity=0.145  Sum_probs=80.8

Q ss_pred             HHH--CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHH
Q ss_conf             997--799799994078861528999999999769947998078743366889789887420268689996488762345
Q gi|254780901|r   88 AIY--NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDA  165 (600)
Q Consensus        88 ai~--~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~  165 (600)
                      +++  ..+++.|+.+-|.=|......+.+.|+..|.++...++-..  |-.=-...+.++...+++.||.+-.+..+..-
T Consensus        11 l~~~~~~k~vaii~~d~~~G~~~~~~~~~~l~~~G~~vv~~~~~~~--~~~d~~~~i~~i~~~~~d~Ii~~~~~~~~~~~   88 (150)
T 1usg_A           11 ILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITA--GEKDFSALIARLKKENIDFVYYGGYYPEMGQM   88 (150)
T ss_dssp             HHHTTCCSSEEEEECSSHHHHHHHHHHHHHHHHTTCCEEEEEECCT--TCCCCHHHHHHHHHTTCCEEEEESCHHHHHHH
T ss_pred             HHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEEECCC--CCCCHHHHHHHHHHCCCCEEEEEECCHHHHHE
T ss_conf             2102455203674165201256787765544134422788873362--11101368888875387469997444344321


Q ss_pred             HHHHHHCCCCEEEECCCCCCC-C-------CCCCEEEECCCCCCCCCC
Q ss_conf             555541798279961544765-5-------567256523788886433
Q gi|254780901|r  166 LQYATNQGIDVIVIDHHQVKS-E-------EIPAYALVNPNRLDDLSG  205 (600)
Q Consensus       166 i~~a~~~GidvIVtDHH~~~~-~-------~p~a~aivNP~~~~~~~p  205 (600)
                      +..++++|++..+.=...... +       .......+-|..++.+++
T Consensus        89 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~g~~~~G~~~~~~~~~~~~~~  136 (150)
T 1usg_A           89 LRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDFG  136 (150)
T ss_dssp             HHHHHHTTCCCEEEECGGGCCTTHHHHHGGGGTTCEEEECCCGGGCCE
T ss_pred             EEECCCCCCCCEEEEEEECCCCCCCCCCCCCCCCEEEECCCCCCCCEE
T ss_conf             410122355630331000146531211112333124421467877879


No 41 
>>3brs_A Periplasmic binding protein/LACI transcriptional regulator; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans isdg} (A:1-112,A:246-289)
Probab=90.36  E-value=1.1  Score=24.95  Aligned_cols=105  Identities=17%  Similarity=0.126  Sum_probs=66.0

Q ss_pred             CCCEEEEECCCCCHHHHHHH--HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHH-HHHH
Q ss_conf             99799994078861528999--99999976994799807874336688978988742026868999648876234-5555
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVAL--MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYD-ALQY  168 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstai--l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e-~i~~  168 (600)
                      ..+|++.-...-+..-+..+  +.+.++..|.++.++..+-..+ .-.....++.+.+.+++-+|.+-...+... .++.
T Consensus         7 s~~Igvi~~~~~~pf~~~i~~gi~~~a~~~g~~v~~~~~~s~~d-~~~q~~~i~~l~~~~vdgiIi~~~~~~~~~~~i~~   85 (156)
T 3brs_A            7 YMICIPKVLDDSSDFWSVLVEGAQMAAKEYEIKLEFMAPEKEED-YLVQNELIEEAIKRKPDVILLAAADYEKTYDAAKE   85 (156)
T ss_dssp             EEEEECSCCCSSSHHHHHHHHHHHHHHHHHTCEEEECCCSSTTC-HHHHHHHHHHHHHTCCSEEEECCSCTTTTHHHHTT
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCC-HHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHH
T ss_conf             89999825899998999999999999998199899996799889-99999999999976999999978720102899998


Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCEEEECCC
Q ss_conf             541798279961544765556725652378
Q gi|254780901|r  169 ATNQGIDVIVIDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       169 a~~~GidvIVtDHH~~~~~~p~a~aivNP~  198 (600)
                      +++.||.||.+|...++... .++...||.
T Consensus        86 l~~~gIPVV~id~~~~~~~~-~~~v~~d~~  114 (156)
T 3brs_A           86 IKDAGIKLIVIDSGMKQDIA-DITVATDPF  114 (156)
T ss_dssp             TGGGTCEEEEESSCCSSCCC-SEEEECCHH
T ss_pred             HHHCCCCCCCCCCCCCCCCC-CEEEEECHH
T ss_conf             86138742001343346887-439983299


No 42 
>>3i10_A Putative glycerophosphoryl diester phosphodiesterase; NP_812074.1, structural genomics; HET: MSE; 1.35A {Bacteroides thetaiotaomicron vpi-5482} (A:1-65,A:105-278)
Probab=90.21  E-value=0.89  Score=25.50  Aligned_cols=19  Identities=32%  Similarity=0.373  Sum_probs=11.1

Q ss_pred             CCCEEEECCCHHHHHHHHH
Q ss_conf             2210020342589999999
Q gi|254780901|r  316 LGSRLLISDDSQELEMLAM  334 (600)
Q Consensus       316 ~av~lL~~~d~~~a~~la~  334 (600)
                      .+++-+.|+.+..+.++.+
T Consensus       215 ~GVdgIiTD~P~~~~~~l~  233 (239)
T 3i10_A          215 LGARILQTDQPAYLLDYLR  233 (239)
T ss_dssp             TCEEEEEESCHHHHHHHHH
T ss_pred             CCCCEEEECCHHHHHHHHH
T ss_conf             5999999397999999999


No 43 
>>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} (A:140-279,A:378-419)
Probab=90.08  E-value=1.5  Score=23.83  Aligned_cols=100  Identities=7%  Similarity=-0.010  Sum_probs=70.1

Q ss_pred             HHHHHHHHHH---HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             9999999999---7799799994078861528999999999769947998078743366889789887420268689996
Q gi|254780901|r   80 KAARRIVQAI---YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        80 ~A~~ri~~ai---~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      ....++...+   ...++|.|+.+-|.=|-+...-+...++..|.++.+.+.  +..+---....+.++++.+++.||++
T Consensus        10 ~~~~~~~~~l~~~~g~kkVaii~~d~~yG~~~~~~f~~~l~~~G~~Vv~~~~--~~~~~~d~~~~i~~i~~a~~d~Viv~   87 (182)
T 3h5l_A           10 KFLKDIEDNGEFSRPNNKIAIITGPGIYSVNIANAIRDGAGEYGYDVSLFET--VAIPVSDWGPTLAKLRADPPAVIVVT   87 (182)
T ss_dssp             HHHHHHHHTTSCCCSSSEEEEEECSSHHHHHHHHHHHHHGGGGTCEEEEEEE--CCSSCSCCHHHHHHHHHSCCSEEEEC
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCEEECCC--CCCCCCCCHHHHHHHHCCCCCEEEEE
T ss_conf             9888888777632688789999537437789999999999973252221012--55321210046666530499789997


Q ss_pred             CC-CCCCHHHHHHHHHCCCCE--EEECC
Q ss_conf             48-876234555554179827--99615
Q gi|254780901|r  157 DC-GSTSYDALQYATNQGIDV--IVIDH  181 (600)
Q Consensus       157 D~-Gi~~~e~i~~a~~~Gidv--IVtDH  181 (600)
                      -+ +.....-++.+++.|++.  |.+|=
T Consensus        88 ~~~~~~~~~~lkq~~~~G~~~~ii~~~~  115 (182)
T 3h5l_A           88 HFYPQDQALFMNQFMTDPTNSLVYLQYG  115 (182)
T ss_dssp             CCCHHHHHHHHHHHTTSCCSCEEEECSG
T ss_pred             ECCCHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             2273245899999875146872999626


No 44 
>>1jeo_A MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase, PHI, structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} (A:)
Probab=89.78  E-value=1.5  Score=23.66  Aligned_cols=93  Identities=19%  Similarity=0.285  Sum_probs=56.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHH--HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             99999999999779979999407886152899--9999999769947998078743366889789887420268689996
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVA--LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitsta--il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      +...+++.+.+.+.++|.++|   + |.++.+  -+...|..+|..+.++-+..           ...+.++  +++|.+
T Consensus        27 ~~~~~~~~~~l~~a~~i~i~g---~-G~S~~~a~~~~~~l~~~g~~~~~~~~~~-----------~~~~~~~--d~vi~i   89 (180)
T 1jeo_A           27 KNKLDSLIDRIIKAKKIFIFG---V-GRSGYIGRCFAMRLMHLGFKSYFVGETT-----------TPSYEKD--DLLILI   89 (180)
T ss_dssp             HHHHHHHHHHHHHCSSEEEEC---C-HHHHHHHHHHHHHHHHTTCCEEETTSTT-----------CCCCCTT--CEEEEE
T ss_pred             HHHHHHHHHHHHCCCEEEEEE---C-CHHHHHHHHHHHHHHHCCCEEEEECCCC-----------CCCCCCC--CEEEEE
T ss_conf             999999999997899399997---7-8899999999999997797237521232-----------4678988--889997


Q ss_pred             C-CCCC--CHHHHHHHHHCCCCEEE-ECCCCCCCCC
Q ss_conf             4-8876--23455555417982799-6154476555
Q gi|254780901|r  157 D-CGST--SYDALQYATNQGIDVIV-IDHHQVKSEE  188 (600)
Q Consensus       157 D-~Gi~--~~e~i~~a~~~GidvIV-tDHH~~~~~~  188 (600)
                      . .|-+  -.+.++.|+++|+.||. |+++.|-.+.
T Consensus        90 S~sG~~~~~~~~~~~ak~~g~~vI~iT~~~s~l~~~  125 (180)
T 1jeo_A           90 SGSGRTESVLTVAKKAKNINNNIIAIVXEXGNVVEF  125 (180)
T ss_dssp             ESSSCCHHHHHHHHHHHTTCSCEEEEESSCCGGGGG
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH
T ss_conf             699980899999999997599799996999975666


No 45 
>>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* (A:1-148)
Probab=89.75  E-value=1.5  Score=23.65  Aligned_cols=113  Identities=13%  Similarity=-0.026  Sum_probs=73.4

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-----CC------CCHHHH-HHHHHCCCCEEEEECCCC
Q ss_conf             979999407886152899999999976994799807874336-----68------897898-874202686899964887
Q gi|254780901|r   93 EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG-----YG------PNPSLM-EKFINEGAQLIITVDCGS  160 (600)
Q Consensus        93 ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eG-----YG------l~~~~i-~~~~~~g~~LiItvD~Gi  160 (600)
                      .||+|+.|--..-=++....+..|...+.++.++...-...+     |+      .+.+.+ +.+.+.++++|| +|.=.
T Consensus         1 ~ki~ir~da~~~iG~GHv~Rcl~LA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~iI-~D~y~   79 (148)
T 3hbm_A            1 XKVLFRSDSSSQIGFGHIKRDLVLAKQYSDVSFACLPLEGSLIDEIPYPVYELSSESIYELINLIKEEKFELLI-IDHYG   79 (148)
T ss_dssp             CCEEEEECCBTTTBSHHHHHHHHHHTTCSSEEEEECCCTTCCGGGCCSCEEECSSSCHHHHHHHHHHHTCSEEE-EECTT
T ss_pred             CEEEEEECCCCCCEEEHHHHHHHHHHHHHHCCEEEEECCCCHHHHCCCCEEEECCHHHHHHHHHHHCCCCCEEE-ECCCC
T ss_conf             97999945889947223899999999875587999987111055659976784431278888887512887899-81777


Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             623455555417982799615447655567256523788886433443
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGH  208 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~  208 (600)
                      .+.+....+++.+..+++.|.=.  ....++..|||+.....+-++++
T Consensus        80 ~~~~~~~~l~~~~~~lv~iDD~~--~~~~~adlvin~~~~~~~~~y~~  125 (148)
T 3hbm_A           80 ISVDDEKLIKLETGVKILSFDDE--IKPHHCDILLNVNAYAKASDYEG  125 (148)
T ss_dssp             CCHHHHHHHHHHHCCEEEEECSS--CCCCCCSEEEECSTTCCGGGGTT
T ss_pred             CCCHHHHHHHHCCCCEEEEECCC--CCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             77227778774377447763044--33420211013332233443201


No 46 
>>2rgw_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, pyrimidine biosynthesis, thermostability; 2.80A {Methanococcus jannaschii} PDB: 3e2p_A (A:148-281)
Probab=89.22  E-value=1.7  Score=23.36  Aligned_cols=79  Identities=19%  Similarity=0.229  Sum_probs=57.2

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             79979999407886152899999999976-99479980787433668897898874202686899964887623455555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHC-SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA  169 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~-g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a  169 (600)
                      ++.||++.||-- .|-+.-+ +..++..+ |.++...-|.    +|.+....++.+.+.|.++.+|-|.-    +++   
T Consensus         3 ~glkia~iGd~~-~~rv~~S-~~~~~~~~~g~~v~~~~P~----~~~~~~~~~~~~~~~g~~i~~~~d~~----ea~---   69 (134)
T 2rgw_A            3 DGIKIAFVGDLK-YGRTVHS-LVYALSLFENVEMYFVSPK----ELRLPKDIIEDLKAKNIKFYEKESLD----DLD---   69 (134)
T ss_dssp             SSCEEEEESCTT-TCHHHHH-HHHHHTTSSSCEEEEECCG----GGCCCHHHHHHHHHTTCCEEEESSGG----GCC---
T ss_pred             CCCEEEEECCCC-CCHHHHH-HHHHHHCCCCEEEEEECCC----CCCCCHHHHCCCCCCCCCCCCCHHHH----HHC---
T ss_conf             577699970554-3325688-8998650574379996575----45785232101001222211120012----202---


Q ss_pred             HHCCCCEEEECCCCC
Q ss_conf             417982799615447
Q gi|254780901|r  170 TNQGIDVIVIDHHQV  184 (600)
Q Consensus       170 ~~~GidvIVtDHH~~  184 (600)
                        .|.|||.||-...
T Consensus        70 --~~aDviy~~~w~~   82 (134)
T 2rgw_A           70 --DDIDVLYVTRIQK   82 (134)
T ss_dssp             --TTCSEEEECCCCG
T ss_pred             --CCCEEEEECCEEC
T ss_conf             --1316995013533


No 47 
>>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3d7k_A* (A:182-367)
Probab=89.00  E-value=1.2  Score=24.42  Aligned_cols=84  Identities=11%  Similarity=0.044  Sum_probs=59.1

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC--CC-------CCCCCHHHHHHHHHCC
Q ss_conf             99999999999779979999407886152899999999976994799807874--33-------6688978988742026
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI--VD-------GYGPNPSLMEKFINEG  149 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~--~e-------GYGl~~~~i~~~~~~g  149 (600)
                      +.+++++.+.|.+-++.+|+.++.+..-.+..-+.++...+|+.|......|-  .+       .|+.......++.++ 
T Consensus        10 ~~~i~~~~~~L~~A~rP~ii~G~~~~~~~a~~~l~~lae~lg~Pv~~t~~~~g~~~~~~p~~~G~~~~~~~~~~~~~~~-   88 (186)
T 2uz1_A           10 PADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAA-   88 (186)
T ss_dssp             HHHHHHHHHHHHHCSSEEEEECHHHHHHTCHHHHHHHHHHHCCCEEECGGGGGGGTTSCGGGEEEEGGGGGGTTTTTCC-
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCC-
T ss_conf             7799999999972889879983242210268999999997197422220001223567530022331014666654125-


Q ss_pred             CCEEEEECCCCCCH
Q ss_conf             86899964887623
Q gi|254780901|r  150 AQLIITVDCGSTSY  163 (600)
Q Consensus       150 ~~LiItvD~Gi~~~  163 (600)
                      ++|||.+.+-.+..
T Consensus        89 aDlil~iG~~~~~~  102 (186)
T 2uz1_A           89 PDLVLMLGARFGLN  102 (186)
T ss_dssp             CSEEEEESCCSSGG
T ss_pred             CCCEEEEECCCCCC
T ss_conf             42103321011112


No 48 
>>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} (A:1-106,A:248-291)
Probab=88.90  E-value=1.8  Score=23.20  Aligned_cols=100  Identities=16%  Similarity=0.107  Sum_probs=65.9

Q ss_pred             CCEEEEECCCCCHHHHHHHH---HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHH-HHHH
Q ss_conf             97999940788615289999---9999976994799807874336688978988742026868999648876234-5555
Q gi|254780901|r   93 EKIMIFGDYDVDGAASVALM---MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYD-ALQY  168 (600)
Q Consensus        93 ekI~I~gDyD~DGitstail---~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e-~i~~  168 (600)
                      ..|.+.-- |.+.--.+.++   .+.++..|.++.++..+...+   --...++.+.+.+++-||.+-++..+.+ .++.
T Consensus         6 ~~Igvi~~-~~~~~f~~~i~~gi~~aa~~~Gy~l~i~~~~~d~~---~~~~~i~~l~~~~vdgIIi~~~~~~~~~~~i~~   81 (150)
T 3l49_A            6 KTIGITAI-GTDHDWDLKAYQAQIAEIERLGGTAIALDAGRNDQ---TQVSQIQTLIAQKPDAIIEQLGNLDVLNPWLQK   81 (150)
T ss_dssp             CEEEEEES-CCSSHHHHHHHHHHHHHHHHTTCEEEEEECTTCHH---HHHHHHHHHHHHCCSEEEEESSCHHHHHHHHHH
T ss_pred             CEEEEEEC-CCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHH
T ss_conf             99999958-99998999999999999997399999993899999---999999999975999999927840305899999


Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCEEEECCCC
Q ss_conf             5417982799615447655567256523788
Q gi|254780901|r  169 ATNQGIDVIVIDHHQVKSEEIPAYALVNPNR  199 (600)
Q Consensus       169 a~~~GidvIVtDHH~~~~~~p~a~aivNP~~  199 (600)
                      +++.||-|+..|-..   ..+.++..++|..
T Consensus        82 l~~~gIPvV~i~~~~---~~~~~~~~~d~~~  109 (150)
T 3l49_A           82 INDAGIPLFTVDTAT---PHAINNTTSNPSE  109 (150)
T ss_dssp             HHHTTCCEEEESCCC---TTCSEEEEECHHH
T ss_pred             HHHCCCCEEECCCCC---CCCCCEEEECHHH
T ss_conf             998699199667767---8878879963999


No 49 
>>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} (A:124-242)
Probab=88.60  E-value=1.8  Score=23.06  Aligned_cols=91  Identities=11%  Similarity=0.023  Sum_probs=69.6

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             77997999940788615289999999997699479980787433668897898874202686899964887623455555
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA  169 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a  169 (600)
                      ...+++.|.++=|.-|-....-+.+.|+..|.++....+.  ..+..=-...+.+++..+++.|+.+-.+.....-+..+
T Consensus        14 ~~~~~v~ii~~d~~~g~~~~~~~~~~l~~~G~~iv~~~~~--~~~~~d~~~~i~~i~~~~~d~v~~~~~~~~~~~i~~~~   91 (119)
T 3hut_A           14 DGFTSVAVIGVTTDWGLSSAQAFRKAFELRGGAVVVNEEV--PPGNRRFDDVIDEIEDEAPQAIYLAXAYEDAAPFLRAL   91 (119)
T ss_dssp             TTCCEEEEEEESSHHHHHHHHHHHHHHHHTTCEEEEEEEE--CTTCCCCHHHHHHHHHHCCSEEEEESCHHHHHHHHHHH
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEEEC--CCCCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHH
T ss_conf             0781699960567265899999864454069789999955--99873115899999865999999973668899999999


Q ss_pred             HHCCCCEEEECCC
Q ss_conf             4179827996154
Q gi|254780901|r  170 TNQGIDVIVIDHH  182 (600)
Q Consensus       170 ~~~GidvIVtDHH  182 (600)
                      +++|++..+.-..
T Consensus        92 ~~~G~~~~~~~~~  104 (119)
T 3hut_A           92 RARGSALPVYGSS  104 (119)
T ss_dssp             HHTTCCCCEEECG
T ss_pred             HHCCCCCCEEEEC
T ss_conf             9819998656420


No 50 
>>3etn_A Putative phosphosugar isomerase involved in capsule formation; YP_209877.1, structural genomics; HET: MSE CMK; 1.70A {Bacteroides fragilis nctc 9343} (A:)
Probab=88.51  E-value=1.9  Score=23.02  Aligned_cols=98  Identities=16%  Similarity=0.256  Sum_probs=57.8

Q ss_pred             CCHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCE
Q ss_conf             48799999999999-7799799994078861528--99999999976994799807874336688978988742026868
Q gi|254780901|r   76 TDCDKAARRIVQAI-YNSEKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQL  152 (600)
Q Consensus        76 ~dm~~A~~ri~~ai-~~~ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~L  152 (600)
                      .++++.++.+.+.+ .+.++|.|+|   + |.+.  +--+...|..+|..+.+.-+.  .    .-......+.+  -++
T Consensus        42 ~~~~~~~~~i~~~~l~~a~~I~i~G---~-G~S~~~A~~~~~~l~~~g~~~~~~~~~--~----~~~~~~~~~~~--~dl  109 (220)
T 3etn_A           42 DAYEKAVELIVEQIHRKKGKLVTSG---X-GKAGQIAXNIATTFCSTGIPSVFLHPS--E----AQHGDLGILQE--NDL  109 (220)
T ss_dssp             THHHHHHHHHHHHTTTTCCCEEEEC---S-HHHHHHHHHHHHHHHHTTCCEEECCTT--G----GGBTGGGGCCT--TCE
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEE---E-ECHHHHHHHHHHHHHHCCCEEEEHHHH--H----HHHHHHHCCCC--CCE
T ss_conf             3699999999999971698699998---9-714864999977764133213431267--8----88766521577--755


Q ss_pred             EEEECCCCCCH---HHHHHHH--HCCCCEE-EECCCCCC
Q ss_conf             99964887623---4555554--1798279-96154476
Q gi|254780901|r  153 IITVDCGSTSY---DALQYAT--NQGIDVI-VIDHHQVK  185 (600)
Q Consensus       153 iItvD~Gi~~~---e~i~~a~--~~GidvI-VtDHH~~~  185 (600)
                      +|.....-.+.   +.++.|+  +.|+.|| ||+....|
T Consensus       110 vI~iS~sG~t~~~~~~~~~ak~~~~g~~vi~IT~~~~s~  148 (220)
T 3etn_A          110 LLLISNSGKTREIVELTQLAHNLNPGLKFIVITGNPDSP  148 (220)
T ss_dssp             EEEECSSSCCHHHHHHHHHHHHHCTTCEEEEEESCTTSH
T ss_pred             EEEECCCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCHH
T ss_conf             999658977531366899987324578179873798536


No 51 
>>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, structural genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli K12} (A:1-121,A:255-277)
Probab=88.02  E-value=2  Score=22.79  Aligned_cols=102  Identities=6%  Similarity=-0.008  Sum_probs=66.9

Q ss_pred             HHHHHHCCC--CEEEEE-CCCCCHHHHHHH---HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECC
Q ss_conf             999997799--799994-078861528999---99999976994799807874336688978988742026868999648
Q gi|254780901|r   85 IVQAIYNSE--KIMIFG-DYDVDGAASVAL---MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        85 i~~ai~~~e--kI~I~g-DyD~DGitstai---l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~  158 (600)
                      ..+++..++  .|.+.- |..-+.---+.+   +.+.++..|..+..+..++-.+   .....++.+.+.+++=+|.+..
T Consensus        10 ~Ar~L~~~~s~~Igiiip~~~~~~~f~~~i~~gi~~~~~~~gy~v~i~~~~~d~~---~~~~~i~~l~~~~vDGiIi~~~   86 (144)
T 3brq_A           10 LARNLSAKSTQTLGLVVTNTLYHGIYFSELLFHAARXAEEKGRQLLLADGKHSAE---EERQAIQYLLDLRCDAIXIYPR   86 (144)
T ss_dssp             ---------CCEEEEEECGGGCC--CHHHHHHHHHHHHHHTTCEEEEECCTTSHH---HHHHHHHHHHHTTCSEEEEECS
T ss_pred             HHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEECCC
T ss_conf             9999741899979999588654687999999999999998599999996899989---9999999886346530244033


Q ss_pred             CCCCHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             8762345555541798279961544765556
Q gi|254780901|r  159 GSTSYDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       159 Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      .....+..+++++.|+-+++.|++.+....+
T Consensus        87 ~~~~~~~~~~l~~~~iPvV~i~~~~~~~~~~  117 (144)
T 3brq_A           87 FLSVDEIDDIIDAHSQPIXVLNRRLRKNSSH  117 (144)
T ss_dssp             SSCHHHHHHHHHTCSSCEEEESCCCSSSGGG
T ss_pred             CCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             3211788999875179852222223453322


No 52 
>>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 1.97A {Lactobacillus brevis atcc 367} (A:1-106,A:224-276)
Probab=87.62  E-value=2.1  Score=22.62  Aligned_cols=123  Identities=11%  Similarity=0.040  Sum_probs=78.1

Q ss_pred             HCCCCEEEEECCCCCHHHHHHH--HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHH
Q ss_conf             7799799994078861528999--99999976994799807874336688978988742026868999648876234555
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVAL--MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQ  167 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstai--l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~  167 (600)
                      .+...|++.-.+=-|...+..+  +.+.++..|..+.++..+.-.+   -..+.++.+.+.+++-+|.+  |...-+.+.
T Consensus         5 ~~s~~Igvi~~~~~~~~~~~i~~gi~~~~~~~gy~l~i~~~~~~~~---~~~~~l~~l~~~~vdGiIi~--~~~~~~~~~   79 (159)
T 3jy6_A            5 QSSKLIAVIVANIDDYFSTELFKGISSILESRGYIGVLFDANADIE---REKTLLRAIGSRGFDGLILQ--SFSNPQTVQ   79 (159)
T ss_dssp             CCCCEEEEEESCTTSHHHHHHHHHHHHHHHTTTCEEEEEECTTCHH---HHHHHHHHHHTTTCSEEEEE--SSCCHHHHH
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCCCCCC--CCCHHHHHH
T ss_conf             7899899992899898999999999999998699999994899989---99999999995388853124--620047788


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCCCEE-EECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             55417982799615447655567256-523788886433443047889999
Q gi|254780901|r  168 YATNQGIDVIVIDHHQVKSEEIPAYA-LVNPNRLDDLSGQGHLCAAGVVFL  217 (600)
Q Consensus       168 ~a~~~GidvIVtDHH~~~~~~p~a~a-ivNP~~~~~~~p~~~l~gaGvaf~  217 (600)
                      .+.+.|+-++.+|.+......+.-.. =+.|.+.--.-|..+++..+|-.+
T Consensus        80 ~l~~~~iPvV~i~~~~~~~~~~~V~~Dd~~P~LTTv~~~~~~mg~~a~~~l  130 (159)
T 3jy6_A           80 EILHQQMPVVSVDREMDACPWPQVVTDRMEPKLTLITQNPFLMGASSAEIM  130 (159)
T ss_dssp             HHHTTSSCEEEESCCCTTCSSCEEECCCC--CCCEEECCHHHHHHHHHHHH
T ss_pred             HHHHCCCCEECCCCCCCCCCCCCCCCCHCCCCCEEEEECHHHHHHHHHHHH
T ss_conf             888628730002345455778742556358996499859999999999999


No 53 
>>3fkj_A Putative phosphosugar isomerases; NP_459564.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.12A {Salmonella typhimurium LT2} (A:1-173)
Probab=87.30  E-value=2.2  Score=22.49  Aligned_cols=128  Identities=12%  Similarity=0.073  Sum_probs=67.3

Q ss_pred             HHHHHCCCCHHHCCCCHHHCCC-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             9886619667771899556148-7999999999997799799994078861528--999999999769947998078743
Q gi|254780901|r   56 YAKDFLNPSIRLLMPDPLILTD-CDKAARRIVQAIYNSEKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIV  132 (600)
Q Consensus        56 ~~~~fL~p~l~~l~~dP~~l~d-m~~A~~ri~~ai~~~ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~  132 (600)
                      ..+.+++-.+..+   |..+.. .++..+++.+.+.+.++|.|||   + |.+.  +..+...|..+|.++......   
T Consensus         6 ~~~~~~~~~i~~~---~~~~~~~~~~~~~~~~~~l~~a~~I~i~G---~-G~S~~~a~~~~~~l~~~~~~~~~~~~~---   75 (173)
T 3fkj_A            6 IHHHHHHENLYFQ---GXSVAHENARRIISDILGKQNIERVWFVG---C-GGSLTGFWPGKYFLDCEASKLAVGYIT---   75 (173)
T ss_dssp             -------CCCCCC---CCCHHHHHHHHHHHHHHTTSCCCEEEEEE---S-THHHHTTHHHHHHHHHHCSSCEEEEEE---
T ss_pred             CCCCHHHHHHHHH---HHHHHHHHHHHHHHHHHHHCCCCEEEEEE---E-CHHHHHHHHHHHHHHHHCCCCCEEEEC---
T ss_conf             1111127888875---87651001899999999658999899998---0-369999999999999862399889971---


Q ss_pred             CCCCCCHHHHHHHH--HCCCCEEEEECC-CCC--CHHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCC
Q ss_conf             36688978988742--026868999648-876--23455555417982799-61544765556725652378
Q gi|254780901|r  133 DGYGPNPSLMEKFI--NEGAQLIITVDC-GST--SYDALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       133 eGYGl~~~~i~~~~--~~g~~LiItvD~-Gi~--~~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~  198 (600)
                           .........  -..-+++|.+.. |-+  -.+.+++|+++|+.||. |+.+..+=....-+.+.-|.
T Consensus        76 -----~~~~~~~~~~~~~~~d~vi~iS~sG~t~~~~~~~~~ak~~g~~vi~iT~~~~s~l~~~ad~~l~~~~  142 (173)
T 3fkj_A           76 -----SNEFVHATPKALGKNSVVILASQQGNTAETVAAARVAREKGAATIGLVYQPDTPLCEYSDYIIEYQW  142 (173)
T ss_dssp             -----HHHHHHSCCTTCSTTEEEEEEESSSCCHHHHHHHHHHHHHTCEEEEEESSTTCHHHHTCSEEEECBC
T ss_pred             -----CHHHHCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEECCCCCCCCEEECCCCEEEEEE
T ss_conf             -----0787605976689998899987899976899999999873972551214688751341572378753


No 54 
>>2nyd_A UPF0135 protein SA1388; hypothetical protein SA1388, selenomethionine SAD, unknown function; 2.00A {Staphylococcus aureus subsp} (A:108-131,A:239-332)
Probab=87.22  E-value=0.82  Score=25.78  Aligned_cols=72  Identities=18%  Similarity=0.282  Sum_probs=46.9

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEC--CC------CCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             2899999999976994799807--87------433668897898874202686899964887623455555417982799
Q gi|254780901|r  107 ASVALMMRFLSHCSVNANMYIP--DR------IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIV  178 (600)
Q Consensus       107 tstail~~~L~~~g~~v~~~IP--~R------~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIV  178 (600)
                      |...++...-+.++....-+.+  ++      +--|.|-+  .++++.+.|++++||-|.   .+.....|++.|+.+|.
T Consensus        39 s~~el~~~ik~~l~~~~i~v~g~~~~~IkrVAi~~GsG~s--~i~~A~~~g~D~fITGEi---k~h~~~~A~e~gi~lId  113 (118)
T 2nyd_A           39 TLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIG--YEYQAVQQGADVFVTGDI---KHHDALDAKIHGVNLID  113 (118)
T ss_dssp             EHHHHHHHHHHHTTCSCCEEESCTTCEEEEEEECCSCCTT--SHHHHHHTTCSEEEESCC---CHHHHHHHHHTTCCEEE
T ss_pred             CHHHHHHHHHHHCCCCCEEECCCCCCCEEEEEEEECCCHH--HHHHHHHCCCCEEEECCC---CHHHHHHHHHCCCEEEE
T ss_conf             7999999999870998434048887755389999077578--999998769989997787---51889999867998997


Q ss_pred             ECCCC
Q ss_conf             61544
Q gi|254780901|r  179 IDHHQ  183 (600)
Q Consensus       179 tDHH~  183 (600)
                      ..||.
T Consensus       114 ~GHyA  118 (118)
T 2nyd_A          114 INHYS  118 (118)
T ss_dssp             CCGGG
T ss_pred             CCCCC
T ss_conf             88643


No 55 
>>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium LT2} (A:1-107,A:244-301)
Probab=87.21  E-value=2.2  Score=22.45  Aligned_cols=75  Identities=16%  Similarity=0.210  Sum_probs=53.0

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH-HHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9999997699479980787433668897898874202686899964887623-4555554179827996154476555
Q gi|254780901|r  112 MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY-DALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       112 l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~-e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      +.+.++..|.++.++-+.+.+.  .-....++.+.+.+++-||.+-+..... +.++.+++.|+.|+.+|++.++...
T Consensus        25 i~~aa~~~Gy~vil~~~s~~d~--~~q~~~i~~li~~~vDGIIi~~~~~~~~~~~i~~l~~~gIPVV~id~~~~~~~~  100 (165)
T 1tjy_A           25 AQEAGKALGIDVTYDGPTEPSV--SGQVQLVNNFVNQGYDAIIVSAVSPDGLCPALKRAMQRGVKILTWDSDTKPECR  100 (165)
T ss_dssp             HHHHHHHHTCEEEECCCSSCCH--HHHHHHHHHHHHTTCSEEEECCSSSSTTHHHHHHHHHTTCEEEEESSCCCGGGC
T ss_pred             HHHHHHHCCCEEEEEECCCCCH--HHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCC
T ss_conf             9999998199899997999999--999999999997399744201333202456888765058520103543335666


No 56 
>>2fyw_A Conserved hypothetical protein; structural genomics, PSI, midwest center for structural genomics, MCSG; 2.40A {Streptococcus pneumoniae TIGR4} (A:107-229)
Probab=86.75  E-value=1.1  Score=24.68  Aligned_cols=85  Identities=18%  Similarity=0.185  Sum_probs=57.0

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE-C-----C----CCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             7999940788615289999999997699479980-7-----8----7433668897898874202686899964887623
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI-P-----D----RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~~g~~v~~~I-P-----~----R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      .+..+|  ..+.+|...++...-+.++....-++ .     +    |.-=-=|-..+.++.+...|++++||=|   ..+
T Consensus        29 g~G~ig--~l~~~t~~~l~~~i~~~l~~~~~~~~~~~~~~~~~~i~rVai~~GsG~~~i~~a~~~g~D~~ITGe---~~~  103 (123)
T 2fyw_A           29 GIGRIG--NIQPQTFWELAQQVKQVFDLDSLRXVHYQEDDLQKPISRVAICGGSGQSFYKDALAKGADVYITGD---IYY  103 (123)
T ss_dssp             EEEEEE--EEEEEEHHHHHHHHHHHTTCSCCEEECSCTTGGGSEEEEEEEESSSCGGGHHHHHHTTCSEEEESC---CCH
T ss_pred             CEEEEE--CCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEECC---CCC
T ss_conf             647874--468779999999999972999669962357877774058999789725655456524999999778---560


Q ss_pred             HHHHHHHHCCCCEEEECCCC
Q ss_conf             45555541798279961544
Q gi|254780901|r  164 DALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       164 e~i~~a~~~GidvIVtDHH~  183 (600)
                      .+.-.|++.|+-+|-..||.
T Consensus       104 h~~~~A~e~gi~li~~gHy~  123 (123)
T 2fyw_A          104 HTAQDXLSDGLLALDPGHYI  123 (123)
T ss_dssp             HHHHHHHHTTCEEEECCGGG
T ss_pred             HHHHHHHHCCCEEEECCCCH
T ss_conf             78999987699899788505


No 57 
>>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli K12} (A:152-285)
Probab=86.73  E-value=2.3  Score=22.27  Aligned_cols=80  Identities=11%  Similarity=0.257  Sum_probs=57.1

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             79979999407886152899999999976-99479980787433668897898874202686899964887623455555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHC-SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA  169 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~-g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a  169 (600)
                      ++.+|++.||.-- +=+.-+ +..++..+ |.++...-|.    ||.+....++.+.+.|.++.+|-|--    +++   
T Consensus         2 ~g~~i~~vGD~~~-~rv~~S-l~~~~~~l~g~~v~l~~P~----~~~~~~~~~~~~~~~g~~i~~~~d~~----~a~---   68 (134)
T 3csu_A            2 DNLHVAMVGDLKY-GRTVHS-LTQALAKFDGNRFYFIAPD----ALAMPQYILDMLDEKGIAWSLHSSIE----EVM---   68 (134)
T ss_dssp             SSCEEEEESCTTT-CHHHHH-HHHHHHTSSSCEEEEECCG----GGCCCHHHHHHHHHTTCCEEECSCGG----GTT---
T ss_pred             CCCEEEEEECCCC-CCHHHH-HHHHHHHCCCCEEEEECCC----CCCCCHHHHHHHHCCCCCCCCCCCHH----HCC---
T ss_conf             6875899953766-733899-9999863567769996986----12541343200100124333211033----215---


Q ss_pred             HHCCCCEEEECCCCCC
Q ss_conf             4179827996154476
Q gi|254780901|r  170 TNQGIDVIVIDHHQVK  185 (600)
Q Consensus       170 ~~~GidvIVtDHH~~~  185 (600)
                        .|.|||.||-....
T Consensus        69 --~~aDviyt~~w~~~   82 (134)
T 3csu_A           69 --AEVDILYMTRVQKE   82 (134)
T ss_dssp             --TTCSEEEECC----
T ss_pred             --CCCCEEEECCCCHH
T ss_conf             --67754531143022


No 58 
>>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiamine diphosphate; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* (A:192-368)
Probab=86.53  E-value=2.4  Score=22.19  Aligned_cols=135  Identities=10%  Similarity=0.043  Sum_probs=80.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC--CCCCCCCCCHHHHHHHHHCCCCEEEEEC
Q ss_conf             99999999997799799994078861528999999999769947998078--7433668897898874202686899964
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD--RIVDGYGPNPSLMEKFINEGAQLIITVD  157 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~--R~~eGYGl~~~~i~~~~~~g~~LiItvD  157 (600)
                      .+++.+.+.+.+-++.+|+..+.+...-+..-+.++...+|+-|......  .+.+.+.+.....-...-..++|||.+.
T Consensus         8 ~~i~~~~~~L~~A~rPvii~G~~~~~~~a~~~l~~lae~~g~Pv~~~~~~k~~~~~~~p~~~g~~~~~~l~~aDlii~iG   87 (177)
T 2q28_A            8 KSVTSAISLLAKAERPLIILGKGAAYSQADEQLREFIESAQIPFLPMSMAKGILEDTHPLSAAAARSFALANADVVMLVG   87 (177)
T ss_dssp             HHHHHHHHHHHHCSSEEEEECHHHHHHTCHHHHHHHHHHHTCCEEECGGGTTSSCTTCTTBCGGGHHHHHHHCSEEEEES
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCC
T ss_conf             99999998765336987999535333257999999975325875221111345666686433544021203200022223


Q ss_pred             CCCCCHHHHHHHH-HCCCCEEEECCCCCCCCCCCCEEEECCCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             8876234555554-17982799615447655567256523788--88643344304788999999999997021488
Q gi|254780901|r  158 CGSTSYDALQYAT-NQGIDVIVIDHHQVKSEEIPAYALVNPNR--LDDLSGQGHLCAAGVVFLVLVLIYRILRQDNK  231 (600)
Q Consensus       158 ~Gi~~~e~i~~a~-~~GidvIVtDHH~~~~~~p~a~aivNP~~--~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~  231 (600)
                      +-.....--..-. .....+|                .||+..  .+-.+ ..+++=+|=+..++.+|.+.+.....
T Consensus        88 ~~~~~~~~~~~~~~~~~~~vi----------------~i~~d~~~~~~~~-~~~~~i~~d~~~~l~~L~~~l~~~~~  147 (177)
T 2q28_A           88 ARLNWLLAHGKKGWAADTQFI----------------QLDIEPQEIDSNR-PIAVPVVGDIASSMQGMLAELKQNTF  147 (177)
T ss_dssp             CCCSGGGGGGTTTSCTTCEEE----------------EEESCGGGTTSSS-CCSEEEESCHHHHHHHHHHHHHHSCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCC----------------CCCCCCCCCCCCC-CCEEEEEHHHHHHHHHHHHHHHHCCC
T ss_conf             432222343212368654433----------------4566753222345-51232420036899999997552456


No 59 
>>8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} (A:1-109,A:256-284)
Probab=86.27  E-value=2.4  Score=22.09  Aligned_cols=92  Identities=9%  Similarity=-0.000  Sum_probs=58.2

Q ss_pred             CCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC-CCHHHHHHH
Q ss_conf             9799994078861528--9999999997699479980787433668897898874202686899964887-623455555
Q gi|254780901|r   93 EKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS-TSYDALQYA  169 (600)
Q Consensus        93 ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi-~~~e~i~~a  169 (600)
                      .+|.+.-..-.|-..+  ..-+.+.++..|.++.+.-.++..+    ....++.+...+++-||.+=.+. ...+.++.+
T Consensus         3 ~~Igvii~~~~n~f~~~i~~gi~~~a~~~g~~vi~~~~~~~~~----~~~~i~~li~~~vDGIIi~~~~~~~~~~~i~~l   78 (138)
T 8abp_A            3 LKLGFLVKQPEEPWFQTEWKFADKAGKDLGFEVIKIAVPDGEK----TLNAIDSLAASGAKGFVICTPDPKLGSAIVAKA   78 (138)
T ss_dssp             EEEEEEESCTTSHHHHHHHHHHHHHHHHHTEEEEEEECCSHHH----HHHHHHHHHHTTCCEEEEECSCGGGHHHHHHHH
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHH----HHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHH
T ss_conf             0999997999898999999999999997299999985999999----999999999759998998053234558999999


Q ss_pred             HHCCCCEEEECCCCCCCCC
Q ss_conf             4179827996154476555
Q gi|254780901|r  170 TNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       170 ~~~GidvIVtDHH~~~~~~  188 (600)
                      .+.||-||..|-+..+...
T Consensus        79 ~~~gIPvV~id~~~~~~~~   97 (138)
T 8abp_A           79 RGYDMKVIAVDDQFVNAKG   97 (138)
T ss_dssp             HHTTCEEEEESSCCBCTTS
T ss_pred             HHCCCCEEEEECCCCCCCC
T ss_conf             9739988999545434443


No 60 
>>2fts_A Gephyrin; gephyrin, neuroreceptor anchoring, structural protein; 2.41A {Rattus norvegicus} (A:1-21,A:182-334)
Probab=85.86  E-value=2.3  Score=22.35  Aligned_cols=95  Identities=20%  Similarity=0.212  Sum_probs=59.9

Q ss_pred             CHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCC-------H---HHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCC
Q ss_conf             9556148799999999999779979999407886-------1---528999999999769947998--078743366889
Q gi|254780901|r   71 DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVD-------G---AASVALMMRFLSHCSVNANMY--IPDRIVDGYGPN  138 (600)
Q Consensus        71 dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~D-------G---itstail~~~L~~~g~~v~~~--IP~R~~eGYGl~  138 (600)
                      +||-|..|+||---..+----+=.|.+.||==++       |   =+.+..+...|+++|.++.++  +|+...+    -
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~prv~Ii~tGdEiv~~~~~~~~G~v~Dsn~~~l~~~L~~~G~~v~~~~~v~Dd~~~----i   77 (174)
T 2fts_A            2 SPFPLTSMDKAFITVLEMTPPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDD----L   77 (174)
T ss_dssp             CSCCEEEHHHHHHHHHHHSCCCEEEEEECTTEECTTSCCCTTCEECCHHHHHHHHHHTTTCCEEEEEEECSSHHH----H
T ss_pred             CCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCHHH----H
T ss_conf             898997799999999836991089995277656742134654322530788999999779937999873684688----8


Q ss_pred             HHHHHHHHHCCCCEEEEECCCC--CCHHHHHHHHH
Q ss_conf             7898874202686899964887--62345555541
Q gi|254780901|r  139 PSLMEKFINEGAQLIITVDCGS--TSYDALQYATN  171 (600)
Q Consensus       139 ~~~i~~~~~~g~~LiItvD~Gi--~~~e~i~~a~~  171 (600)
                      .++++++.+ ++++|||.- |+  +..+-...+.+
T Consensus        78 ~~~l~~~~~-~~DiVIttG-G~g~g~~D~t~~a~~  110 (174)
T 2fts_A           78 LNALNEGIS-RADVIITSG-GVSMGEKDYLKQVLD  110 (174)
T ss_dssp             HHHHHHHHH-HCSEEEEES-CCSSSCCHHHHHHHH
T ss_pred             HHHHHHHHH-HCCEEEEEC-CCCHHHHHHHHHHHH
T ss_conf             999986454-345798505-546146788999987


No 61 
>>1nmo_A Hypothetical protein YBGI; toroidal structure, structure 2 function project, S2F, structural genomics, unknown functio; 2.20A {Escherichia coli} (A:103-217)
Probab=85.71  E-value=2.6  Score=21.89  Aligned_cols=45  Identities=27%  Similarity=0.404  Sum_probs=37.0

Q ss_pred             CCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             66889789887420268689996488762345555541798279961544
Q gi|254780901|r  134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       134 GYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      |.|  ...++++.+.+++++||-|   -.+-++-.|++.|+.+|..-||.
T Consensus        71 GsG--~~~i~~a~~~~~D~~ITGe---~k~h~~~~A~~~gl~li~~gHya  115 (115)
T 1nmo_A           71 GGG--QSFIDSAARFGVDAFITGE---VSEQTIHSAREQGLHFYAAGHHA  115 (115)
T ss_dssp             SSC--GGGHHHHHHHCCSEEEESC---CCHHHHHHHHHTTCEEEECCHHH
T ss_pred             CCC--HHHHHHHHHCCCCEEEECC---CCHHHHHHHHHCCCEEEEECCHH
T ss_conf             776--4489999864997899756---77799999997699799909489


No 62 
>>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, signaling protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* (A:170-304,A:441-482)
Probab=85.56  E-value=2.6  Score=21.84  Aligned_cols=90  Identities=8%  Similarity=0.019  Sum_probs=64.8

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             799799994078861528999999999769947998--078743366889789887420268689996488762345555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      +-++|.|+.+-|..|-....-+.+.++..|.++.+.  +|..... ..-....+..+.+.+++.||.+=.+..+..-+..
T Consensus        16 gwk~VaII~~dd~yG~~~~~~l~~~~~~~Gi~V~~~~~~~~~~~~-~~d~~~~l~~i~~s~~~vVv~~~~~~~~~~il~~   94 (177)
T 2e4u_A           16 NWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIR-KSYDSVIRELLQKPNARVVVLFMRSDDSRELIAA   94 (177)
T ss_dssp             TCCEEEEEEESSTTHHHHHHHHHHHHHTTTCEEEEEEEECTTCCH-HHHHHHHHHHHTCTTCCEEEEECCHHHHHHHHHH
T ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCH-HHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHH
T ss_conf             995899998440667799999999888648349999965788757-7788877777652687089997250899999999


Q ss_pred             HHHCCCCEE--EECC
Q ss_conf             541798279--9615
Q gi|254780901|r  169 ATNQGIDVI--VIDH  181 (600)
Q Consensus       169 a~~~GidvI--VtDH  181 (600)
                      |+++|++..  ++|-
T Consensus        95 a~~~Gl~~~~I~s~~  109 (177)
T 2e4u_A           95 ANRVNASFTWVASDG  109 (177)
T ss_dssp             HHHTTCCCEEEECTT
T ss_pred             HHHCCCCCCEEEEEC
T ss_conf             998088763899711


No 63 
>>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} (A:127-259,A:340-385)
Probab=85.53  E-value=1.4  Score=24.06  Aligned_cols=85  Identities=9%  Similarity=0.045  Sum_probs=61.1

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             77997999940788615289999999997699479980787433668897898874202686899964887623455555
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA  169 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a  169 (600)
                      ...++|.+...-|.-|.....-+.+.++..|.++.+.....+..+-.=-...+.++++.+++.||.+-.+.....-+..+
T Consensus        12 ~g~kkVaiI~~d~~~G~~~~~~~~~~~~~~G~~vv~~~~~~~~~~~~D~~~~i~~i~~~~pd~Vi~~~~~~~~~~~l~qa   91 (179)
T 1pea_A           12 HYGERVVFIGSDYIYPRESNHVMRHLYRQHGGTVLEEIYIPLYPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAI   91 (179)
T ss_dssp             TTCSEEEEEEESSHHHHHHHHHHHHHHHHTTCEEEEEEEECSSCCHHHHHHHHHHHHHHTCSEEEEECCTHHHHHHHHHH
T ss_pred             HCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHH
T ss_conf             17847998226776235565546666664168357899616764420168999998751899899996347799999999


Q ss_pred             HHCCC
Q ss_conf             41798
Q gi|254780901|r  170 TNQGI  174 (600)
Q Consensus       170 ~~~Gi  174 (600)
                      ++.|+
T Consensus        92 ~~~Gl   96 (179)
T 1pea_A           92 ARRYG   96 (179)
T ss_dssp             HHHHC
T ss_pred             HHHCC
T ss_conf             98479


No 64 
>>2gx8_A NIF3-related protein; structural genomics, unknown function, PSI, protein structure initiative; HET: EPE; 2.20A {Bacillus cereus atcc 14579} (A:133-154,A:269-359)
Probab=85.15  E-value=0.89  Score=25.51  Aligned_cols=73  Identities=16%  Similarity=0.191  Sum_probs=49.7

Q ss_pred             HHHHHHHHHHHHHCCCCE-EEE-ECCCC------CCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEE
Q ss_conf             528999999999769947-998-07874------3366889789887420268689996488762345555541798279
Q gi|254780901|r  106 AASVALMMRFLSHCSVNA-NMY-IPDRI------VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVI  177 (600)
Q Consensus       106 itstail~~~L~~~g~~v-~~~-IP~R~------~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvI  177 (600)
                      +|-..++.+.=+.++... .+. =+++.      --|.|  .+.++.+.+.|++++||-|.   .+.+...|++.|+.+|
T Consensus        33 ~s~~~l~~~ik~~l~~~~v~~~g~~~~~I~rVAi~~GsG--~s~i~~a~~~gaD~~ITGE~---k~h~~~~A~e~gi~lI  107 (113)
T 2gx8_A           33 MTLGQFAEHVKQSLDVKGARVVGKLDDKVRKVAVLGGDG--NKYINQAKFKGADVYVTGDM---YYHVAHDAMMLGLNIV  107 (113)
T ss_dssp             EEHHHHHHHHHHHTTCSCCEEESCTTSEEEEEEEEEEEC--GGGHHHHHHTTCSEEEEECC---CHHHHHHHHHHTCEEE
T ss_pred             CCHHHHHHHHHHHCCCCCEEEECCCCCCCCEEEEECCCC--HHHHHHHHHCCCCEEEEECC---CHHHHHHHHHCCCEEE
T ss_conf             039999999998759981899389988416799980653--89999998779989999056---4699999997699799


Q ss_pred             EECCCC
Q ss_conf             961544
Q gi|254780901|r  178 VIDHHQ  183 (600)
Q Consensus       178 VtDHH~  183 (600)
                      ...||.
T Consensus       108 ~~GHyA  113 (113)
T 2gx8_A          108 DPGHNV  113 (113)
T ss_dssp             ECCGGG
T ss_pred             ECCCHH
T ss_conf             788405


No 65 
>>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, thiamin thiazolone diphosphate, inhibitor; HET: TZD; 1.00A {Pseudomonas putida} (A:174-341)
Probab=85.14  E-value=2.7  Score=21.70  Aligned_cols=84  Identities=14%  Similarity=0.168  Sum_probs=57.0

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--C-------CCCCCCC-HHHHHHHHHC
Q ss_conf             9999999999977997999940788615289999999997699479980787--4-------3366889-7898874202
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--I-------VDGYGPN-PSLMEKFINE  148 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~-------~eGYGl~-~~~i~~~~~~  148 (600)
                      +.+++++.+.|.+-++.+|+.++.+...-+...+.++...+|+-+....-.+  +       --++|.. .....++.++
T Consensus        14 ~~~i~~~~~~L~~AkrPvii~G~~~~~~~a~~~l~~la~~~~~pv~~t~~~~g~~~~~~~~~~g~~g~~~~~~~~~~~~~   93 (168)
T 1q6z_A           14 DQDLDILVKALNSASNPAIVLGPDVDAANANADCVMLAERLKAPVWVAPSAPRCPFPTRHPCFRGLMPAGIAAISQLLEG   93 (168)
T ss_dssp             HHHHHHHHHHHHHCSSCEEEECHHHHHTTCHHHHHHHHHHHTCCEEECSSCSBCCSCTTSTTEEEECCSCHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHC
T ss_conf             99999999999737587366145430126676789999973587022023455557777843346522354899999854


Q ss_pred             CCCEEEEECCCCCCH
Q ss_conf             686899964887623
Q gi|254780901|r  149 GAQLIITVDCGSTSY  163 (600)
Q Consensus       149 g~~LiItvD~Gi~~~  163 (600)
                       +++||.++|-.+..
T Consensus        94 -aDlil~vG~~~~~~  107 (168)
T 1q6z_A           94 -HDVVLVIGAPVFRY  107 (168)
T ss_dssp             -CSEEEEESSCTTCC
T ss_pred             -CCCEEEECCCCCCC
T ss_conf             -66202324533332


No 66 
>>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} (A:123-258,A:339-364)
Probab=84.93  E-value=2.8  Score=21.63  Aligned_cols=98  Identities=10%  Similarity=0.105  Sum_probs=70.1

Q ss_pred             HHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             999999999-7799799994078861528999999999769947998078743366889789887420268689996488
Q gi|254780901|r   81 AARRIVQAI-YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        81 A~~ri~~ai-~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      +.....-+. ...++|.++..=|.-|.....-+.+.++..|.++.+.++-.  -|----...+.++++.+++.|+..-.+
T Consensus         7 ~~ala~~l~~~g~~~Vaii~~d~~~G~~~~~~~~~~~~~~G~~vv~~~~~~--~~~~d~~~~v~~i~~~~pdvIv~~~~~   84 (162)
T 3lop_A            7 IDKXITALVTIGVTRIGVLYQEDALGKEAITGVERTLKAHALAITAXASYP--RNTANVGPAVDKLLAADVQAIFLGATA   84 (162)
T ss_dssp             HHHHHHHHHHTTCCCEEEEEETTHHHHHHHHHHHHHHHTTTCCCSEEEEEC--TTSCCCHHHHHHHHHSCCSEEEEESCH
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEEEEEC--CCCCCHHHHHHHHHHCCCCEEEEECCH
T ss_conf             999999999819988999983683269999999999997698899999837--988536899999985798999996878


Q ss_pred             CCCHHHHHHHHHCCCCEEEEC
Q ss_conf             762345555541798279961
Q gi|254780901|r  160 STSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       160 i~~~e~i~~a~~~GidvIVtD  180 (600)
                      ..+..-++.++++|++.-+.-
T Consensus        85 ~~~~~~~~~~~~~g~~~~~i~  105 (162)
T 3lop_A           85 EPAAQFVRQYRARGGEAQLLG  105 (162)
T ss_dssp             HHHHHHHHHHHHTTCCCEEEE
T ss_pred             HHHHHHHHHHHHHCCCCEEEE
T ss_conf             999999999998389976999


No 67 
>>3e61_A Putative transcriptional repressor of ribose operon; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} (A:1-100,A:232-251)
Probab=84.80  E-value=2.7  Score=21.75  Aligned_cols=88  Identities=10%  Similarity=0.007  Sum_probs=57.2

Q ss_pred             CCCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             99799994078861528--9999999997699479980787433668897898874202686899964887623455555
Q gi|254780901|r   92 SEKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA  169 (600)
Q Consensus        92 ~ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a  169 (600)
                      ...|.+.-..=-+..-+  ..-+.++++..|.++.++.-.--.+   -..+.++.+.+.+++-||.+  |...-+.++.+
T Consensus         8 s~~Igvi~p~~~~~f~~~i~~gi~~aa~~~gy~v~i~~~~~d~~---~~~~~i~~l~~~~vDGIIi~--~~~~~~~~~~~   82 (120)
T 3e61_A            8 SKLIGLLLPDMSNPFFTLIARGVEDVALAHGYQVLIGNSDNDIK---KAQGYLATFVSHNCTGMIST--AFNENIIENTL   82 (120)
T ss_dssp             --CEEEEESCTTSHHHHHHHHHHHHHHHHTTCCEEEEECTTCHH---HHHHHHHHHHHTTCSEEEEC--GGGHHHHHHHH
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCCEEEC--CCCHHHHHHHH
T ss_conf             99899992999678999999999999998699999996899989---99999999984466422531--43115578776


Q ss_pred             HHCCCCEEEECCCCC
Q ss_conf             417982799615447
Q gi|254780901|r  170 TNQGIDVIVIDHHQV  184 (600)
Q Consensus       170 ~~~GidvIVtDHH~~  184 (600)
                      .+.|+-+++.|.+.+
T Consensus        83 ~~~~iPvV~id~~~~   97 (120)
T 3e61_A           83 TDHHIPFVFIDRINN   97 (120)
T ss_dssp             HHC-CCEEEGGGCC-
T ss_pred             HHCCCCEEEEEECCC
T ss_conf             403753035530578


No 68 
>>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} (A:1-104,A:238-283)
Probab=83.73  E-value=3.1  Score=21.27  Aligned_cols=101  Identities=13%  Similarity=0.049  Sum_probs=64.4

Q ss_pred             CCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC-HHHHHHH
Q ss_conf             9799994078861528--999999999769947998078743366889789887420268689996488762-3455555
Q gi|254780901|r   93 EKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS-YDALQYA  169 (600)
Q Consensus        93 ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~-~e~i~~a  169 (600)
                      ++|++.-..--|..-+  ..=+.++++..|.++..+..+.-.+   --...++.+.+.+++=||.+=...+. .+.++.+
T Consensus         2 ktIgii~~~~~~~f~~~ii~gi~~aa~~~G~~l~i~~~~~~~~---~e~~~i~~ll~~~vdgIIi~~~~~~~~~~~~~~l   78 (150)
T 2ioy_A            2 KTIGLVISTLNNPFFVTLKNGAEEKAKELGYKIIVEDSQNDSS---KELSNVEDLIQQKVDVLLINPVDSDAVVTAIKEA   78 (150)
T ss_dssp             CEEEEEESCSSSHHHHHHHHHHHHHHHHHTCEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEECCSSTTTTHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             2999985789898999999999999997599999993899999---9999999998623233445663222221000023


Q ss_pred             HHCCCCEEEECCCCCCCCCCCCEEEECC
Q ss_conf             4179827996154476555672565237
Q gi|254780901|r  170 TNQGIDVIVIDHHQVKSEEIPAYALVNP  197 (600)
Q Consensus       170 ~~~GidvIVtDHH~~~~~~p~a~aivNP  197 (600)
                      .+.|+.++..|.+.+. ....++...||
T Consensus        79 ~~~gIPvV~id~~~~~-~~~~~~v~~d~  105 (150)
T 2ioy_A           79 NSKNIPVITIDRSANG-GDVVCHIASDP  105 (150)
T ss_dssp             HHTTCCEEEESSCCSS-SCCSEEEEECH
T ss_pred             HCCCCEEEEEECCCCC-CCCCEEEEECH
T ss_conf             3157528998157788-88672997489


No 69 
>>3i45_A Twin-arginine translocation pathway signal protein; structural genomics, protein structure initiative; 1.36A {Rhodospirillum rubrum atcc 11170} (A:125-260,A:324-387)
Probab=83.52  E-value=3.2  Score=21.20  Aligned_cols=89  Identities=8%  Similarity=0.005  Sum_probs=66.0

Q ss_pred             HHHHH--HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEE--EECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             99999--779979999407886152899999999976994799--80787433668897898874202686899964887
Q gi|254780901|r   85 IVQAI--YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM--YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        85 i~~ai--~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~--~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      +.+.+  ...++|.|++.=|.-|......+.+.++..|.++.+  .++-...+  .=-...+.+++..+++.|+.+-.|.
T Consensus         9 la~~l~~~g~kkVaII~~d~~yG~~~~~~f~~~l~~~G~~V~~~~~i~~~~~~--~d~~~~i~kik~a~pdvVi~~~~~~   86 (200)
T 3i45_A            9 LAAEAAKLPITRWATIAPNYEYGQSAVARFKELLLAARPEVTFVAEQWPALYK--LDAGPTVQALQQAEPEGLFNVLFGA   86 (200)
T ss_dssp             HHHHHTTSSCCEEEEECCSSHHHHHHHHHHHHHHHHHCTTCEEEEEECCCTTC--CCHHHHHHHHHHTCCSEEEECCCTT
T ss_pred             HHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCC--CHHHHHHHHHHHCCCCEEEEEECCH
T ss_conf             99998862871785447896788999998887775236613688766402665--1167898888860983899993337


Q ss_pred             CCHHHHHHHHHCCCC
Q ss_conf             623455555417982
Q gi|254780901|r  161 TSYDALQYATNQGID  175 (600)
Q Consensus       161 ~~~e~i~~a~~~Gid  175 (600)
                      ....-+..+++.|+.
T Consensus        87 ~a~~~ikqa~~~Gl~  101 (200)
T 3i45_A           87 DLPKFVREGRVRGLF  101 (200)
T ss_dssp             HHHHHHHHHHHHTSS
T ss_pred             HHHHHHHHHHHHCCC
T ss_conf             899999999981887


No 70 
>>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} (A:181-349)
Probab=82.94  E-value=3.3  Score=21.04  Aligned_cols=137  Identities=9%  Similarity=0.081  Sum_probs=78.7

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC---------CCCCCCC--CHHHHHHH
Q ss_conf             879999999999977997999940788615289999999997699479980787---------4336688--97898874
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR---------IVDGYGP--NPSLMEKF  145 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R---------~~eGYGl--~~~~i~~~  145 (600)
                      .-+.+++++.+.|++-++.+|+.++.+...-+..-+.++.+.+|+.|......|         +--.|+.  ....+.++
T Consensus        14 ~~~~~i~~~~~~L~~AkrPvii~G~~~~~~~~~~~l~~lae~~g~pv~~t~~~kg~~~~~~p~~~G~~~~~~~~~~~~~~   93 (169)
T 1ovm_A           14 CLKAFRDAAENKLAMSKRTALLADFLVLRHGLKHALQKWVKEVPMAHATMLMGKGIFDERQAGFYGTYSGSASTGAVKEA   93 (169)
T ss_dssp             HHHHHHHHHHHHHHTCSCEEEEECHHHHHTTCHHHHHHHHHHSCCEEEECGGGTTSSCTTSTTCCCCCCGGGSCHHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHCCCCEEECCCCCEECCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             30678999999998558868995762123533699999998669961222333141266665346762465565999999


Q ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHH-CCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             20268689996488762345555541-79827996154476555672565237888864334430478899999999999
Q gi|254780901|r  146 INEGAQLIITVDCGSTSYDALQYATN-QGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYR  224 (600)
Q Consensus       146 ~~~g~~LiItvD~Gi~~~e~i~~a~~-~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~  224 (600)
                      .++ ++|||.+.+-.+...--.+... ..-.+|.+|.+..         -+++     .+ ..++.=.|-.=.++.+|.+
T Consensus        94 l~~-aDlvl~~G~~~~~~~~~~~~~~~~~~~~I~i~~d~~---------~~~~-----~~-~~~~~i~~d~~~~l~~L~~  157 (169)
T 1ovm_A           94 IEG-ADTVLCVGTRFTDTLTAGFTHQLTPAQTIEVQPHAA---------RVGD-----VW-FTGIPMNQAIETLVELCKQ  157 (169)
T ss_dssp             HHT-SSEEEEESCCCCTTTTTTTCCCCCTTTEEEECSSEE---------EETT-----EE-EESCCHHHHHHHHHHHHHT
T ss_pred             HHC-CCEEEECCCCCCCCCCCCCCCCCCCCCEEEECCCHH---------HHCC-----CC-CCCCCHHHHHHHHHHHHHH
T ss_conf             841-440111043456444456544578740467458788---------8574-----31-4783377779999998763


Q ss_pred             HHCCC
Q ss_conf             70214
Q gi|254780901|r  225 ILRQD  229 (600)
Q Consensus       225 ~l~~~  229 (600)
                      .+...
T Consensus       158 ~l~~~  162 (169)
T 1ovm_A          158 HVHAG  162 (169)
T ss_dssp             SCCC-
T ss_pred             HHHHH
T ss_conf             02266


No 71 
>>2d59_A Hypothetical protein PH1109; COA binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.65A {Pyrococcus horikoshii OT3} (A:)
Probab=82.94  E-value=3.3  Score=21.04  Aligned_cols=114  Identities=11%  Similarity=0.086  Sum_probs=67.9

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-CCCCCCHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             99999997799799994078861528999999999769947998078743-36688978988742026868999648876
Q gi|254780901|r   83 RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV-DGYGPNPSLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        83 ~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~-eGYGl~~~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      +...+.+.+.++|+|.|--+-.|--+.. ..+.|+..|.+|...-|...+ +|+ ..-..++++.+ .+++++.+-.-..
T Consensus        13 ~~~~~~l~~p~~iAVvGas~~~~~~g~~-v~~~l~~~G~~V~~V~p~~~~i~g~-~~~~sl~elp~-~~Dlv~i~~p~~~   89 (144)
T 2d59_A           13 EDIREILTRYKKIALVGASPKPERDANI-VMKYLLEHGYDVYPVNPKYEEVLGR-KCYPSVLDIPD-KIEVVDLFVKPKL   89 (144)
T ss_dssp             HHHHHHHHHCCEEEEETCCSCTTSHHHH-HHHHHHHTTCEEEEECTTCSEETTE-ECBSSGGGCSS-CCSEEEECSCHHH
T ss_pred             HHHHHHHHCCCEEEEECCCCCCCCCHHH-HHHHHHHCCCEEEEECCCCHHHCCC-CCCCCCCCCCC-CCCEEEEEECHHH
T ss_conf             9999998668949999115999982599-9999997899899989733300797-45664201467-6507999858899


Q ss_pred             CHHHHHHHHHCCCCEEEECCCCCCCCCC-----CCEEEECCCC
Q ss_conf             2345555541798279961544765556-----7256523788
Q gi|254780901|r  162 SYDALQYATNQGIDVIVIDHHQVKSEEI-----PAYALVNPNR  199 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIVtDHH~~~~~~p-----~a~aivNP~~  199 (600)
                      ..+.++.+.++|+..++.=-|-.+++.-     ...-+|-|+=
T Consensus        90 ~~~i~~e~~~~g~k~v~~~~~g~~e~~~~~a~~~gi~vvgp~c  132 (144)
T 2d59_A           90 TMEYVEQAIKKGAKVVWFQYNTYNREASKKADEAGLIIVANRC  132 (144)
T ss_dssp             HHHHHHHHHHHTCSEEEECTTCCCHHHHHHHHHTTCEEEESCC
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCEEECCCC
T ss_conf             9999999997299999994264499999999996998895683


No 72 
>>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} (A:1-142,A:271-284)
Probab=82.91  E-value=0.69  Score=26.36  Aligned_cols=76  Identities=16%  Similarity=0.194  Sum_probs=58.8

Q ss_pred             HHCCCCEEEEECCCCC-HHHHHHHHHHHHHHCCC-CEEEEECC--------CCCCCCCCCHHHHHHHHHCCCCEEEEECC
Q ss_conf             9779979999407886-15289999999997699-47998078--------74336688978988742026868999648
Q gi|254780901|r   89 IYNSEKIMIFGDYDVD-GAASVALMMRFLSHCSV-NANMYIPD--------RIVDGYGPNPSLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        89 i~~~ekI~I~gDyD~D-Gitstail~~~L~~~g~-~v~~~IP~--------R~~eGYGl~~~~i~~~~~~g~~LiItvD~  158 (600)
                      +..+..+.|..-+..+ -+....+|..+++..|+ .+...+|-        |+.+|=-++...+.++.+.|++-+||+|-
T Consensus        45 v~g~~V~ii~s~~~~~d~l~eLlll~~alr~~ga~~i~lViPYl~YsRQDR~~~~ge~isak~~a~lls~g~d~vitvDl  124 (156)
T 1u9y_A           45 INDDEAVIINTQKNQNDAIVETILLCDALRDEGVKKITLVAPYLAYARQDKKFNPGEAISIRALAKIYSNIVDKLITINP  124 (156)
T ss_dssp             CCSSEEEEECCCSSHHHHHHHHHHHHHHHHTTTCCEEEEECSSCTTCSCSSCSSTTBCCHHHHHHHHHHHHCSEEEEESC
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCHHCCHHHHHHHHHHHHHHHCCCHHHCCCC
T ss_conf             78997999907887542378899999999985646632112223322146110220257789999999742560121076


Q ss_pred             CCCCHH
Q ss_conf             876234
Q gi|254780901|r  159 GSTSYD  164 (600)
Q Consensus       159 Gi~~~e  164 (600)
                      -+...+
T Consensus       125 Hs~~~~  130 (156)
T 1u9y_A          125 HETHIK  130 (156)
T ss_dssp             SCGGGG
T ss_pred             CHHEEE
T ss_conf             123012


No 73 
>>3g98_A Alanyl-tRNA synthetase; alpha and beta fold, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 1.85A {Aquifex aeolicus} (A:)
Probab=82.85  E-value=3.4  Score=21.01  Aligned_cols=100  Identities=15%  Similarity=0.112  Sum_probs=68.0

Q ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCEEEEEEECCCCEE-EEEEEC---CCCCCHHHHHHHHCCCCCCCCCCCC
Q ss_conf             434750262057858122222278998842010799886379837-999864---8986188888853033530115653
Q gi|254780901|r  365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRS---IEGFDIGKMVSFAVEEGILVKGGGH  440 (600)
Q Consensus       365 ~~~~~~ivv~~~~wh~GViGIVAsrL~e~y~kP~iv~s~~~dg~~-kGS~RS---i~g~~l~~~l~~~~~~~ll~~~GGH  440 (600)
                      ....++++..-++...-.+--+|.+|.+++..-++++.-..++.. ...+.|   ..+++..++++.+... +--++||-
T Consensus         6 i~~~~~i~~~~~~~d~~~l~~la~~l~~~~~~~vv~l~~~~~~k~~~~~~vs~~~~~~i~a~~lik~~~~~-~gGkGGGk   84 (111)
T 3g98_A            6 VGDFTLHYGVFEEVEPEELRNLADMLRQRTKKDVVFIASRKGDKINFVIGVSKEISDKVNAKEVIREVGKV-LKGGGGGR   84 (111)
T ss_dssp             ETTEEEEEEEEESCCHHHHHHHHHHHTTSSSSEEEEEEEEETTEEEEEEEECGGGTTTSCHHHHHHHHHHH-TTBCCEEC
T ss_pred             ECCEEEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCEEEEEECCCCCCCCHHHHHHHHHHHH-HCCCCCCC
T ss_conf             88999999996699999999999999841578559999531676369999646651412399999999998-19765589


Q ss_pred             CCCC-CEEECCCCHHHHHHHHHHHHH
Q ss_conf             2223-146422215889999999998
Q gi|254780901|r  441 AMAA-GLTVERVNFGRLCDFFQKFAH  465 (600)
Q Consensus       441 ~~Aa-G~ti~~~~l~~f~~~l~~~~~  465 (600)
                      +.-| |-.-..++++++.+.+.+++.
T Consensus        85 ~~~AQggg~~~~~l~~~l~~~~~~l~  110 (111)
T 3g98_A           85 ADLAQGGGKAPDKFPEAVKLLKEILS  110 (111)
T ss_dssp             SSEEEEEESCGGGHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             40013389987889999999999836


No 74 
>>2o55_A Putative glycerophosphodiester phosphodiesterase; beta barrel, structural genomics, protein structure initiative, PSI-2; 2.81A {Galdieria sulphuraria} (A:)
Probab=82.36  E-value=1.9  Score=22.86  Aligned_cols=28  Identities=18%  Similarity=0.236  Sum_probs=18.8

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             6234555554179827996154476555
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      ++.+++..|.+.|.|+|=+|=|.-.+..
T Consensus        24 NT~~a~~~A~~~Ga~~iE~DV~~TkDg~   51 (258)
T 2o55_A           24 NTLRSFVLCXERNIPYIETDLRVCKTGE   51 (258)
T ss_dssp             TCHHHHHHHHHTTCCEEEEEEEECTTSC
T ss_pred             CHHHHHHHHHHCCCCEEEEEEEEECCCC
T ss_conf             2899999999859899998779911898


No 75 
>>3knz_A Putative sugar binding protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.50A {Salmonella enterica subsp} (A:34-182)
Probab=81.94  E-value=3.6  Score=20.77  Aligned_cols=105  Identities=13%  Similarity=0.061  Sum_probs=57.2

Q ss_pred             HHHHHHHH--HCCCCEEEEECCCCCHHHHHHHH--HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEC
Q ss_conf             99999999--77997999940788615289999--999997699479980787433668897898874202686899964
Q gi|254780901|r   82 ARRIVQAI--YNSEKIMIFGDYDVDGAASVALM--MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD  157 (600)
Q Consensus        82 ~~ri~~ai--~~~ekI~I~gDyD~DGitstail--~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD  157 (600)
                      .+++.+.+  .+.++|.++|   + |.+..+-.  ...|..+|..+..+-+.-     -.. .....+.+  -+|+|.+.
T Consensus         5 i~~~v~~l~~~~a~~I~~~G---~-G~S~~~a~~~~~~l~~~g~~~~~~~~~~-----~~~-~~~~~~~~--~dlvI~iS   72 (149)
T 3knz_A            5 LWRAAQALTERGVTRIILTG---S-GTSYHGALTARTFXQRWCALPVDVCWPF-----XLD-DETLARSG--KALVVGIS   72 (149)
T ss_dssp             HHHHHHHHHHTTCCEEEEEC---C-HHHHHHHHHHHHHHHHHHTSCEEEECGG-----GCC-HHHHHHSC--SEEEEEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEE---E-CHHHHHHHHHHHHHHHHHCCCEEEECHH-----HHC-CCCCCCCC--CEEEEEEE
T ss_conf             99999999867999899999---5-0799999999999999839987995577-----840-77778999--81899993


Q ss_pred             -CCCCC--HHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCCC
Q ss_conf             -88762--3455555417982799-615447655567256523788
Q gi|254780901|r  158 -CGSTS--YDALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPNR  199 (600)
Q Consensus       158 -~Gi~~--~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~~  199 (600)
                       .|-+.  .+.++.|+++|+.+|. |+....+-. .-++.++....
T Consensus        73 ~sg~t~~~~~~~~~ak~~g~~~i~iT~~~~s~l~-~~ad~~i~~~~  117 (149)
T 3knz_A           73 QGGGSLSTLAAXERARNVGHITASXAGVAPATID-RAADYILTVPC  117 (149)
T ss_dssp             SSSCCHHHHHHHHHHHHTTCEEEEEESSSSCGGG-GGCSEECCCCC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHH-HCCCCHHCCCC
T ss_conf             8938889999998766520220257887862766-30450011443


No 76 
>>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-diaminopimelate ligase; structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis MC58} (A:1-105)
Probab=81.88  E-value=3.6  Score=20.76  Aligned_cols=83  Identities=12%  Similarity=0.111  Sum_probs=48.4

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC----C--CCCCCCCCHH---HHHHHHHCCCCEEEEECCCC
Q ss_conf             7799799994078861528999999999769947998078----7--4336688978---98874202686899964887
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD----R--IVDGYGPNPS---LMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~----R--~~eGYGl~~~---~i~~~~~~g~~LiItvD~Gi  160 (600)
                      .++++|+|+|    =|.|+-+-+.++|...|++|..+=-+    +  .-+.+|....   ..+.+...+++++|+ -.|+
T Consensus         2 ~~~k~v~viG----~G~sG~salA~~L~~~G~~V~~~D~~~~~~~~~~L~~~gi~~~~g~~~~~~~~~~~d~vV~-SPgi   76 (105)
T 3eag_A            2 NAXKHIHIIG----IGGTFXGGLAAIAKEAGFEVSGCDAKXYPPXSTQLEALGIDVYEGFDAAQLDEFKADVYVI-GNVA   76 (105)
T ss_dssp             -CCCEEEEES----CCSHHHHHHHHHHHHTTCEEEEEESSCCTTHHHHHHHTTCEEEESCCGGGGGSCCCSEEEE-CTTC
T ss_pred             CCCCEEEEEE----ECHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHCCCEEECCCCHHHCCCCCCCEEEE-EEEC
T ss_conf             9777899998----5789999999999978993999979999578999997889998788978846655642223-3201


Q ss_pred             C-CHHHHHHHHHCCCCEE
Q ss_conf             6-2345555541798279
Q gi|254780901|r  161 T-SYDALQYATNQGIDVI  177 (600)
Q Consensus       161 ~-~~e~i~~a~~~GidvI  177 (600)
                      . +++.+..|+++|+.++
T Consensus        77 ~~~~p~l~~A~~~gi~I~   94 (105)
T 3eag_A           77 KRGXDVVEAILNLGLPYI   94 (105)
T ss_dssp             CTTCHHHHHHHHTTCCEE
T ss_pred             CCCCHHHHHHHHCCEEEE
T ss_conf             322025677652332576


No 77 
>>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} (A:1-162,A:293-349)
Probab=81.88  E-value=3.6  Score=20.76  Aligned_cols=141  Identities=12%  Similarity=0.047  Sum_probs=82.9

Q ss_pred             HHHHHHHHCCCH-HHHHHHHHCC-CCHHHHHHHCCCCHHHCCCCHHHCCCHHHHHHHHHHHHH--CCCCEEEEECCCCCH
Q ss_conf             999998819999-9999999678-897898866196677718995561487999999999997--799799994078861
Q gi|254780901|r   30 ALAITQKHAIPD-IVARVLVNRN-VSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY--NSEKIMIFGDYDVDG  105 (600)
Q Consensus        30 ~~~l~~~~~~~~-~~a~iL~~Rg-i~~~~~~~fL~p~l~~l~~dP~~l~dm~~A~~ri~~ai~--~~ekI~I~gDyD~DG  105 (600)
                      ...+++..|+|. .++++|-+++ ++++..+.-+.-- ..+--.|          +...+++.  ....|.+.-+.-.+-
T Consensus         6 ikDIA~~aGVS~aTVSraLN~~~~Vs~~TrerV~~aa-~eLGY~p----------n~~ar~L~~~~s~~Igvi~~~~~n~   74 (219)
T 1jye_A            6 LYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAM-AELNYIP----------NRVAQQLAGKQSLLIGVATSSLALH   74 (219)
T ss_dssp             -------------------------------------------------------------------CEEEEEESCTTSH
T ss_pred             HHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHH-HHHCCCC----------CHHHHHHHCCCCEEEEEEECCCCCC
T ss_conf             9999999885999999996795999999999999999-9988987----------9888875117762899994477662


Q ss_pred             HHHHHH--HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             528999--999999769947998078743366889789887420268689996488762345555541798279961544
Q gi|254780901|r  106 AASVAL--MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       106 itstai--l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      ..+..+  +.+.++..|.++.++.-++..  +-.....++.+.+.+++=||..-.+....+.+..++..|+-+|+.|=..
T Consensus        75 f~~~ii~gi~~~a~~~Gy~l~i~~~~~~~--~e~~~~~ie~l~~~~vdGIIi~~~~~~~~~~~~~l~~~~iPvV~iD~~~  152 (219)
T 1jye_A           75 APSQIVAAILSRADQLGASVVVSMVERSG--VEACKTAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSD  152 (219)
T ss_dssp             HHHHHHHHHHHHHHHTTCEEEEEECCSSS--HHHHHHHHHHHHTTTCSCEEEESCCCHHHHHHHHHHTTTSCEEESSSCT
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCC--HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEECCC
T ss_conf             26788776666676507702441234322--7999999999996377763013664302567999850589668851467


No 78 
>>2zj3_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* (A:1-216)
Probab=81.56  E-value=3.7  Score=20.68  Aligned_cols=95  Identities=11%  Similarity=0.141  Sum_probs=53.6

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH-CC
Q ss_conf             561487999999999997799799994078861528--999999999769947998078743366889789887420-26
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN-EG  149 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~-~g  149 (600)
                      .....+++++++    +.+.++|.|||=    |.+.  +..+...|..+|..+.++.+..         ........ ..
T Consensus        45 l~~~~i~~~~~~----l~~a~rI~i~G~----G~S~~~a~~~~~~l~~~g~~~~~~~~~~---------~~~~~~~~~~~  107 (216)
T 2zj3_A           45 VNLGGLKDHIKE----IQRCRRLILIAC----GTSYHAGVATRQVLEELTELPVMVELAS---------DFLDRNTPVFR  107 (216)
T ss_dssp             ECCGGGTTTHHH----HHHCSEEEEEEC----HHHHHHHHHHHHHHHHHHCSCEEEEEHH---------HHHHTTCCCCT
T ss_pred             CCCCCHHHHHHH----HHCCCEEEEEEE----HHHHHHHHHHHHHHHHHCCCCEEEEEEE---------ECCCCCCCCCC
T ss_conf             103525567999----735997999996----0799999999999999659877998611---------00014677889


Q ss_pred             CCEEEEE-CCCCC--CHHHHHHHHHCCCCEEE-ECCCCC
Q ss_conf             8689996-48876--23455555417982799-615447
Q gi|254780901|r  150 AQLIITV-DCGST--SYDALQYATNQGIDVIV-IDHHQV  184 (600)
Q Consensus       150 ~~LiItv-D~Gi~--~~e~i~~a~~~GidvIV-tDHH~~  184 (600)
                      -+++|.+ -.|-+  -.+.++.|+++|+.+|. |+-...
T Consensus       108 ~dvvi~iS~sG~t~e~~~~~~~ak~~g~~~i~iT~~~~s  146 (216)
T 2zj3_A          108 DDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGS  146 (216)
T ss_dssp             TEEEEEEESSSCCHHHHHHHHHHHHTTCEEEEEESCTTC
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             877999966889778999999999879939999778998


No 79 
>>3e0f_A Putative metal-dependent phosphoesterase; YP_910028.1, structural genomics, joint center for structural genomics, JCSG; 2.40A {Bifidobacterium adolescentis ATCC15703} (A:1-95,A:177-301)
Probab=81.48  E-value=3.7  Score=20.66  Aligned_cols=58  Identities=16%  Similarity=0.236  Sum_probs=47.4

Q ss_pred             CCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC-HHH-HHHHHHCCCCEEE
Q ss_conf             947998078743366889789887420268689996488762-345-5555417982799
Q gi|254780901|r  121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS-YDA-LQYATNQGIDVIV  178 (600)
Q Consensus       121 ~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~-~e~-i~~a~~~GidvIV  178 (600)
                      ..+.+|+-.++++|.+--.+.++.+++.|.+.+...|.+.-. ..+ .+.+++.|+.+|+
T Consensus        13 ~~~dlH~HT~~Sdg~~~~~el~~~a~~~g~~~i~iTDH~~~~~~~~~~~~~~~~~i~~i~   72 (220)
T 3e0f_A           13 QGWDIHCHTVFSDGTETPRTLVEQARKLGLHGVAIADHDTTAGWDEATEASEEIGLPLLL   72 (220)
T ss_dssp             SSEEEEECCTTTTCSSCHHHHHHHHHHTTCSEEEEEEETCCTTHHHHHHHHHHHTCCEEE
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             881168284734898999999999998799999994899964499999999975996433


No 80 
>>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hyperthermostable protein; HET: DNA BOG; 1.50A {Thermus thermophilus} (A:410-664)
Probab=81.37  E-value=3.8  Score=20.63  Aligned_cols=78  Identities=9%  Similarity=0.026  Sum_probs=60.0

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             87999999999997799799994078861528999999999769947998078743366889789887420268689996
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      .....+..+.+-...++++.||    |.-+..+-.|+.+|...|..+.++-..- .  +.--...++++....++.||++
T Consensus        15 ~~~~ll~~i~~~~~~~~k~iIF----~~t~~~~~~l~~~L~~~g~~~~~~hg~~-~--~~~R~~i~~~F~~~~~~vLVaT   87 (255)
T 1c4o_A           15 QILDLMEGIRERAARGERTLVT----VLTVRMAEELTSFLVEHGIRARYLHHEL-D--AFKRQALIRDLRLGHYDCLVGI   87 (255)
T ss_dssp             HHHHHHHHHHHHHHTTCEEEEE----CSSHHHHHHHHHHHHHTTCCEEEECTTC-C--HHHHHHHHHHHHTTSCSEEEES
T ss_pred             CHHHHHHHHHHHHHCCCEEEEE----ECCCHHHHHHHHHHHHCCCCEEECCCCC-C--CHHHHHHHHHHHCCCEEEEEEE
T ss_conf             4689999999998459808999----5573069999999987798246426665-4--0356778877506863799853


Q ss_pred             CCCCC
Q ss_conf             48876
Q gi|254780901|r  157 DCGST  161 (600)
Q Consensus       157 D~Gi~  161 (600)
                      |.+..
T Consensus        88 ~~l~~   92 (255)
T 1c4o_A           88 NLLRE   92 (255)
T ss_dssp             CCCCT
T ss_pred             CCCCC
T ss_conf             14554


No 81 
>>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* (A:183-372)
Probab=81.20  E-value=3.8  Score=20.59  Aligned_cols=135  Identities=10%  Similarity=0.131  Sum_probs=77.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCC------C-CCC--CHHHHHHHHH
Q ss_conf             9999999999977997999940788615289999999997699479980787--433------6-688--9789887420
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVD------G-YGP--NPSLMEKFIN  147 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~e------G-YGl--~~~~i~~~~~  147 (600)
                      ..+++++.+.|.+-++.+|+.++.+.---+..-+..+.+.+|+-|...--.|  +.+      | ||.  +..+.+.+ +
T Consensus        10 ~~~i~~~~~~L~~A~rPvii~G~~~~~~~a~~~l~~lae~~~iPv~~t~~~kg~~~~~hp~~~G~~g~~~~~~~~~~l-~   88 (190)
T 2pgn_A           10 NEDVREAAAQLVAAKNPVILAGGGVARSGGSEALLKLAEMVGVPVVTTSTGAGVFPETHALAMGSAGFCGWKSANDMM-A   88 (190)
T ss_dssp             HHHHHHHHHHHHHCSSEEEEECHHHHHHTCHHHHHHHHHHHTCCEEECTTTTTSSCTTSTTEEEECSTTSCHHHHHHH-H
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCEEEECCCCCCCCCCHHHHCCCCCCCCCCHHHHHHH-H
T ss_conf             899999876530234333345653123443899999999829747623557865541333022456765514566665-4


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             26868999648876234555554179827996154476555672565237888864334430478899999999999702
Q gi|254780901|r  148 EGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR  227 (600)
Q Consensus       148 ~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~  227 (600)
                      + ++|||.+.|..+....-......+.++|.+|              +||...+..+ +.+++=.|-+=.++.+|.+.+.
T Consensus        89 ~-aDlil~iG~~~~~~~~~~~~~~~~~~~i~i~--------------~d~~~l~~~~-~~~~~i~gd~~~~l~~L~~~l~  152 (190)
T 2pgn_A           89 A-ADFVLVLGSRLSDWGIAQGYITKMPKFVHVD--------------TDPAVLGTFY-FPLLSVVADAKTFMEQLIEVLP  152 (190)
T ss_dssp             H-CSEEEEESCCCCTTTTTTTTTCCCCSEEEEE--------------SCGGGTTSSS-CCSEEEECCHHHHHHHHHHHGG
T ss_pred             H-CCCCCCCCCCCCCCCCCCCCCCCCCCEEECC--------------CCHHHCCCCC-CCCEEEHHHHHHHHHHHHHHHH
T ss_conf             0-2220013443344553001123564212103--------------6812227765-6500110447999999999613


Q ss_pred             CCC
Q ss_conf             148
Q gi|254780901|r  228 QDN  230 (600)
Q Consensus       228 ~~~  230 (600)
                      ...
T Consensus       153 ~~~  155 (190)
T 2pgn_A          153 GTS  155 (190)
T ss_dssp             GST
T ss_pred             CCC
T ss_conf             145


No 82 
>>2q5c_A NTRC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} (A:79-168)
Probab=80.84  E-value=3.9  Score=20.50  Aligned_cols=82  Identities=12%  Similarity=0.125  Sum_probs=57.1

Q ss_pred             HHHHHHHHHCCCCEEEEECCCC-CHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             9999999977997999940788-615289999999997699479980787433668897898874202686899964887
Q gi|254780901|r   82 ARRIVQAIYNSEKIMIFGDYDV-DGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        82 ~~ri~~ai~~~ekI~I~gDyD~-DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      ..-+.+|.+.+.||.|.|-... .|+..-      =..++.++..|.-+...|    -.+.+++++++|++.+|    | 
T Consensus         6 l~al~~a~~~~~kiaivgf~~~~~~~~~~------~~ll~~~i~~~~~~~~~e----~~~~i~~l~~~G~~vVI----G-   70 (90)
T 2q5c_A            6 MRAVYNAKRFGNELALIAYKHSIVDKHEI------EAMLGVKIKEFLFSSEDE----ITTLISKVKTENIKIVV----S-   70 (90)
T ss_dssp             HHHHHHHGGGCSEEEEEEESSCSSCHHHH------HHHHTCEEEEEEECSGGG----HHHHHHHHHHTTCCEEE----E-
T ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHHH------HHHHCCCEEEEEECCHHH----HHHHHHHHHHCCCCEEE----C-
T ss_conf             99999998628978999578613689999------999599459999658899----99999999986997999----9-


Q ss_pred             CCHHHHHHHHHCCCCEEEE
Q ss_conf             6234555554179827996
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVI  179 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVt  179 (600)
                       +.-..+.|++.|+.-|.+
T Consensus        71 -~~~~~~~A~~~Gl~~vli   88 (90)
T 2q5c_A           71 -GKTVTDEAIKQGLYGETI   88 (90)
T ss_dssp             -CHHHHHHHHHTTCEEEEC
T ss_pred             -CHHHHHHHHHCCCCEEEE
T ss_conf             -879999999849968999


No 83 
>>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreductase, porphyrin biosynthesis; 2.30A {Bacillus megaterium} (A:1-126)
Probab=80.61  E-value=2.7  Score=21.69  Aligned_cols=86  Identities=6%  Similarity=-0.009  Sum_probs=50.8

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC------CCCCCCHHHHH--HHHHCCCCEEEEECCCCCC
Q ss_conf             799799994078861528999999999769947998078743------36688978988--7420268689996488762
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV------DGYGPNPSLME--KFINEGAQLIITVDCGSTS  162 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~------eGYGl~~~~i~--~~~~~g~~LiItvD~Gi~~  162 (600)
                      ++.+|+|.|    -|-+ +..+.+.|...|+++...-|+...      +.+|.......  +..-.+++++|++=..-..
T Consensus        30 ~~k~vlIiG----~G~~-G~~~a~~L~~~g~~v~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~adivi~~t~~~~~  104 (126)
T 3dfz_A           30 KGRSVLVVG----GGTI-ATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFFIVVATNDQAV  104 (126)
T ss_dssp             TTCCEEEEC----CSHH-HHHHHHHHGGGCCCEEEECSSCCHHHHHHHHTTSCEEECSCCCGGGSSSCSEEEECCCCTHH
T ss_pred             CCCEEEEEC----CCHH-HHHHHHHHHHCCCEEEEEECCCCHHHHHHHHCCCCEEEECCCCHHHHCCCEEEEECCCCHHH
T ss_conf             988599989----9899-99999999638998999928899899999976983898256895572896099977898899


Q ss_pred             HHHHHHHHHCCCCEEEECC
Q ss_conf             3455555417982799615
Q gi|254780901|r  163 YDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       163 ~e~i~~a~~~GidvIVtDH  181 (600)
                      ...+..+++.|+-|.+.|+
T Consensus       105 ~~~~~~~~~~~~~v~~v~~  123 (126)
T 3dfz_A          105 NKFVKQHIKNDQLVNMASS  123 (126)
T ss_dssp             HHHHHHHSCTTCEEEC---
T ss_pred             HHHHHHHHHHCCCCEECCC
T ss_conf             9999999876688246798


No 84 
>>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} (A:174-332)
Probab=80.27  E-value=4.1  Score=20.36  Aligned_cols=78  Identities=21%  Similarity=0.246  Sum_probs=55.3

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH----CCCCEEEEECCCCCCHHHH
Q ss_conf             799799994078861528999999999769947998078743366889789887420----2686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN----EGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~----~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++.+|++.||  .-+=++.+ +..++..+|.++...-|.    +|.+....++.+.+    .|.++.+|-|     .++ 
T Consensus         2 ~glkia~vGD--~~~rv~~S-l~~~~~~~g~~~~l~~P~----~~~~~~~~~~~~~~~~~~~g~~i~~~~d-----~~e-   68 (159)
T 2w37_A            2 QGLTLTFMGD--GRNNVANS-LLVTGAILGVNIHIVAPK----ALFPTEETQNIAKGFAEKSGAKLVITDD-----LDE-   68 (159)
T ss_dssp             TTCEEEEESC--TTSHHHHH-HHHHHHHHTCEEEEECCG----GGSCCHHHHHHHHHHHHHHTCCEEEESC-----HHH-
T ss_pred             CCCCEEEECC--CCCCCCCH-HHHHHHHCCCEEEEECCC----CCCCCHHHHHHHHHHHHCCCCEEEEEEC-----HHH-
T ss_conf             4444022036--76565423-999986369889982342----3378589988876655337986999838-----999-


Q ss_pred             HHHHHCCCCEEEECCCCC
Q ss_conf             555417982799615447
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~  184 (600)
                         .-.|.|||+||--..
T Consensus        69 ---a~~~aDviyt~~w~~   83 (159)
T 2w37_A           69 ---GLKGSNVVYTDVWVS   83 (159)
T ss_dssp             ---HHTTCSEEEECCSCC
T ss_pred             ---HHCCCCEEEECCEEE
T ss_conf             ---965799999745540


No 85 
>>3cf4_G Acetyl-COA decarbonylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductase; 2.00A {Methanosarcina barkeri} (G:)
Probab=80.05  E-value=3.5  Score=20.91  Aligned_cols=102  Identities=11%  Similarity=0.053  Sum_probs=60.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE------ECCCCCCCCCCCHHH-----------H
Q ss_conf             99999999997799799994078861528999999999769947998------078743366889789-----------8
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY------IPDRIVDGYGPNPSL-----------M  142 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~------IP~R~~eGYGl~~~~-----------i  142 (600)
                      .+++++.++|++-++.+|+.++-+.---+..-+.++.+.+|+.|...      +|+.-.--+|.....           .
T Consensus        22 ~~i~~~~~~L~~AkrPvii~G~~~~~~~~~~~l~~lae~~g~Pv~~t~~gkg~~~~~hp~~~g~~~g~~g~~G~~~~~~~  101 (170)
T 3cf4_G           22 VSPEMAAKIISKAKRPLLMVGTLALDPELLDRVVKISKAANIPIAATGSSLAVLADKDVDAKYINAHMLGFYLTDPKWPG  101 (170)
T ss_dssp             CCHHHHHHHHHHCSSEEEEECSTTCCHHHHHHHHHHHHHHTCCEEECTTTHHHHTTSSSCEEECCHHHHHHHTTCTTCCC
T ss_pred             CCHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEECHHHCCCCCCCCCHHCCCCCCCCCCCCCHHHHHH
T ss_conf             69999999999669988996888643268999999999849788987222676776682111645222465221027888


Q ss_pred             HHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             8742026868999648876234555554179827996154
Q gi|254780901|r  143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       143 ~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH  182 (600)
                      .++ -+.++|||.+.+-.+...-.-+.....-++|++|-|
T Consensus       102 ~~~-~~~aDlii~iG~~~~~~~t~~~~~~~~~~~i~Id~d  140 (170)
T 3cf4_G          102 LDG-NGNYDMIITIGFKKFYINQVLSAAKNFSNLKTIAIE  140 (170)
T ss_dssp             SSS-SCCCSEEEEESCCHHHHHHHHHHHHHHCCCCEEECS
T ss_pred             HHH-HCCCCEEEEECCCCCCCCCCCCCCCCCCCEEEEEEC
T ss_conf             853-346788999577004214120233466770799828


No 86 
>>3jx9_A Putative phosphoheptose isomerase; YP_001815198.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.95A {Exiguobacterium sibiricum 255-15} (A:20-131)
Probab=79.94  E-value=3.7  Score=20.63  Aligned_cols=95  Identities=16%  Similarity=0.090  Sum_probs=57.2

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             87999999999997799799994078861528999999999769947998078743366889789887420268689996
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      +++.|+.+|.||+-..-+|-|||.-+.+|+..-|+       .|.+-..-. .|+.+        ...+-+..--||++.
T Consensus         4 ~iEdaARlLAQAivgeG~VYi~G~~Em~~v~~eAl-------~g~E~l~~~-k~l~~--------~~elt~tDRVLlfs~   67 (112)
T 3jx9_A            4 ELFDVVRLLAQALVGQGKVYLDAYGEFEGLYPXLS-------DGPDQXKRV-TKIKD--------HKTLHAVDRVLIFTP   67 (112)
T ss_dssp             HHHHHHHHHHHHHHTTCCEEEEECGGGGGGTHHHH-------TSTTCCTTE-EECCT--------TCCCCTTCEEEEEES
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH-------CCCCCCCCC-CCCCC--------CCCCCCCCEEEEECC
T ss_conf             78999999999872697799961657999999997-------287656533-34887--------565775687999759


Q ss_pred             CCCCCCHHHH---HHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             4887623455---55541798279961544765556
Q gi|254780901|r  157 DCGSTSYDAL---QYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       157 D~Gi~~~e~i---~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      ++  ++.+++   +.+.+.|++++++--..-.++.|
T Consensus        68 fs--~dee~~~~ak~L~e~gi~~v~vs~~~~~~~~~  101 (112)
T 3jx9_A           68 DT--ERSDLLASLARYDAWHTPYSIITLGDVTETLE  101 (112)
T ss_dssp             CS--CCHHHHHHHHHHHHHTCCEEEEESSCCCTTGG
T ss_pred             CC--CHHHHHHHHHHHHCCCCEEEEECCCCCCCCHH
T ss_conf             97--63899999999636876599963687788504


No 87 
>>2wv9_A Flavivirin protease NS2B regulatory subunit, flavivirin protease NS3 catalytic subunit...; NS2B-NS3 protease; 2.75A {Murray valley encephalitis virus} (A:378-536)
Probab=79.86  E-value=4.2  Score=20.27  Aligned_cols=63  Identities=14%  Similarity=0.057  Sum_probs=51.6

Q ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECC
Q ss_conf             99999779979999407886152899999999976994799807874336688978988742026868999648
Q gi|254780901|r   85 IVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        85 i~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~  158 (600)
                      +....+.+.+++||    |.....+--|++.|+..|.++.++-..       +....++++.+...+.||+.|.
T Consensus        26 ~~~~~~~~~~~lIF----~~t~~~~~~l~~~L~~~g~~~~~lh~~-------~~~~~~~~~~~g~~~ilvaT~~   88 (159)
T 2wv9_A           26 FEWITDYAGKTVWF----VASVKMSNEIAQCLQRAGKRVIQLNRK-------SYDTEYPKCKNGDWDFVITTDI   88 (159)
T ss_dssp             CHHHHSCCSCEEEE----CSSHHHHHHHHHHHHTTTCCEEEECSS-------SHHHHGGGGGTCCCSEEEECGG
T ss_pred             HHHHHHCCCCEEEE----ECCHHHHHHHHHHHHHCCCCEEEECCC-------CCHHHHHHCCCCCEEEEEECCH
T ss_conf             99997379999999----599999999999998689819997798-------9777673366897369996234


No 88 
>>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} (A:58-160,A:293-340)
Probab=79.65  E-value=4.2  Score=20.22  Aligned_cols=74  Identities=5%  Similarity=-0.027  Sum_probs=52.7

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             99999976994799807874336688978988742026868999648876234555554179827996154476555
Q gi|254780901|r  112 MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       112 l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      +.+.++..|..+.++--+.-.|   .-...++.+.+.+++-+|.+-...++.+....+.+.||-|+++|-.......
T Consensus        23 i~~~a~~~g~~l~i~~~~~~~e---~~~~~i~~l~~~~vDGIIi~~~~~~~~~~~~~l~~~~IPvV~id~~~~~~~~   96 (151)
T 1qpz_A           23 VEKNCFQKGYTLILGNAWNNLE---KQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADF   96 (151)
T ss_dssp             HHHHHHHTTCEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEECCSCCCHHHHHHHHTTTTSCEEEEEESSCCCSS
T ss_pred             HHHHHHHCCCEEEEECCCCCHH---HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             9999874895899941554448---9999999998548874898146787277888876148877983367666777


No 89 
>>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding protein, alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} (A:1-121,A:264-350)
Probab=79.60  E-value=4.2  Score=20.21  Aligned_cols=107  Identities=6%  Similarity=0.055  Sum_probs=67.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHC--CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             289999999997699479980787433668897898874202--686899964887623455555417982799615447
Q gi|254780901|r  107 ASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE--GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       107 tstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~--g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      +-..-+-++.+.+|.++.+.-+++-.+   ...+.++.+...  +++.||.+-...+..+.++.|.+.||.||..|--.+
T Consensus        21 ~v~~gie~aA~~~G~~l~v~~s~~d~~---~q~~~ie~lia~~~~vD~Iii~p~~~~~~~~i~~a~~~gIPVV~ids~l~   97 (208)
T 3h75_A           21 SYSQFXQAAARDLGLDLRILYAERDPQ---NTLQQARELFQGRDKPDYLXLVNEQYVAPQILRLSQGSGIKLFIVNSPLT   97 (208)
T ss_dssp             HHHHHHHHHHHHHTCEEEEEECTTCHH---HHHHHHHHHHHSSSCCSEEEEECCSSHHHHHHHHHTTSCCEEEEEESCCC
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHCCCEEEEECCCCC
T ss_conf             999999999997399899994899999---99999999984799869999778420369999999977994999266556


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             65556725652378888643344304788999999
Q gi|254780901|r  185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVL  219 (600)
Q Consensus       185 ~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~  219 (600)
                      +...  ++.-.+....+.. --+.|+--.=||-++
T Consensus        98 ~~~~--~~Vg~Dn~~~G~~-aa~~L~~~~g~w~~v  129 (208)
T 3h75_A           98 LDQR--ELIGQSRQNYSDW-IGSXVGDTLGGWALV  129 (208)
T ss_dssp             TTTC--------------C-EEEEECCGHHHHHHH
T ss_pred             CCCC--CCCCCCCCCCCCC-CCEEECCHHHHHHHH
T ss_conf             5310--0001354346764-112536799999999


No 90 
>>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} (A:187-356)
Probab=78.93  E-value=4.4  Score=20.06  Aligned_cols=87  Identities=9%  Similarity=0.066  Sum_probs=60.3

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE------ECCCC---CCCCCCC------HH
Q ss_conf             487999999999997799799994078861528999999999769947998------07874---3366889------78
Q gi|254780901|r   76 TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY------IPDRI---VDGYGPN------PS  140 (600)
Q Consensus        76 ~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~------IP~R~---~eGYGl~------~~  140 (600)
                      .--+.+++++.+.|.+.++.+|+.+..+....+..-+.++...+|+.+...      +|.+.   .-.||+.      ..
T Consensus        14 ~~~~~~i~~~~~~L~~A~rPvii~G~~~~~~~a~~~l~~lae~~~~pv~~t~~~kg~~~~~~p~~~G~~~~~~~G~~~~~   93 (170)
T 2iht_A           14 DGWQKAADQAAALLAEAKHPVLVVGAAAIRSGAVPAIRALAERLNIPVITTYIAKGVLPVGHELNYGAVTGYXDGILNFP   93 (170)
T ss_dssp             TTHHHHHHHHHHHHHHCSSEEEEECHHHHHTTCHHHHHHHHHHHTCCEEECSTTTTSSCTTCTTEEEECCTTHHHHHTSC
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCCCCH
T ss_conf             00056789999999856465201321223432379999999997989897314665435785245544333011332247


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             98874202686899964887623
Q gi|254780901|r  141 LMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus       141 ~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      ...++.+ .+||||.+.+-.+..
T Consensus        94 ~~~~~l~-~aDlil~iG~~~~~~  115 (170)
T 2iht_A           94 ALQTXFA-PVDLVLTVGYDYAED  115 (170)
T ss_dssp             HHHHHHT-TCCEEEEETCCGGGC
T ss_pred             HHHHHHC-CCCCEEEECCCCCCC
T ss_conf             8998734-434300002453124


No 91 
>>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* (A:186-350)
Probab=78.68  E-value=4.5  Score=20.01  Aligned_cols=138  Identities=11%  Similarity=0.101  Sum_probs=81.8

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCC------C-CC--CCHHHHHHH
Q ss_conf             879999999999977997999940788615289999999997699479980787--433------6-68--897898874
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVD------G-YG--PNPSLMEKF  145 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~e------G-YG--l~~~~i~~~  145 (600)
                      .-+.+++++.+.+.+-++.+|+.++.+...-+...+.++...+|+-|....-.|  +.|      | |+  .+...+.++
T Consensus        11 ~~~~~i~~~~~~L~~A~rPvi~~G~~~~~~~a~~~l~~lae~~~~pv~~t~~~kg~~~~~~p~~~G~~~g~~~~~~~~~~   90 (165)
T 2vk8_A           11 SEKEVIDTILVLDKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEA   90 (165)
T ss_dssp             HHHHHHHHHHHHHHHCSSEEEEECHHHHHTTCHHHHHHHHHHHCCCEEECTTTTTSSCTTSTTEEEECCGGGSCHHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             66999999999987456985024886430249999999998648981214100356777882225755556541899999


Q ss_pred             HHCCCCEEEEECCCCCCHHHHHHHH-HCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             2026868999648876234555554-179827996154476555672565237888864334430478899999999999
Q gi|254780901|r  146 INEGAQLIITVDCGSTSYDALQYAT-NQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYR  224 (600)
Q Consensus       146 ~~~g~~LiItvD~Gi~~~e~i~~a~-~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~  224 (600)
                      .++ ++|||.+.+-.+...--.+.. ...-.+|.+|..              |...+..+ +.++.=+|-.-.++.+|.+
T Consensus        91 l~~-aDlvl~iG~~~~~~~~~~~~~~~~~~~~I~i~~d--------------~~~~~~~~-~~~~~i~~d~~~~l~~L~~  154 (165)
T 2vk8_A           91 VES-ADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSD--------------HMKIRNAT-FPGVQMKFVLQKLLTTIAD  154 (165)
T ss_dssp             HHT-CSEEEEESCCCCTTTTTTTCCCCCCSCEEEECSS--------------EEEETTEE-EETCCHHHHHHHHHHHHHH
T ss_pred             HHC-CCCEEEEEEECCCCCCCCCCCCCCCCEEEEECCC--------------HHHHCCCC-CCCEEEHHHHHHHHHHHHH
T ss_conf             855-6745999851355346876656775448774350--------------87646765-6636627689999999887


Q ss_pred             HHCCCC
Q ss_conf             702148
Q gi|254780901|r  225 ILRQDN  230 (600)
Q Consensus       225 ~l~~~~  230 (600)
                      .+....
T Consensus       155 ~l~~~~  160 (165)
T 2vk8_A          155 AAKGYK  160 (165)
T ss_dssp             HTTTCC
T ss_pred             HHHHHH
T ss_conf             652103


No 92 
>>3dlj_A Beta-Ala-His dipeptidase; CNDP1, carnosine dipeptidase 1, structural genomics, structural genomics consortium, SGC, metallopeptidase M20 family; 2.26A {Homo sapiens} (A:1-210,A:429-485)
Probab=78.60  E-value=4.5  Score=19.99  Aligned_cols=123  Identities=16%  Similarity=0.203  Sum_probs=66.3

Q ss_pred             HHHHCC-CCHHHCCCCHHHCCCHHHHHHHHHHHHHC------------------------------------CCCEEEEE
Q ss_conf             886619-66777189955614879999999999977------------------------------------99799994
Q gi|254780901|r   57 AKDFLN-PSIRLLMPDPLILTDCDKAARRIVQAIYN------------------------------------SEKIMIFG   99 (600)
Q Consensus        57 ~~~fL~-p~l~~l~~dP~~l~dm~~A~~ri~~ai~~------------------------------------~ekI~I~g   99 (600)
                      ..++++ |+.+.. .+|..-.++.++++++.+.+++                                    +..|++||
T Consensus        31 l~~lv~ipSvS~~-~~~~~~~~~~~~a~~l~~~l~~lG~~~~~~~~~~~~~~~~~~~~~~~~v~a~~~~~~~~~til~~~  109 (267)
T 3dlj_A           31 LKEWVAIESDSVQ-PVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYG  109 (267)
T ss_dssp             HHHHHTSCCBSSS-CCHHHHHHHHHHHHHHHHHHHHTTCEEEEECCCEEEC--CCEEECCCEEEEEECCCTTSCEEEEEE
T ss_pred             HHHHHCCCCCCCC-CCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCCCCCEEEEEE
T ss_conf             9999578888999-865323899999999999999769959998156654566766788857999967899888799981


Q ss_pred             CCCCC-------------------------H----HHHHHHHHH---HHHHCC----CCEEEEECCCCCCCCCCC-HHHH
Q ss_conf             07886-------------------------1----528999999---999769----947998078743366889-7898
Q gi|254780901|r  100 DYDVD-------------------------G----AASVALMMR---FLSHCS----VNANMYIPDRIVDGYGPN-PSLM  142 (600)
Q Consensus       100 DyD~D-------------------------G----itstail~~---~L~~~g----~~v~~~IP~R~~eGYGl~-~~~i  142 (600)
                      +||+=                         |    -...+.+..   +|+..+    .+|.+.+-. -+|.-... ...+
T Consensus       110 H~Dvvp~~~~~~w~~~pf~~~~~d~~l~grGa~Ddkggv~~~l~a~~~l~~~~~~l~~~I~~~~~~-~EE~Gs~g~~~~~  188 (267)
T 3dlj_A          110 HLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEG-MEEAGSVALEELV  188 (267)
T ss_dssp             ECCBCCCCGGGTCSSCTTSCEEETTEEESTTTTTTHHHHHHHHHHHHHHHHTTCCCSSEEEEEEES-CGGGTTTTHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEECCC-CCCHHHHHHHHHH
T ss_conf             356258887434467876037789989702402466208999899998775421478642540244-3102555699999


Q ss_pred             HHHHHC---CCCEEEEECCCCCCHHHHH-HHHHCCCCEEEECCC
Q ss_conf             874202---6868999648876234555-554179827996154
Q gi|254780901|r  143 EKFINE---GAQLIITVDCGSTSYDALQ-YATNQGIDVIVIDHH  182 (600)
Q Consensus       143 ~~~~~~---g~~LiItvD~Gi~~~e~i~-~a~~~GidvIVtDHH  182 (600)
                      ++..+.   .++.+|.+|.|- -..-+. .-+.+|++++++-=-
T Consensus       189 ~~~~~~~~~~~d~~i~~D~~~-~ip~~~~~~~~l~~~~~~~~~~  231 (267)
T 3dlj_A          189 EKEKDRFFSGVDYIVISDNLW-IIPIAKMFQEIVHKSVVLIPLG  231 (267)
T ss_dssp             HHHTTTTSTTCCEEEECCCBC-CCHHHHHHHHHTC--CEECCCB
T ss_pred             HHHHHHCCCCCCEEEECCCCC-CHHHHHHHHHHHCCCEEEEECC
T ss_conf             997876567655136405764-5667999999849698998078


No 93 
>>1nri_A Hypothetical protein HI0754; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Haemophilus influenzae} (A:1-233)
Probab=78.38  E-value=4.6  Score=19.94  Aligned_cols=148  Identities=18%  Similarity=0.136  Sum_probs=69.0

Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH---HHHHHHHHHHCCCCEE--EEEC--CCCC-CCCCCCHHH-----
Q ss_conf             1487999999999997799799994078861528---9999999997699479--9807--8743-366889789-----
Q gi|254780901|r   75 LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAAS---VALMMRFLSHCSVNAN--MYIP--DRIV-DGYGPNPSL-----  141 (600)
Q Consensus        75 l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGits---tail~~~L~~~g~~v~--~~IP--~R~~-eGYGl~~~~-----  141 (600)
                      +...++.++++.+.|.+.++|.|+|-    |.++   -.+-+++.+..+.++.  ..+.  ..+. --+|.+...     
T Consensus        54 ~~~~~~~~~~~~~~i~~a~~I~i~G~----G~S~~~A~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~g~~~~~~~~~~  129 (233)
T 1nri_A           54 LPQISLAVEQIVQAFQQGGRLIYIGA----GTSGRLGVLDASECPPTFGVSTEXVKGIIAGGECAIRHPVEGAEDNTKAV  129 (233)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCEEEEES----HHHHHHHHHHHHHHHHHHCCCTTSEEEEETTCTHHHHSCCTTGGGCTTHH
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEC----CHHHHHHHHHHHHHCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCHHHH
T ss_conf             99999999999999973997999817----65699999999986486788821106877169878766544013548889


Q ss_pred             --HHHHHH-CCCCEEEEECC-CCC--CHHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCCCC-CC--CCC-CCCHH
Q ss_conf             --887420-26868999648-876--23455555417982799-6154476555672565237888-86--433-44304
Q gi|254780901|r  142 --MEKFIN-EGAQLIITVDC-GST--SYDALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPNRL-DD--LSG-QGHLC  210 (600)
Q Consensus       142 --i~~~~~-~g~~LiItvD~-Gi~--~~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~~~-~~--~~p-~~~l~  210 (600)
                        ...... ..-+++|.+-. |-+  -.+.++.|+++|+.||. ||....+-..-..+.+.-|--. ..  ..+ ....|
T Consensus       130 ~~~~~~~~~~~~dlvI~iS~sG~t~~~~~~~~~ak~~g~~vI~IT~~~~s~l~~~ad~~l~~~~~~e~~~~~~~~~s~~a  209 (233)
T 1nri_A          130 LNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLGALTISIASNPKSEXAEIADIAIETIVGPEILTGSSRLKSGTA  209 (233)
T ss_dssp             HHHHHHTTCCTTSEEEEECTTSCCHHHHHHHHHHHHHTCEEEEEESSTTCHHHHHSSEEEECCCCSCSSTTCTTTHHHHH
T ss_pred             HHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHCCEEEECCCCCCCCCCCCCCHHHHH
T ss_conf             99999834898884899868999777898999987516625666348874356858988868988777777747599999


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             7889999999999970
Q gi|254780901|r  211 AAGVVFLVLVLIYRIL  226 (600)
Q Consensus       211 gaGvaf~l~~al~~~l  226 (600)
                      ..-+.-.++.++....
T Consensus       210 ~~~lld~l~~~~~~~~  225 (233)
T 1nri_A          210 QKXVLNXLTTASXILL  225 (233)
T ss_dssp             HHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999981


No 94 
>>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} (A:91-179)
Probab=77.67  E-value=4.8  Score=19.80  Aligned_cols=80  Identities=10%  Similarity=0.074  Sum_probs=54.6

Q ss_pred             HHHHHHHHCCCCEEEEECCCC-CHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             999999977997999940788-6152899999999976994799807874336688978988742026868999648876
Q gi|254780901|r   83 RRIVQAIYNSEKIMIFGDYDV-DGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        83 ~ri~~ai~~~ekI~I~gDyD~-DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      .-+.+|.+-+.||.|.|-... +|...   +   =..++.++..+.-+...|    -.+.+++++++|++.+|    |  
T Consensus         7 ~al~~a~~~~~kiaivgf~~~~~~~~~---~---~~ll~~~i~~~~~~~~~e----~~~~i~~l~~~G~~vVI----G--   70 (89)
T 2pju_A            7 QFLAKAGKLTSSIGVVTYQETIPALVA---F---QKTFNLRLDQRSYITEED----ARGQINELKANGTEAVV----G--   70 (89)
T ss_dssp             HHHHHTTCTTSCEEEEEESSCCHHHHH---H---HHHHTCCEEEEEESSHHH----HHHHHHHHHHTTCCEEE----E--
T ss_pred             HHHHHHHHHCCCEEEEECCCCCHHHHH---H---HHHHCCCEEEEEECCHHH----HHHHHHHHHHCCCCEEE----C--
T ss_conf             999999975897899937751469999---9---999599449999658899----99999999986997999----9--


Q ss_pred             CHHHHHHHHHCCCCEEE
Q ss_conf             23455555417982799
Q gi|254780901|r  162 SYDALQYATNQGIDVIV  178 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIV  178 (600)
                      +.-..+.|++.|+.-|.
T Consensus        71 ~~~~~~~A~~~Gl~~vl   87 (89)
T 2pju_A           71 AGLITDLAEEAGMTGIF   87 (89)
T ss_dssp             SHHHHHHHHHTTSEEEE
T ss_pred             CHHHHHHHHHCCCCEEE
T ss_conf             86999999984997899


No 95 
>>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} (A:1-96,A:208-267)
Probab=77.62  E-value=4.8  Score=19.79  Aligned_cols=82  Identities=16%  Similarity=0.363  Sum_probs=58.4

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCH---------HHHHHHHHCCCCEEEEECCCCC
Q ss_conf             7997999940788615289999999997699479980787433668897---------8988742026868999648876
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNP---------SLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~---------~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      .+.+|.||-    -|+-+.+++.+..+.+-..-.+|+-+.-.-.||--.         ..++.+.+.++++||. -|.+.
T Consensus         2 ~~~pIgvfD----SGvGGLtV~~~i~~~lP~~~~iY~gD~a~~PYG~ks~~~i~~~~~~~~~~l~~~~~k~iVi-ACNTa   76 (156)
T 2gzm_A            2 LNRAIGVID----SGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHLLDLNIKMLVI-ACNTA   76 (156)
T ss_dssp             TTSCEEEEE----SSSTTHHHHHHHHHHCTTSCEEEEECTTTCCCTTSCHHHHHHHHHHHHHHHHTTTCSEEEE-CCHHH
T ss_pred             CCCCEEEEE----CCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEE-CCCHH
T ss_conf             999789998----8966799999999978999989995378999899999999999999999998616787997-26278


Q ss_pred             CHHHHHHHHHC-CCCEE
Q ss_conf             23455555417-98279
Q gi|254780901|r  162 SYDALQYATNQ-GIDVI  177 (600)
Q Consensus       162 ~~e~i~~a~~~-GidvI  177 (600)
                      +.-+++.+++. .+.+|
T Consensus        77 sa~al~~lr~~~~iPvi   93 (156)
T 2gzm_A           77 TAVVLEEMQKQLPIPVV   93 (156)
T ss_dssp             HHHHHHHHHHHCSSCEE
T ss_pred             HHHHHHHHHHHCCCCEE
T ss_conf             89999999974898879


No 96 
>>1tks_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, synthetic gene, isomerase; 1.60A {Candida albicans SC5314} (A:)
Probab=77.29  E-value=0.9  Score=25.47  Aligned_cols=95  Identities=18%  Similarity=0.177  Sum_probs=57.7

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCH----H----HHHHHHHHHHHH-CCCCEEEEECCCCCCCCCCCHHHHHHHHHC
Q ss_conf             7999999999997799799994078861----5----289999999997-699479980787433668897898874202
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYDVDG----A----ASVALMMRFLSH-CSVNANMYIPDRIVDGYGPNPSLMEKFINE  148 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD~DG----i----tstail~~~L~~-~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~  148 (600)
                      ....+++..+++++++.|+|+-|-|-++    +    +.|.=...|+.+ -+.-++.-++.+.-+--||..-.-..-...
T Consensus         4 ~~~~i~~ai~alr~G~~Viv~D~~~re~egdlv~aAe~~t~e~i~fm~~~~~Glic~ai~~~~a~~L~Lp~m~~~~~~~~   83 (204)
T 1tks_A            4 IFTPIEEALEAYKNGEFLIVMDDEDRENEGDLIMAAELITQEKMAFLVRYSSGYVCVPLSEERANQLELPPMLANRSDRH   83 (204)
T ss_dssp             CSCCHHHHHHHHHTTCCEEEESSSCTTCBCEEEEEGGGCCHHHHHHHHHTBCSCCEEEEEHHHHHHTTCCBSCC------
T ss_pred             CCCCHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCCEEEECCHHHHHHHCCCCCCCCCCCCC
T ss_conf             52439999999988996999968998774068989798899999999984588758845899986750786556666777


Q ss_pred             CCCEEEEEC------CCCCCHHHHHHHHHC
Q ss_conf             686899964------887623455555417
Q gi|254780901|r  149 GAQLIITVD------CGSTSYDALQYATNQ  172 (600)
Q Consensus       149 g~~LiItvD------~Gi~~~e~i~~a~~~  172 (600)
                      +...-||||      .|||+.+...-++.+
T Consensus        84 ~t~ftvsvda~~g~~TGISa~DRa~Tir~l  113 (204)
T 1tks_A           84 GTAYTITCDFAEGTTTGISAHDRALTTRSL  113 (204)
T ss_dssp             CCCBBCCEEESTTCSSSCSHHHHHHHHHHH
T ss_pred             CCCEEEECCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             775110000246888773599999999987


No 97 
>>1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} (A:)
Probab=77.00  E-value=5  Score=19.66  Aligned_cols=107  Identities=14%  Similarity=0.148  Sum_probs=57.5

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHH--HHHHHHHHCCCCEEEEECCCC-CCC----------CCCCHH
Q ss_conf             6148799999999999779979999407886152899--999999976994799807874-336----------688978
Q gi|254780901|r   74 ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVA--LMMRFLSHCSVNANMYIPDRI-VDG----------YGPNPS  140 (600)
Q Consensus        74 ~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitsta--il~~~L~~~g~~v~~~IP~R~-~eG----------YGl~~~  140 (600)
                      .+..++++++++.+.+.+.++|.++|   + |.+..+  .+...|..+|.......|--. .+.          ++....
T Consensus        24 ~~~~~~~~~~~~~~~i~~~~rI~~~G---~-G~S~~~a~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   99 (188)
T 1tk9_A           24 LKGQIAKVGELLCECLKKGGKILICG---N-GGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFV   99 (188)
T ss_dssp             GHHHHHHHHHHHHHHHHTTCCEEEEE---S-THHHHHHHHHHHHHHSCSSSCCCCCCEEESSCCHHHHHHHHHHTCGGGH
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEE---C-CCCCEEEEEHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             19999999999999998599899991---6-8874344331434068765554433222567874433212255799999


Q ss_pred             HH-HH-HHHCCCCEEEEECCCCCC---HHHHHHHHHCCCCEEE-ECCCCC
Q ss_conf             98-87-420268689996488762---3455555417982799-615447
Q gi|254780901|r  141 LM-EK-FINEGAQLIITVDCGSTS---YDALQYATNQGIDVIV-IDHHQV  184 (600)
Q Consensus       141 ~i-~~-~~~~g~~LiItvD~Gi~~---~e~i~~a~~~GidvIV-tDHH~~  184 (600)
                      .. .. ..-..-+++|.+-++-.+   .+.+++|+++|+.+|. |+...-
T Consensus       100 ~~~~~~~~~~~~dlvI~~S~sG~t~~~~~~~~~ak~~g~~vI~IT~~~~s  149 (188)
T 1tk9_A          100 FSRQVEALGNEKDVLIGISTSGKSPNVLEALKKAKELNXLCLGLSGKGGG  149 (188)
T ss_dssp             HHHHHHHHCCTTCEEEEECSSSCCHHHHHHHHHHHHTTCEEEEEEEGGGT
T ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHEEEEEEEECCCCCH
T ss_conf             99999983799998999818988831576567777424148998378852


No 98 
>>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} (A:1-99,A:212-276)
Probab=76.95  E-value=5  Score=19.65  Aligned_cols=85  Identities=18%  Similarity=0.275  Sum_probs=63.2

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCH---------HHHHHHHHCCCCEEEEECCC
Q ss_conf             977997999940788615289999999997699479980787433668897---------89887420268689996488
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNP---------SLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~---------~~i~~~~~~g~~LiItvD~G  159 (600)
                      .+++.+|.||-    -|+-+.+++....+.+-..-.+|+-+.-.-.||--.         +.++.+.+.|+++|| +-|-
T Consensus         4 ~~~~~~IgifD----SG~GGltv~~~i~~~lP~~~~iY~~D~~~~PYG~k~~~~i~~~~~~~~~~l~~~~~~~iV-iACN   78 (164)
T 2dwu_A            4 CHKHSVIGVLD----SGVGGLTVASEIIRQLPKESICYIGDNERCPYGPRSVEEVQSFVFEMVEFLKQFPLKALV-VACN   78 (164)
T ss_dssp             -CCCCEEEEEE----SSSTTHHHHHHHHHHCTTSCEEEEECGGGCCCTTSCHHHHHHHHHHHHHHHTTSCEEEEE-ECCH
T ss_pred             CCCCCEEEEEE----CCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEE-EECC
T ss_conf             66899089994----896389999999997899988999527889988899999999999999998625776899-9537


Q ss_pred             CCCHHHHHHHHH-CCCCEEE
Q ss_conf             762345555541-7982799
Q gi|254780901|r  160 STSYDALQYATN-QGIDVIV  178 (600)
Q Consensus       160 i~~~e~i~~a~~-~GidvIV  178 (600)
                      +.+.-+++.+++ ..+.+|.
T Consensus        79 Tasa~al~~lr~~~~iPii~   98 (164)
T 2dwu_A           79 TAAAATLAALQEALSIPVIG   98 (164)
T ss_dssp             HHHHHHHHHHHHHCSSCEEE
T ss_pred             HHHHHHHHHHHHCCCCCEEE
T ss_conf             27774189997406987785


No 99 
>>2a3n_A Putative glucosamine-fructose-6-phosphate aminotransferase; 16423107, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Salmonella typhimurium LT2} (A:1-192)
Probab=76.93  E-value=5  Score=19.65  Aligned_cols=105  Identities=10%  Similarity=0.075  Sum_probs=56.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH--HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHH-H-HHCCCCEEEE
Q ss_conf             999999999977997999940788615289999--99999769947998078743366889789887-4-2026868999
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALM--MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEK-F-INEGAQLIIT  155 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail--~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~-~-~~~g~~LiIt  155 (600)
                      ...+++.+++.+.++|.++|-    |.+...-.  ...|..++..+..+.++         ...... . .-..-+++|.
T Consensus        42 ~~~~~~~~~l~~a~~i~i~G~----G~S~~~a~~~~~~l~~l~~~~~~~~~~---------~~~~~~~~~~~~~~d~vI~  108 (192)
T 2a3n_A           42 AEQVADEIYQAGFSSLFFASV----GGSLAPXXAINEFAKELTTLPVYVEQA---------AELIHKGNKRLNKDSVVIT  108 (192)
T ss_dssp             HHHHHHHHHHHCCSCEEEEEC----GGGHHHHHHHHHHHHHHCCSCEEEEEH---------HHHHHHCCTTCCTTCEEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEEC----HHHHHHHHHHHHHHHHHHCCCEEEEEH---------HHHHCCCCCCCCCCCEEEE
T ss_conf             999999999679997999971----178999999999999985998699841---------6754458887899997999


Q ss_pred             ECCCCCC---HHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECC
Q ss_conf             6488762---3455555417982799-6154476555672565237
Q gi|254780901|r  156 VDCGSTS---YDALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNP  197 (600)
Q Consensus       156 vD~Gi~~---~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP  197 (600)
                      +-..-.+   .+.++.|++.|+.+|. ||....+=..-..+.+..|
T Consensus       109 iS~sg~s~~~~~~~~~ak~~g~~iI~IT~~~~s~l~~~ad~~l~~~  154 (192)
T 2a3n_A          109 LSKSGDTKESVAIAEWCKAQGIRVVAITKNADSPLAQAATWHIPXR  154 (192)
T ss_dssp             ECSSSCCHHHHHHHHHHHHTTCEEEEEESCTTSHHHHTCSEEEECC
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHHEEEEECCCCCCCCCCCCCCCCC
T ss_conf             9689997679999999986301211333024542002233210123


No 100
>>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} (A:1-152,A:296-319)
Probab=76.83  E-value=5  Score=19.63  Aligned_cols=74  Identities=16%  Similarity=0.263  Sum_probs=51.1

Q ss_pred             CCCCEEEEECCC---CCHHHHHHHHHHHHHHCCC-CEEEEECC--------CCCCCC-CCCHHHHHHHHH-CCCCEEEEE
Q ss_conf             799799994078---8615289999999997699-47998078--------743366-889789887420-268689996
Q gi|254780901|r   91 NSEKIMIFGDYD---VDGAASVALMMRFLSHCSV-NANMYIPD--------RIVDGY-GPNPSLMEKFIN-EGAQLIITV  156 (600)
Q Consensus        91 ~~ekI~I~gDyD---~DGitstail~~~L~~~g~-~v~~~IP~--------R~~eGY-Gl~~~~i~~~~~-~g~~LiItv  156 (600)
                      +++.+.|+.+.-   -|-+....++..+++..|+ .+...+|-        |+.+|. -++...+-++.+ .|++-+||+
T Consensus        53 rg~dV~iiqs~~~~~nd~lmeLlll~dAlr~~gA~rItlViPYl~YsRQDR~~~~G~e~isak~vA~ll~~~Gvd~vitv  132 (176)
T 3dah_A           53 RGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRPRSARVAISAKVVANMLEIAGVERIITM  132 (176)
T ss_dssp             BTCEEEEECCCCSSHHHHHHHHHHHHHHHHHTTBSEEEEEESSCTTTTCCSCCTTCCCCCHHHHHHHHHHHHTCCEEEEE
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEE
T ss_conf             69869999279998506799999999999873897699996367303688776788667379999975431589879998


Q ss_pred             CCCCCCHH
Q ss_conf             48876234
Q gi|254780901|r  157 DCGSTSYD  164 (600)
Q Consensus       157 D~Gi~~~e  164 (600)
                      |-.+...+
T Consensus       133 D~H~~~i~  140 (176)
T 3dah_A          133 DLHADQIQ  140 (176)
T ss_dssp             SCSCGGGG
T ss_pred             CCCCHHHH
T ss_conf             17976884


No 101
>>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} (A:16-117)
Probab=76.22  E-value=5.2  Score=19.51  Aligned_cols=78  Identities=15%  Similarity=0.159  Sum_probs=46.6

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC--CC-----CCC----CCCCHHHHHHHHHCCCCEEEEECC
Q ss_conf             7799799994078861528999999999769947998078--74-----336----688978988742026868999648
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD--RI-----VDG----YGPNPSLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~--R~-----~eG----YGl~~~~i~~~~~~g~~LiItvD~  158 (600)
                      +++++|+|+|    =|.|+-+-+.++|...|++|..+=-+  ..     .+|    +|.+.+.     -.+++++|. -.
T Consensus         2 ~k~k~v~v~G----lG~sG~salA~~L~~~G~~V~~~D~~~~~~~~~l~~~~i~~~~g~~~~~-----l~~~d~VV~-SP   71 (102)
T 2f00_A            2 RRVRHIHFVG----IGGAGXGGIAEVLANEGYQISGSDLAPNPVTQQLXNLGATIYFNHRPEN-----VRDASVVVV-SS   71 (102)
T ss_dssp             TTCCEEEEET----TTSTTHHHHHHHHHHTTCEEEEECSSCCHHHHHHHHTTCEEESSCCGGG-----GTTCSEEEE-CT
T ss_pred             HCCCEEEEEE----ECHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHCCCEEECCCCHHH-----CCCCCEEEE-CC
T ss_conf             1478799998----5899999999999968991899948999799999978898986989888-----689989998-99


Q ss_pred             CCC-CHHHHHHHHHCCCCEE
Q ss_conf             876-2345555541798279
Q gi|254780901|r  159 GST-SYDALQYATNQGIDVI  177 (600)
Q Consensus       159 Gi~-~~e~i~~a~~~GidvI  177 (600)
                      |+. +++++..|+++|+.|+
T Consensus        72 gi~~~~p~l~~a~~~gi~i~   91 (102)
T 2f00_A           72 AISADNPEIVAAHEARIPVI   91 (102)
T ss_dssp             TCCTTCHHHHHHHHTTCCEE
T ss_pred             CCCCCCHHHHHHHHCCCCEE
T ss_conf             84998999999998899699


No 102
>>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} (D:189-320)
Probab=75.54  E-value=2.5  Score=22.06  Aligned_cols=96  Identities=5%  Similarity=-0.031  Sum_probs=59.2

Q ss_pred             HHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCCCCHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             99999977997999940788615289999999997699479980787--4336688978988742026868999648876
Q gi|254780901|r   84 RIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVDGYGPNPSLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        84 ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      ++.+.+++-++-+|+..+.+.--.+..-+.++.+.+|+.|...-+.|  +.+.+=......-... ..++++|++.+-.+
T Consensus         5 ~~~~~l~~AkrPvii~G~g~~~~~~~~~i~~lae~~g~pv~~t~~~kg~~~~~hp~~~G~~g~~~-~~aDlil~iG~~~~   83 (132)
T 1o97_D            5 GGNDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSRPIADAGWLPKSRQVGQSGKVV-GSCKLYVAMGISGS   83 (132)
T ss_dssp             ---CCCCSCSSEEEEECGGGCSGGGHHHHHHHHHHHTCEEEECHHHHHTTSSCGGGBBSTTSBCC-TTCSEEEEESCCCC
T ss_pred             CCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCEEECHHHHHCCCCCHHHEEECCCCEE-CCCCEEEEEECCCH
T ss_conf             55566666664489816766770047899999998498332258688679998788681118351-38748999840473


Q ss_pred             CHHHHHHHHHCCCCEEEECCC
Q ss_conf             234555554179827996154
Q gi|254780901|r  162 SYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIVtDHH  182 (600)
                      .+.  ..-...+-++|-+|-.
T Consensus        84 ~~~--~~~~~~~~~ii~Id~d  102 (132)
T 1o97_D           84 IQH--MAGMKHVPTIIAVNTD  102 (132)
T ss_dssp             HHH--HHHHTTCSEEEEECSC
T ss_pred             HHH--HHHHCCCCEEEEEECC
T ss_conf             887--8760459889999489


No 103
>>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} (A:153-280)
Probab=74.83  E-value=5.6  Score=19.25  Aligned_cols=76  Identities=20%  Similarity=0.319  Sum_probs=53.3

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHH----HCCCCEEEEECCCCCCHHHH
Q ss_conf             79979999407886152899999999976994799807874336688978988742----02686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFI----NEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~----~~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++.+|++.||  .-.+  .--+..++..+|.++.+.-|.    ||-+....++.+.    +.|.++.+|-|     .++ 
T Consensus         2 ~gl~i~~vGd--~~nv--~~Sl~~~~~~~g~~v~~~~P~----~~~~~~~~~~~~~~~~~~~g~~~~~~~d-----~~e-   67 (128)
T 1oth_A            2 KGLTLSWIGD--GNNI--LHSIMMSAAKFGMHLQAATPK----GYEPDASVTKLAEQYAKENGTKLLLTND-----PLE-   67 (128)
T ss_dssp             TTCEEEEESC--SSHH--HHHHHTTTGGGTCEEEEECCT----TCCCCHHHHHHHHHHHHHHTCCEEEESC-----HHH-
T ss_pred             CCCEEEEECC--CCCC--CCCHHHHHHHCCCCEEEEECC----CCCCCHHHHHHHHHHHHHCCCEEEEECC-----HHH-
T ss_conf             8967999656--5565--131999987628737898357----7687488999999999864997999728-----899-


Q ss_pred             HHHHHCCCCEEEECCCC
Q ss_conf             55541798279961544
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~  183 (600)
                         .-.|.|||+||--.
T Consensus        68 ---ai~~aDvvyt~~w~   81 (128)
T 1oth_A           68 ---AAHGGNVLITDTWI   81 (128)
T ss_dssp             ---HHTTCSEEEECCSS
T ss_pred             ---HHCCCCEEEEEEEE
T ss_conf             ---85079979998546


No 104
>>2wje_A CPS4B, tyrosine-protein phosphatase CPSB; capsule biogenesis/degradation, manganese, hydrolase, exopolysaccharide synthesis; 1.90A {Streptococcus pneumoniae} PDB: 2wjd_A 2wjf_A (A:)
Probab=74.71  E-value=1.5  Score=23.64  Aligned_cols=28  Identities=29%  Similarity=0.402  Sum_probs=21.4

Q ss_pred             CCCCCCHHH----HHHHHHCCCCEE-EECCCCC
Q ss_conf             488762345----555541798279-9615447
Q gi|254780901|r  157 DCGSTSYDA----LQYATNQGIDVI-VIDHHQV  184 (600)
Q Consensus       157 D~Gi~~~e~----i~~a~~~GidvI-VtDHH~~  184 (600)
                      ++|+.+.++    ++.|+++|++.| ||||...
T Consensus        17 ~DG~~s~~~~~~lv~~A~~~G~~~iaiTDH~~~   49 (247)
T 2wje_A           17 DDGPKSREESKALLAESYRQGVRTIVSTSHRRK   49 (247)
T ss_dssp             SSSCSSHHHHHHHHHHHHHTTEEEEECCCEEBT
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             789999999999999999879998998989886


No 105
>>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} (A:1-153,A:296-317)
Probab=74.63  E-value=5.7  Score=19.22  Aligned_cols=74  Identities=18%  Similarity=0.256  Sum_probs=56.2

Q ss_pred             CCCCEEEEECCC--C-CHHHHHHHHHHHHHHCCC-CEEEEECC--------CCCCCCCCCHHHHHHHHHC-CCCEEEEEC
Q ss_conf             799799994078--8-615289999999997699-47998078--------7433668897898874202-686899964
Q gi|254780901|r   91 NSEKIMIFGDYD--V-DGAASVALMMRFLSHCSV-NANMYIPD--------RIVDGYGPNPSLMEKFINE-GAQLIITVD  157 (600)
Q Consensus        91 ~~ekI~I~gDyD--~-DGitstail~~~L~~~g~-~v~~~IP~--------R~~eGYGl~~~~i~~~~~~-g~~LiItvD  157 (600)
                      +++.+.|....-  + |-+.-..++..+++..|+ ++...+|-        |+.+|=-++...+-++.+. |++-+||+|
T Consensus        55 rg~dV~iiqs~~~~~nd~lmELll~idAlr~~gA~rItlViPYl~YaRQDr~~~~ge~isak~vA~lL~~~Gvd~vitvD  134 (175)
T 1dku_A           55 RGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKARSREPITAKLFANLLETAGATRVIALD  134 (175)
T ss_dssp             TTCEEEEECCCCSSHHHHHHHHHHHHHHHHHTTCSEEEEEESSCTTTTCCSCSSTTCCCHHHHHHHHHHHHTCCEEEEES
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             89859999678998015499999888777634553478833642144023225788871578886566532887689962


Q ss_pred             CCCCCHH
Q ss_conf             8876234
Q gi|254780901|r  158 CGSTSYD  164 (600)
Q Consensus       158 ~Gi~~~e  164 (600)
                      --+...+
T Consensus       135 ~Hs~~~~  141 (175)
T 1dku_A          135 LHAPQIQ  141 (175)
T ss_dssp             CSSGGGG
T ss_pred             CCCHHHH
T ss_conf             6858886


No 106
>>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open active site loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* (A:199-361)
Probab=74.42  E-value=5.8  Score=19.18  Aligned_cols=87  Identities=10%  Similarity=0.116  Sum_probs=58.4

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE------CCCCCC---CC-CC-CHHHHHHH
Q ss_conf             879999999999977997999940788615289999999997699479980------787433---66-88-97898874
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI------PDRIVD---GY-GP-NPSLMEKF  145 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~I------P~R~~e---GY-Gl-~~~~i~~~  145 (600)
                      .-+.+++++.+.|.+-++.+|+..+-+..--+..-+.++.+.+|+.|...-      |++-.-   .| |. +...+.++
T Consensus         9 ~~~~~i~~~~~~L~~A~rPvii~G~~~~~~~a~~~l~~lae~~g~pv~~t~~~kg~~~~~~p~~~G~~~g~~~~~~~~~~   88 (163)
T 2nxw_A            9 ALAACADEVLAAMRSATSPVLMVCVEVRRYGLEAKVAELAQRLGVPVVTTFMGRGLLADAPTPPLGTYIGVAGDAEITRL   88 (163)
T ss_dssp             HHHHHHHHHHHHHHHCSSEEEEECHHHHHTTCHHHHHHHHHHHCSCEEECGGGTTTTTTSSSCCSCBCCGGGSCHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCC
T ss_conf             36899999999987501122210011344333431000023334322334210011235530000112565431111012


Q ss_pred             HHCCCCEEEEECCCCCCHH
Q ss_conf             2026868999648876234
Q gi|254780901|r  146 INEGAQLIITVDCGSTSYD  164 (600)
Q Consensus       146 ~~~g~~LiItvD~Gi~~~e  164 (600)
                      .++ ++|||.+.+-.+...
T Consensus        89 ~~~-aDlvl~iG~~~~~~~  106 (163)
T 2nxw_A           89 VEE-SDGLFLLGAILSDTN  106 (163)
T ss_dssp             HHT-CSEEEEESCCBCSST
T ss_pred             CCC-CCCCEEECCCCCCCC
T ss_conf             455-652136534336652


No 107
>>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor; HET: T6P; 2.50A {Escherichia coli} (A:1-98,A:224-255)
Probab=74.25  E-value=5.8  Score=19.15  Aligned_cols=67  Identities=3%  Similarity=-0.047  Sum_probs=46.4

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             9999997699479980787433668897898874202686899964887623455555417982799615447
Q gi|254780901|r  112 MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       112 l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      +.+.++..|.++..+-.+.-.+   .....++.+...+++-||.+..   +.+.++.+.+.|+.++..|...+
T Consensus        24 i~~~a~~~Gy~viv~~t~~~~~---~e~~~i~~l~~~~vDGIIi~~~---~~~~~~~l~~~giPvV~id~~~~   90 (130)
T 1byk_A           24 MLPAFYEQGYDPIMMESQFSPQ---LVAEHLGVLKRRNIDGVVLFGF---TGITEEMLAHWQSSLVLLARDAK   90 (130)
T ss_dssp             HHHHHHHHTCEEEEEECTTCHH---HHHHHHHHHHTTTCCEEEEECC---TTCCTTTSGGGSSSEEEESSCCS
T ss_pred             HHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCCEEECCC---CCCHHHHHHHCCCCEEEECCCCC
T ss_conf             9999998599999993899989---9999999998326651121025---65089999976999998166789


No 108
>>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic resolution; HET: FAD; 0.92A {Streptomyces SP} (A:1-48,A:115-153,A:214-284,A:456-504)
Probab=74.23  E-value=4.9  Score=19.72  Aligned_cols=37  Identities=8%  Similarity=0.214  Sum_probs=25.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             86899964887623455555417982799615447655
Q gi|254780901|r  150 AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE  187 (600)
Q Consensus       150 ~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~  187 (600)
                      ++++| |-.|++...+..++++.|++|+|.|....+..
T Consensus         6 ~dviI-IGaG~aGl~aA~~l~~~g~~v~iie~~~~~gg   42 (207)
T 1n4w_A            6 VPAVV-IGTGYGAAVSALRLGEAGVQTLMLEMGQLWNQ   42 (207)
T ss_dssp             EEEEE-ECCSHHHHHHHHHHHHTTCCEEEEESSCCCCC
T ss_pred             CCEEE-ECCCHHHHHHHHHHHHCCCEEEEEECCCCCCC
T ss_conf             96999-79688999999999868692999957899887


No 109
>>3fj1_A Putative phosphosugar isomerase; YP_167080.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.75A {Silicibacter pomeroyi dss-3} (A:1-193)
Probab=74.06  E-value=5.9  Score=19.12  Aligned_cols=132  Identities=7%  Similarity=-0.093  Sum_probs=68.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHH--HHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHH--HCCCCEEEE
Q ss_conf             999999999977997999940788615289--9999999976994799807874336688978988742--026868999
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASV--ALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFI--NEGAQLIIT  155 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitst--ail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~--~~g~~LiIt  155 (600)
                      +.++.+.+.+.+-++|.++|   + |.|..  .-+...|..++..+.+....         ........  -..-+++|.
T Consensus        31 ~~i~~~~~~i~~a~~I~i~G---~-G~S~~~a~~~~~~l~~l~~~~~~~~~~---------~~~~~~~~~~~~~~d~vI~   97 (193)
T 3fj1_A           31 VARVAAVLRLRDPSFVATVA---R-GSSDHVCTYLSYAAELLLGLPVASLGP---------SVASVYDARLRLDRALCLA   97 (193)
T ss_dssp             HHHHHHHHHHHCCSEEEEEC---C-THHHHHHHHHHHHHHHHHCCCEEECCT---------HHHHTTCCCCCCTTEEEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEE---C-HHHHHHHHHHHHHHHHHHCCCEEEECH---------HHHHHCCCCCCCCCEEEEE
T ss_conf             77676565306987899995---1-289999999999999984998599515---------2554413667889849999


Q ss_pred             ECC-CCC--CHHHHHHHHHCCCCEE-EECCCCCC-CCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             648-876--2345555541798279-96154476-555672565237888864334430478899999999999702
Q gi|254780901|r  156 VDC-GST--SYDALQYATNQGIDVI-VIDHHQVK-SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR  227 (600)
Q Consensus       156 vD~-Gi~--~~e~i~~a~~~GidvI-VtDHH~~~-~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~  227 (600)
                      +.. |-+  -.+.++.|+++|..+| ||+-...+ .+.- .+.+.=|.  +++..+...++.-..+.++..|...+.
T Consensus        98 iS~sG~t~~~~~~~~~ak~~g~~vi~iT~~~~s~l~~~a-d~~i~~~~--~~~~~~~~~~s~~~~~~~l~~L~~~l~  171 (193)
T 3fj1_A           98 VSQSGKSPDIVAXTRNAGRDGALCVALTNDAASPLAGVS-AHTIDIHA--GPELSVAATKTFVTSAVAGLXLLADWA  171 (193)
T ss_dssp             EESSSCCHHHHHHHHHHHHTTCEEEEEESCTTSHHHHTS-SEEEECCC--CCCCSTTCHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCC-CCCCCCCC--CCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             977899748999999987759949998447998701034-63310246--775202347779999999999999975


No 110
>>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} (A:187-366)
Probab=73.96  E-value=5.9  Score=19.10  Aligned_cols=136  Identities=12%  Similarity=0.148  Sum_probs=73.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCC-------CC-CC-CHHHHHHHHH
Q ss_conf             9999999999977997999940788615289999999997699479980787--433-------66-88-9789887420
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVD-------GY-GP-NPSLMEKFIN  147 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~e-------GY-Gl-~~~~i~~~~~  147 (600)
                      +.+++++.+.|.+-++.+|+..+.+..--+..-+.++...+|+.|...-..|  +.+       || |. ......++.+
T Consensus         8 ~~~i~~~~~~L~~A~rPvii~G~~~~~~~a~~~l~~lae~~g~Pv~~t~~~kg~~~~~hp~~~~g~~g~~~~~~~~~~i~   87 (180)
T 1ozh_A            8 DDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFSRFAGRVGLFNNQAGDRLLQ   87 (180)
T ss_dssp             HHHHHHHHHHHHHCSSEEEEECGGGGSGGGHHHHHHHHHHHCCCEEECGGGTTTCCTTTCTTEEEECSSBTTCHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCC
T ss_conf             89999999999754398645787654516689999999860897110232367643345543444567656423312465


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             26868999648876234555554179827996154476555672565237888864334430478899999999999702
Q gi|254780901|r  148 EGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR  227 (600)
Q Consensus       148 ~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~  227 (600)
                      + +++||.+.+-.+...--.+.. .+-.+|              ...++|...+..|+ .+++=+|=+--++.+|.+.+.
T Consensus        88 ~-aD~il~iG~~~~~~~~~~~~~-~~~~~i--------------~i~~d~~~~~~~~~-~~~~i~~d~~~~l~~L~~~l~  150 (180)
T 1ozh_A           88 L-ADLVICIGYSPVEYEPAMWNS-GNATLV--------------HIDVLPAYEERNYT-PDVELVGDIAGTLNKLAQNID  150 (180)
T ss_dssp             H-CSEEEEESCCGGGSCGGGTCC-SCSEEE--------------EEESSCCCCBTTBC-CSEEEESCHHHHHHHHHHTCC
T ss_pred             C-CCEEEECCCCCCCCCCCCCCC-CCCEEE--------------EEECCHHHHCCCCC-CCEEEECHHHHHHHHHHHHHH
T ss_conf             0-204666376556667654678-876179--------------98433554235777-643552139999999999865


Q ss_pred             CCCC
Q ss_conf             1488
Q gi|254780901|r  228 QDNK  231 (600)
Q Consensus       228 ~~~~  231 (600)
                      ....
T Consensus       151 ~~~~  154 (180)
T 1ozh_A          151 HRLV  154 (180)
T ss_dssp             SCCC
T ss_pred             HCCC
T ss_conf             0334


No 111
>>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structural genomics, protein structure initiative; 2.20A {Bacteroides fragilis nctc 9343} (A:1-116,A:254-304)
Probab=73.67  E-value=6  Score=19.05  Aligned_cols=123  Identities=13%  Similarity=-0.005  Sum_probs=69.1

Q ss_pred             CEEE-EECCCCCHHHHHHH--HHHHHHHC---CCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC-HHHH
Q ss_conf             7999-94078861528999--99999976---9947998078743366889789887420268689996488762-3455
Q gi|254780901|r   94 KIMI-FGDYDVDGAASVAL--MMRFLSHC---SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS-YDAL  166 (600)
Q Consensus        94 kI~I-~gDyD~DGitstai--l~~~L~~~---g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~-~e~i  166 (600)
                      +|.+ ..+..-+-.-....  +.++.+.+   |.++.+.-|...+.  .-....++.+...+++-||.+-..... .+.+
T Consensus        10 ~Igvivp~~~~~~f~~~i~~g~~~aa~e~~~~g~~i~i~~~~~~d~--~~q~~~i~~li~~~vDgIii~p~~~~~~~~~i   87 (167)
T 3gbv_A           10 TFACLLPKHLEGEYWTDVQKGIREAVTTYSDFNISANITHYDPYDY--NSFVATSQAVIEEQPDGVXFAPTVPQYTKGFT   87 (167)
T ss_dssp             EEEEEEECCCTTSHHHHHHHHHHHHHHHTGGGCEEEEEEEECSSCH--HHHHHHHHHHHTTCCSEEEECCSSGGGTHHHH
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCH--HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHH
T ss_conf             8999987999888999999999999997166887999995898999--99999999999759998999604532029999


Q ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             5554179827996154476555672565237888864334430478899999999999702148876
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP  233 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~  233 (600)
                      +.+++.||.||..|-..++. ...++.-.||              .+..|+-+.++.+.|.....++
T Consensus        88 ~~~~~~gIPvV~id~~~~~~-~~~~~Vg~Dp--------------~~~G~~av~~~~~~l~~g~~~~  139 (167)
T 3gbv_A           88 DALNELGIPYIYIDSQIKDA-PPLAFFGQNP--------------ELQGFNSIKTLCDHLIFRKEVA  139 (167)
T ss_dssp             HHHHHHTCCEEEESSCCTTS-CCSEEEECCH--------------HHHHHHHHHHHHHHHTSCCCCC
T ss_pred             HHHHHCCCEEEEEEECCCCC-CCCCCCCCHH--------------HHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99997197799996023233-2222245109--------------9999999999999985599999


No 112
>>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex; HET: PSQ; 1.70A {Escherichia coli} (G:153-278)
Probab=73.46  E-value=6  Score=19.01  Aligned_cols=78  Identities=18%  Similarity=0.283  Sum_probs=54.2

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH----CCCCEEEEECCCCCCHHHH
Q ss_conf             799799994078861528999999999769947998078743366889789887420----2686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN----EGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~----~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++.+|++.||  ..+=+.-+ +..++..+|.++.+.-|.    ||.+....++.+.+    .|.++.+|-|     .++ 
T Consensus         2 ~glki~~vGd--~~~rv~~S-~~~~~~~~g~~v~~~~P~----~~~~~~~~~~~~~~~~~~~g~~i~~~~d-----~~e-   68 (126)
T 1duv_G            2 NEMTLVYAGD--ARNNMGNS-MLEAAALTGLDLRLVAPQ----ACWPEAALVTECRALAQQNGGNITLTED-----VAK-   68 (126)
T ss_dssp             GGCEEEEESC--TTSHHHHH-HHHHHHHHCCEEEEECCG----GGCCCHHHHHHHHHHHHHTTCEEEEESC-----HHH-
T ss_pred             CCEEEEEECC--CCCCHHHH-HHHHHHCCCCEEEECCCC----CCCCCHHHHHHHHHHHCCCCCEEEEEEC-----HHH-
T ss_conf             6427998357--54320677-887763268224311342----3488489999998764047986899724-----322-


Q ss_pred             HHHHHCCCCEEEECCCCC
Q ss_conf             555417982799615447
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~  184 (600)
                         .=.|.|||.||-=..
T Consensus        69 ---a~~~aDviy~~~w~~   83 (126)
T 1duv_G           69 ---GVEGADFIYTDVWVS   83 (126)
T ss_dssp             ---HHTTCSEEEECCSSC
T ss_pred             ---HCCCCCEEEEHHHHH
T ss_conf             ---115797873104667


No 113
>>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* (A:202-364)
Probab=73.31  E-value=6.1  Score=18.99  Aligned_cols=87  Identities=14%  Similarity=0.197  Sum_probs=59.4

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCC----------CCCCCHHHHHH
Q ss_conf             879999999999977997999940788615289999999997699479980787--433----------66889789887
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVD----------GYGPNPSLMEK  144 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~e----------GYGl~~~~i~~  144 (600)
                      --+.+++++.+.+.+.++.+|+.++.+..--+..-+.++...+|+.|....-.|  +.|          |+.-+.. +.+
T Consensus        12 ~~~~~i~~~~~~l~~a~rP~ii~G~~~~~~~a~~~l~~lae~~~~Pv~~t~~~kg~~~e~~p~~~G~~~g~~~~~~-~~~   90 (163)
T 2vbf_A           12 TEQVILSKIEESLKNAQKPVVIAGHEVISFGLEKTVTQFVSETKLPITTLNFGKSAVDESLPSFLGIYNGKLSEIS-LKN   90 (163)
T ss_dssp             HHHHHHHHHHHHHHHCSSEEEEECHHHHHTTCHHHHHHHHHHHCCCEEECSTTTTSSCTTSTTEEEECCGGGSCHH-HHH
T ss_pred             CHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH-HHH
T ss_conf             3025899999999733551787411233310466777776414787423454334345788656666523555312-443


Q ss_pred             HHHCCCCEEEEECCCCCCHHH
Q ss_conf             420268689996488762345
Q gi|254780901|r  145 FINEGAQLIITVDCGSTSYDA  165 (600)
Q Consensus       145 ~~~~g~~LiItvD~Gi~~~e~  165 (600)
                      +.++ ++|||.+.+-.+...-
T Consensus        91 ~~~~-aDlii~iG~~~~~~~~  110 (163)
T 2vbf_A           91 FVES-ADFILMLGVKLTDSST  110 (163)
T ss_dssp             HHHH-CSEEEEESCCCCGGGT
T ss_pred             HHCC-CCCEEEEEEECCCCCC
T ss_conf             3036-6510476200133321


No 114
>>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} (A:184-348)
Probab=72.62  E-value=6.3  Score=18.87  Aligned_cols=85  Identities=11%  Similarity=0.172  Sum_probs=59.6

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC--CC------C-C-C-CCHHHHHHHH
Q ss_conf             799999999999779979999407886152899999999976994799807874--33------6-6-8-8978988742
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI--VD------G-Y-G-PNPSLMEKFI  146 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~--~e------G-Y-G-l~~~~i~~~~  146 (600)
                      -+.+++++.+.+.+-++.+|+..+.+...-+..-+.++.+.+|+.|...-..|-  .|      | | | .......++.
T Consensus        12 ~~~~i~~~~~~L~~A~rP~ii~G~~~~~~~a~~~l~~lae~~g~pv~~t~~~k~~~~~~hp~~~G~~~g~~~~~~~~~~~   91 (165)
T 2vbi_A           12 LKAAVDATVALLEKSASPVMLLGSKLRAANALAATETLADKLQCAVTIMAAAKGFFPEDHAGFRGLYWGEVSNPGVQELV   91 (165)
T ss_dssp             HHHHHHHHHHHHHTCSCEEEEECTTTTTTTCHHHHHHHHHHHCCEEEEEGGGTTSSCTTSTTEEEEECGGGSCTTHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCEECCCCCCCCCCCC
T ss_conf             27789999999986232453232223333222232221243210355302345468754653456400034464332221


Q ss_pred             HCCCCEEEEECCCCCCH
Q ss_conf             02686899964887623
Q gi|254780901|r  147 NEGAQLIITVDCGSTSY  163 (600)
Q Consensus       147 ~~g~~LiItvD~Gi~~~  163 (600)
                      ++ ++|||++.+-.+..
T Consensus        92 ~~-aDlil~iG~~~~~~  107 (165)
T 2vbi_A           92 ET-SDALLCIAPVFNDY  107 (165)
T ss_dssp             HT-CSEEEEESCCCBTT
T ss_pred             CC-CCCCCCCCCCCCCC
T ss_conf             24-41133346544433


No 115
>>3ksm_A ABC-type sugar transport system, periplasmic component; PSI- II, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis kctc 2396} (A:1-106,A:243-276)
Probab=72.50  E-value=6.3  Score=18.85  Aligned_cols=82  Identities=10%  Similarity=0.148  Sum_probs=50.8

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCC---CHHHHHHHHHCC-CCEEEEEC-CCCCCHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             99999976994799807874336688---978988742026-86899964-88762345555541798279961544765
Q gi|254780901|r  112 MMRFLSHCSVNANMYIPDRIVDGYGP---NPSLMEKFINEG-AQLIITVD-CGSTSYDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       112 l~~~L~~~g~~v~~~IP~R~~eGYGl---~~~~i~~~~~~g-~~LiItvD-~Gi~~~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                      +...++..|.++.....+    +++-   ....++.+...+ .+.||..- ......+.++.+++.||-|+..|......
T Consensus        22 ie~~a~~~Gy~vii~~~~----~~~d~~~q~~~i~~li~~~~~dgIIl~~~~~~~~~~~l~~l~~~gIPvV~id~~i~~~   97 (140)
T 3ksm_A           22 AQKAADEAGVTLLHRSTK----DDGDIAGQIQILSYHLSQAPPDALILAPNSAEDLTPSVAQYRARNIPVLVVDSDLAGD   97 (140)
T ss_dssp             HHHHHHHHTCEEEECCCS----STTCHHHHHHHHHHHHHHSCCSEEEECCSSTTTTHHHHHHHHHTTCCEEEESSCCSSS
T ss_pred             HHHHHHHCCCEEEEEECC----CCCCHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEECCCCCCCC
T ss_conf             999999839989999589----9879999999999999708998999937985777999999997799499736644678


Q ss_pred             CCCCCEEEECCC
Q ss_conf             556725652378
Q gi|254780901|r  187 EEIPAYALVNPN  198 (600)
Q Consensus       187 ~~p~a~aivNP~  198 (600)
                      .. .++...||.
T Consensus        98 ~~-~~~V~~D~~  108 (140)
T 3ksm_A           98 AH-QGLVATDPE  108 (140)
T ss_dssp             CS-SEEEECCHH
T ss_pred             CC-CEEEEECHH
T ss_conf             76-408984499


No 116
>>2h06_A Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A (A:1-147,A:293-326)
Probab=72.40  E-value=6.4  Score=18.84  Aligned_cols=73  Identities=19%  Similarity=0.208  Sum_probs=53.7

Q ss_pred             CCCEEEEECCCC---CHHHHHHHHHHHHHHCCC-CEEEEECC--------CCCCCCCCCHHHHHHHHHC-CCCEEEEECC
Q ss_conf             997999940788---615289999999997699-47998078--------7433668897898874202-6868999648
Q gi|254780901|r   92 SEKIMIFGDYDV---DGAASVALMMRFLSHCSV-NANMYIPD--------RIVDGYGPNPSLMEKFINE-GAQLIITVDC  158 (600)
Q Consensus        92 ~ekI~I~gDyD~---DGitstail~~~L~~~g~-~v~~~IP~--------R~~eGYGl~~~~i~~~~~~-g~~LiItvD~  158 (600)
                      ++.+.|..+.-.   |-+.-..++..+|+..|+ ++...+|-        |+.+|=-++...+-++.+. |++-+||+|-
T Consensus        50 g~dV~iiqs~~~~~nd~lmELlllidAlr~~gA~~ItlViPYl~YaRQDR~~~~GE~isak~vA~lL~~~G~d~vitvD~  129 (181)
T 2h06_A           50 GEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDL  129 (181)
T ss_dssp             TCEEEEECCCCSCHHHHHHHHHHHHHHHHTTTBSEEEEEESSCTTTTCCSCSSSSCCCHHHHHHHHHHHHTCCEEEEESC
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCEEHHHHHHHHHHCCCCEEEEECC
T ss_conf             99589995899983067999999999987606654047414331222464347886212999999998638872899806


Q ss_pred             CCCCHH
Q ss_conf             876234
Q gi|254780901|r  159 GSTSYD  164 (600)
Q Consensus       159 Gi~~~e  164 (600)
                      -+...+
T Consensus       130 Hs~~i~  135 (181)
T 2h06_A          130 HASQIQ  135 (181)
T ss_dssp             SSGGGG
T ss_pred             CHHHHH
T ss_conf             868872


No 117
>>2r7a_A Bacterial heme binding protein; periplasmic binding protein, heme transport, transport protein; HET: HEM; 2.05A {Shigella dysenteriae} PDB: 2rg7_A (A:1-91)
Probab=72.40  E-value=6.4  Score=18.83  Aligned_cols=68  Identities=15%  Similarity=0.162  Sum_probs=40.8

Q ss_pred             HHHHHHHCCCC-EEE------EECCCCC----CCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             99999976994-799------8078743----366889789887420268689996488762345555541798279961
Q gi|254780901|r  112 MMRFLSHCSVN-ANM------YIPDRIV----DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       112 l~~~L~~~g~~-v~~------~IP~R~~----eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtD  180 (600)
                      ..+.|..+|.. .-.      +.|....    -|..-+.. +|.+.+-.++|||.- .+...-+.++.++++|+.|+++|
T Consensus        12 ~~e~l~aLG~~~~ivg~~~~~~~~~~~~~~~~~g~~~~~n-~E~i~~l~PDlii~~-~~~~~~~~~~~L~~~gi~v~~~~   89 (91)
T 2r7a_A           12 LTELIYAMGAGERVVGVDETTSYPPETAKLPHIGYWKQLS-SEGILSLRPDSVITW-QDAGPQIVLDQLRAQKVNVVTLP   89 (91)
T ss_dssp             HHHHHHHTTCGGGEEEECTTCCCSGGGGGSCBCSCTTSCC-HHHHHTTCCSEEEEE-TTCSCHHHHHHHHHTTCEEEEEC
T ss_pred             HHHHHHHCCCCCEEEEEECCCCCCHHHHCCCEECCCCCCC-HHHHHHCCCCEEEEE-CCCCCHHHHHHHHHCCCEEEEEC
T ss_conf             8999997699980799857777827770487307888989-999984099807853-36540267789885283599842


Q ss_pred             C
Q ss_conf             5
Q gi|254780901|r  181 H  181 (600)
Q Consensus       181 H  181 (600)
                      -
T Consensus        90 ~   90 (91)
T 2r7a_A           90 R   90 (91)
T ss_dssp             C
T ss_pred             C
T ss_conf             5


No 118
>>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} (A:1-119)
Probab=72.37  E-value=6.4  Score=18.83  Aligned_cols=76  Identities=11%  Similarity=0.196  Sum_probs=47.6

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH---------------CCCCEEE
Q ss_conf             7799799994078861528999999999769947998078743366889789887420---------------2686899
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN---------------EGAQLII  154 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~---------------~g~~LiI  154 (600)
                      .+++||.++|    =|.|+-+-+.++|...|++|..+=-..       +.+..+.+.+               ++++++|
T Consensus        17 ~~~~kv~viG----lG~sG~salA~~L~~~G~~V~~~D~~~-------~~~~~~~L~~~gi~~~~g~~~~~~~~~~D~vV   85 (119)
T 3hn7_A           17 FQGXHIHILG----ICGTFXGSLALLARALGHTVTGSDANI-------YPPXSTQLEQAGVTIEEGYLIAHLQPAPDLVV   85 (119)
T ss_dssp             --CCEEEEET----TTSHHHHHHHHHHHHTTCEEEEEESCC-------CTTHHHHHHHTTCEEEESCCGGGGCSCCSEEE
T ss_pred             CCCCEEEEEE----ECHHHHHHHHHHHHHCCCEEEEEECCC-------CCHHHHHHHHCCCEEECCCCHHHCCCCCCEEE
T ss_conf             6898899996----788999999999996899499990999-------95789999968998984889899599997899


Q ss_pred             EECCCCC-CHHHHHHHHHCCCCEE
Q ss_conf             9648876-2345555541798279
Q gi|254780901|r  155 TVDCGST-SYDALQYATNQGIDVI  177 (600)
Q Consensus       155 tvD~Gi~-~~e~i~~a~~~GidvI  177 (600)
                      . --|+. +++++.+|+++|+.|+
T Consensus        86 ~-SPgi~~~~p~i~~a~~~gi~i~  108 (119)
T 3hn7_A           86 V-GNAXKRGXDVIEYXLDTGLRYT  108 (119)
T ss_dssp             E-CTTCCTTSHHHHHHHHHTCCEE
T ss_pred             E-CCCCCCCCHHHHHHHHCCCCEE
T ss_conf             8-9954999999999998799787


No 119
>>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* (A:1-97,A:210-269)
Probab=72.26  E-value=6.4  Score=18.81  Aligned_cols=87  Identities=17%  Similarity=0.323  Sum_probs=58.6

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCH---------HHHHHHHHCCCCEEEEECCCC
Q ss_conf             77997999940788615289999999997699479980787433668897---------898874202686899964887
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNP---------SLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~---------~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      ..+.+|.||-    -|+-+.+++.+..+.+-.+-.+|+-+.-.-.||--.         +.++.+.+.|+++||. =|.+
T Consensus         3 ~~~~~IgifD----SGvGGltv~~~i~~~lP~~~~iy~~D~~~~PYG~ks~~~i~~~~~~~~~~l~~~~~~~ivi-ACNT   77 (157)
T 3ist_A            3 AXKQAIGFID----SGVGGLTVVREVLKQLPHEQVYYLGDTARCPYGPRDKEEVAKFTWEXTNFLVDRGIKXLVI-ACNT   77 (157)
T ss_dssp             SSCCCEEEEE----SSSTTHHHHHHHHHHCTTCCEEEEECGGGCCCTTSCHHHHHHHHHHHHHHHHHTTCSEEEE-CCHH
T ss_pred             CCCCCEEEEE----CCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE-ECCC
T ss_conf             7779689996----8965799999999978999989995378999899999999999999999998659987999-4485


Q ss_pred             CCHHHHHHHHH-CCCCEEEECC
Q ss_conf             62345555541-7982799615
Q gi|254780901|r  161 TSYDALQYATN-QGIDVIVIDH  181 (600)
Q Consensus       161 ~~~e~i~~a~~-~GidvIVtDH  181 (600)
                      .+.-+.+.+++ .++.++....
T Consensus        78 as~~al~~l~~~~~~pi~~~a~   99 (157)
T 3ist_A           78 ATAAALYDIREKLDIPVIGVGE   99 (157)
T ss_dssp             HHHHHHHHHHHHCSSCEEESHH
T ss_pred             HHHHHHHHHHHHCCCCEEEEHH
T ss_conf             4789999998634886574179


No 120
>>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcription, transcription regulation; 2.35A {Burkholderia thailandensis E264} (A:1-108,A:241-291)
Probab=72.06  E-value=6.5  Score=18.78  Aligned_cols=104  Identities=8%  Similarity=-0.033  Sum_probs=64.5

Q ss_pred             HCCCCEEEEECCCCCHHHHH--HHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHH
Q ss_conf             77997999940788615289--9999999976994799807874336688978988742026868999648876234555
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASV--ALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQ  167 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitst--ail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~  167 (600)
                      .+...|.++-..=.+..-+.  .=+.+.++..|.++..+..+...+   .....++.+.+.+++-||.+.. -.+.+.++
T Consensus         6 gkS~~IGviip~l~~~f~~~ii~gie~aa~~~Gy~l~i~~~~~d~e---~~~~~l~~l~~~~vDGIII~~~-~~~~~~i~   81 (159)
T 3egc_A            6 KRSNVVGLIVSDIENVFFAEVASGVESEARHKGYSVLLANTAEDIV---REREAVGQFFERRVDGLILAPS-EGEHDYLR   81 (159)
T ss_dssp             -CCCEEEEEESCTTSHHHHHHHHHHHHHHHHTTCEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEECCC-SSCCHHHH
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEECC-CCCHHHHH
T ss_conf             9889999992999888999999999999998699899996899979---9999999998569738853101-21101589


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCCCEEEECCCC
Q ss_conf             55417982799615447655567256523788
Q gi|254780901|r  168 YATNQGIDVIVIDHHQVKSEEIPAYALVNPNR  199 (600)
Q Consensus       168 ~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~  199 (600)
                      .+.+.|+-+|+.|.-......|  +.-++.++
T Consensus        82 ~l~~~giPvV~id~~~~~~~~~--~V~~D~~~  111 (159)
T 3egc_A           82 TELPKTFPIVAVNRELRIPGCG--AVLSETRR  111 (159)
T ss_dssp             HSSCTTSCEEEESSCCCCTTCE--EEEECHHH
T ss_pred             HHHHHCCCCCCCCCCCCCCCCE--EEEEHHHH
T ss_conf             9986335542234555688744--89744999


No 121
>>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Thermotoga maritima} (A:165-294)
Probab=72.01  E-value=6.5  Score=18.77  Aligned_cols=76  Identities=16%  Similarity=0.290  Sum_probs=53.6

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHH----HHCCCCEEEEECCCCCCHHHH
Q ss_conf             7997999940788615289999999997699479980787433668897898874----202686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKF----INEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~----~~~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++-+|++.||  ..+=+.-+ +..++..+|.++...-|.    +|-+....++.+    ++.|.++.+|-|     .++ 
T Consensus         2 ~glkia~vGD--~~~rv~~S-~~~~~~~~g~~v~~~~P~----~~~~~~~~~~~~~~~~~~~g~~i~~~~d-----~~e-   68 (130)
T 1vlv_A            2 KGVKVVFMGD--TRNNVATS-LMIACAKMGMNFVACGPE----ELKPRSDVFKRCQEIVKETDGSVSFTSN-----LEE-   68 (130)
T ss_dssp             TTCEEEEESC--TTSHHHHH-HHHHHHHTTCEEEEESCG----GGCCCHHHHHHHHHHHHHHCCEEEEESC-----HHH-
T ss_pred             CCCCEEEECC--CCCEEEEH-HHHHHHHCCCEEEEEEEC----CCCCCCHHHHHHHHHCCCCCCCCCCCCC-----HHH-
T ss_conf             4455146415--55506413-788998769849999611----3235423454454420012355334359-----999-


Q ss_pred             HHHHHCCCCEEEECCC
Q ss_conf             5554179827996154
Q gi|254780901|r  167 QYATNQGIDVIVIDHH  182 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH  182 (600)
                         .=.|.|||+||-=
T Consensus        69 ---av~~aDviytd~w   81 (130)
T 1vlv_A           69 ---ALAGADVVYTDVW   81 (130)
T ss_dssp             ---HHTTCSEEEECCC
T ss_pred             ---HHHCCCHHHHHHH
T ss_conf             ---9834664554466


No 122
>>2iks_A DNA-binding transcriptional dual regulator; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 1.85A {Escherichia coli K12} (A:1-121,A:252-293)
Probab=71.96  E-value=6.5  Score=18.76  Aligned_cols=100  Identities=10%  Similarity=0.089  Sum_probs=60.3

Q ss_pred             HHHHHHCCCC--EEEEECCCCCHHHHHHHH---HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             9999977997--999940788615289999---99999769947998078743366889789887420268689996488
Q gi|254780901|r   85 IVQAIYNSEK--IMIFGDYDVDGAASVALM---MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        85 i~~ai~~~ek--I~I~gDyD~DGitstail---~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      .++++..++.  |+++- .|.+.---+.++   ...++..|..+..+.-+.-.|   --.+.++.+.+.+++-+|..-+.
T Consensus        11 ~ArsL~s~kS~tIgviv-pdl~~~ff~~ii~gI~~~a~~~Gy~vii~~s~~~~e---~e~~~l~~l~~~~vDGiIl~~~~   86 (163)
T 2iks_A           11 VAAGLRAGRTRSIGLVI-PDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD---NEXRCIEHLLQRQVDAIIVSTSL   86 (163)
T ss_dssp             -------CCCCEEEEEE-SCSCSHHHHHHHHHHHHHHHHTTCEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEECCSS
T ss_pred             HHHHHHHCCCCEEEEEE-CCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHCCCCCCCEEEEECCC
T ss_conf             99998618999899992-999887999999999999998699999994799758---89998762014544357883143


Q ss_pred             CCCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             76234555554179827996154476555
Q gi|254780901|r  160 STSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       160 i~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      ..+.+.+..+.+.++.+|+.|...+....
T Consensus        87 ~~~~~~~~~l~~~~iPvVlid~~~~~~~~  115 (163)
T 2iks_A           87 PPEHPFYQRWANDPFPIVALDRALDREHF  115 (163)
T ss_dssp             CTTCHHHHTTTTSSSCEEEEESCCCTTTC
T ss_pred             CCCHHHHHHHHCCCCCEEEEECCCCCCCC
T ss_conf             32125777765169768998414433335


No 123
>>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica hm-1} PDB: 3bm5_A* (A:55-163)
Probab=71.53  E-value=6.6  Score=18.69  Aligned_cols=88  Identities=17%  Similarity=0.126  Sum_probs=55.8

Q ss_pred             HHHHHHHHHHCCC----CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             9999999997799----799994078861528999999999769947998078743366889789887420268689996
Q gi|254780901|r   81 AARRIVQAIYNSE----KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        81 A~~ri~~ai~~~e----kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      |...|.++++++.    .-.|..   -.|-++.|+-+-+ +.+|.++..++|..      .+...++.+..-|.++++ |
T Consensus         8 a~~~i~~~~~~~~~~~~~~iv~~---SsGN~g~alA~~a-~~~g~~~~vv~p~~------~~~~k~~~l~~~GA~V~~-v   76 (109)
T 2pqm_A            8 GFNIVYQAIKDGRLKPGMEIIES---TSGNTGIALCQAG-AVFGYRVNIAMPST------MSVERQMIMKAFGAELIL-T   76 (109)
T ss_dssp             HHHHHHHHHHHTSSCTTCEEEEE---CSSHHHHHHHHHH-HHHTCCEEEEEETT------SCHHHHHHHHHTTCEEEE-E
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEE---EECCHHHHHHHHH-HHHCCCCCCHHHCC------CCHHHHHHHHCCCCCCEE-E
T ss_conf             99999999865845799789985---4261132689999-98513520122113------566765422035764101-0


Q ss_pred             CCCCCCHHHHHHH----HHCCCCEEEE
Q ss_conf             4887623455555----4179827996
Q gi|254780901|r  157 DCGSTSYDALQYA----TNQGIDVIVI  179 (600)
Q Consensus       157 D~Gi~~~e~i~~a----~~~GidvIVt  179 (600)
                      |-|..--+.++.+    .+.|.-.+..
T Consensus        77 ~~~~~~~~~~~~a~~~~~~~~~~~~~~  103 (109)
T 2pqm_A           77 EGKKGMPGAIEEVNKMIKENPGKYFVA  103 (109)
T ss_dssp             CGGGHHHHHHHHHHHHHHHSTTTEEEC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             355665443223321000036626863


No 124
>>2r79_A Periplasmic binding protein; heme transport, transport protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} (A:1-91)
Probab=71.17  E-value=6.8  Score=18.64  Aligned_cols=38  Identities=13%  Similarity=0.149  Sum_probs=29.9

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             887420268689996488762345555541798279961
Q gi|254780901|r  142 MEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       142 i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtD  180 (600)
                      +|.+.+.+++|||. .++....+..+.+++.|+.|+++|
T Consensus        52 ~E~i~~l~PDlvi~-~~~~~~~~~~~~l~~~gi~v~v~~   89 (91)
T 2r79_A           52 AEGVLALRPDILIG-TEEMGPPPVLKQLEGAGVRVETLS   89 (91)
T ss_dssp             HHHHHTTCCSEEEE-CTTCCCHHHHHHHHHTTCCEEECC
T ss_pred             HHHHHHCCCCEEEE-ECCCCHHHHHHHHHHCCCCCCCCC
T ss_conf             99998459986997-356420557777653167321357


No 125
>>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} (A:)
Probab=71.16  E-value=6.8  Score=18.63  Aligned_cols=94  Identities=11%  Similarity=0.034  Sum_probs=56.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC-HHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             99999997799799994078861528999999999769947998078743366889-78988742026868999648876
Q gi|254780901|r   83 RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN-PSLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        83 ~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~-~~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      ++..+.+-+.++|+|.|--+=.|-.+..++ ..|+..|.++...=|.. .+=.|.. -..+.++.+ .+++++.+-.-..
T Consensus         5 ~~~l~~l~~p~~iaVvGas~~~~~~g~~i~-~~l~~~g~~v~~Vnp~~-~~i~g~~~y~sl~di~~-~vDl~vi~vp~~~   81 (138)
T 1y81_A            5 HHHGSNSKEFRKIALVGASKNPAKYGNIIL-KDLLSKGFEVLPVNPNY-DEIEGLKCYRSVRELPK-DVDVIVFVVPPKV   81 (138)
T ss_dssp             ---------CCEEEEETCCSCTTSHHHHHH-HHHHHTTCEEEEECTTC-SEETTEECBSSGGGSCT-TCCEEEECSCHHH
T ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCHHHHH-HHHHHCCCEEEEECCCC-CCCCCCCCCCCCCCCCC-CCEEEEEECCHHH
T ss_conf             457898621577999832799998199999-99997899799971554-31479735556411343-3206899807899


Q ss_pred             CHHHHHHHHHCCCCEEEE
Q ss_conf             234555554179827996
Q gi|254780901|r  162 SYDALQYATNQGIDVIVI  179 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIVt  179 (600)
                      ..+.++.|.++|+..++.
T Consensus        82 ~~~~v~ea~~~gi~~~~~   99 (138)
T 1y81_A           82 GLQVAKEAVEAGFKKLWF   99 (138)
T ss_dssp             HHHHHHHHHHTTCCEEEE
T ss_pred             HHHHHHHHHHCCCCEEEE
T ss_conf             999999998569988985


No 126
>>1vim_A Hypothetical protein AF1796; structural genomics, unknown function; 1.36A {Archaeoglobus fulgidus} (A:)
Probab=70.71  E-value=6.9  Score=18.56  Aligned_cols=88  Identities=10%  Similarity=0.200  Sum_probs=55.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEC
Q ss_conf             99999999997799799994078861528--9999999997699479980787433668897898874202686899964
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD  157 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD  157 (600)
                      +.++++.+.+.+.++|.|||   + |.+.  +.-+...|..+|..+.++.+....            .... -+++|.+.
T Consensus        35 ~~i~~i~~~i~~a~~I~i~G---~-G~S~~~a~~~~~~l~~~g~~~~~~~~~~~~------------~~~~-~dvvI~iS   97 (200)
T 1vim_A           35 ETVGEMIKLIDSARSIFVIG---A-GRSGYIAKAFAMRLMHLGYTVYVVGETVTP------------RITD-QDVLVGIS   97 (200)
T ss_dssp             HHHHHHHHHHHHSSCEEEEC---S-HHHHHHHHHHHHHHHHTTCCEEETTSTTCC------------CCCT-TCEEEEEC
T ss_pred             HHHHHHHHHHHCCCCEEEEE---E-CCCCCCHHHHCCCCCCCCCCCCCCCCHHHH------------EECC-CCEEEEEC
T ss_conf             99999999997199589993---1-642434233101222333222223210330------------0025-66156512


Q ss_pred             CCCCC---HHHHHHHHHCCCCEEE-ECCCCC
Q ss_conf             88762---3455555417982799-615447
Q gi|254780901|r  158 CGSTS---YDALQYATNQGIDVIV-IDHHQV  184 (600)
Q Consensus       158 ~Gi~~---~e~i~~a~~~GidvIV-tDHH~~  184 (600)
                      ..-.+   .+.++.|+++|+.||. |+....
T Consensus        98 ~sG~t~~~~~~~~~ak~~g~~vi~IT~~~~s  128 (200)
T 1vim_A           98 GSGETTSVVNISKKAKDIGSKLVAVTGKRDS  128 (200)
T ss_dssp             SSSCCHHHHHHHHHHHHHTCEEEEEESCTTS
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             3322023799999998623564366403554


No 127
>>3i3w_A Phosphoglucosamine mutase; csgid, IDP02164, isomerase, magnesium, metal-binding, phosphoprotein, structural genomics; HET: SEP; 2.30A {Francisella tularensis subsp} (A:153-256)
Probab=70.66  E-value=6.9  Score=18.56  Aligned_cols=76  Identities=18%  Similarity=0.126  Sum_probs=42.6

Q ss_pred             HHHHHHHHHHHHCC--CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHH--------HHHHHHHC
Q ss_conf             99999999999779--979999407886152899999999976994799807874336688978--------98874202
Q gi|254780901|r   79 DKAARRIVQAIYNS--EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPS--------LMEKFINE  148 (600)
Q Consensus        79 ~~A~~ri~~ai~~~--ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~--------~i~~~~~~  148 (600)
                      +.-++.+.+.+...  .+..|.  ||+..=++..++-+.|+.+|.++...  ++..+|++.|++        ..+.+.+.
T Consensus         3 ~~Y~~~~~~~id~~~~~~~kiv--~d~~~G~~~~~~~~ll~~lg~~~i~~--~~~~d~~~~~pep~~~~l~~l~~~v~~~   78 (104)
T 3i3w_A            3 DEYIESIYSRFAKFVNYKGKVV--VDCAHGAASHNFEALLDKFGINYVSI--ASNPDGLNINVGCGATCVSNIKKAVKEQ   78 (104)
T ss_dssp             HHHHHHHHHHHTTTCCCCSEEE--EECTTSTTTTHHHHHHHHTTCEEEES--SCCCCSSCTTTTCSTTCHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCHHCCCCCEEE--EECCCCCCCHHHHHHHHHCCCCCCEE--ECCCCCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             6655432212201104686499--97688851001244553036543214--1278999989888740578999999706


Q ss_pred             CCCEEEEECC
Q ss_conf             6868999648
Q gi|254780901|r  149 GAQLIITVDC  158 (600)
Q Consensus       149 g~~LiItvD~  158 (600)
                      ++++.|..|-
T Consensus        79 ~adlgi~~D~   88 (104)
T 3i3w_A           79 KADLGISLDG   88 (104)
T ss_dssp             TCSEEEEECT
T ss_pred             CCCEEEEECC
T ss_conf             9988999858


No 128
>>3ek6_A Uridylate kinase; UMPK unique GTP binding site, allosteric regulation, ATP-binding, cytoplasm kinase, nucleotide-binding; 2.34A {Xanthomonas campestris PV} PDB: 3ek5_A (A:)
Probab=70.51  E-value=7  Score=18.53  Aligned_cols=66  Identities=17%  Similarity=0.086  Sum_probs=30.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCC-CCCCCCHHHHHHHHHCCCCEEEEECCCC----CCHHHHHHHHHCCCC
Q ss_conf             99999999769947998078743-3668897898874202686899964887----623455555417982
Q gi|254780901|r  110 ALMMRFLSHCSVNANMYIPDRIV-DGYGPNPSLMEKFINEGAQLIITVDCGS----TSYDALQYATNQGID  175 (600)
Q Consensus       110 ail~~~L~~~g~~v~~~IP~R~~-eGYGl~~~~i~~~~~~g~~LiItvD~Gi----~~~e~i~~a~~~Gid  175 (600)
                      .+|..+|+..|.++....|.-+. ..=......+..+.+.|.-.|++-+.|+    ++.-+...|..++.+
T Consensus        89 ~~l~~~L~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~ipi~~g~~~~~~~~sD~~A~~lA~~l~a~  159 (243)
T 3ek6_A           89 LAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRAIEIGAD  159 (243)
T ss_dssp             HHHHHHHHHTTCCEEEEESSCBTTTBEECCHHHHHHHHHTTCEEEEESTTSSTTCCHHHHHHHHHHHHTCS
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             99999999659752663100021013555599999876515763212533346668647999999984732


No 129
>>2aml_A SIS domain protein; 46906266, LMO0035 protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes str} (A:27-183)
Probab=70.07  E-value=7.1  Score=18.47  Aligned_cols=105  Identities=10%  Similarity=0.055  Sum_probs=58.1

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHH--HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHH-HHCCCCEEEEE
Q ss_conf             9999999999779979999407886152899--99999997699479980787433668897898874-20268689996
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVA--LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKF-INEGAQLIITV  156 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitsta--il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~-~~~g~~LiItv  156 (600)
                      +..+.+.+.+.+.++|.|+|    -|.+...  .+...|..+|..+....+.         ....... ....-+++|.+
T Consensus        12 ~~~~~~~~~i~~a~~I~i~G----~G~S~~~a~~~~~~l~~~~~~~~~~~~~---------~~~~~~~~~~~~~dl~I~i   78 (157)
T 2aml_A           12 NAEKLESLVKNGAKEWLILA----TGSSLNAAQSAKYYIENLADVRITIEEP---------FNHLYYEKLSSHLDLVIGI   78 (157)
T ss_dssp             HHHHHHTTCTTCCCEEEEEE----CHHHHHHHHHHHHHHHHHSSCEEEEECH---------HHHHHHCCCCTTCCEEEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEE----ECHHHHHHHHHHHHHHHHHCCCEEEECH---------HHHHCCCCCCCCCCEEEEE
T ss_conf             59999999866899899999----6359999999999999974998699652---------5653146655567269998


Q ss_pred             CCCCCCH---HHHHHHHHCC-CCEE-EECCCCCCCCCCCCEEEECCC
Q ss_conf             4887623---4555554179-8279-961544765556725652378
Q gi|254780901|r  157 DCGSTSY---DALQYATNQG-IDVI-VIDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       157 D~Gi~~~---e~i~~a~~~G-idvI-VtDHH~~~~~~p~a~aivNP~  198 (600)
                      -..=.+.   +.++.++++| +.+| |||-+..|= ...++..+.+.
T Consensus        79 S~sG~~~~~~~~~~~~~~~g~~~vi~iT~~~~s~l-~~~ad~~l~~~  124 (157)
T 2aml_A           79 SQSGQSTSTISALERVKKEASVPVVALTSDVTSEI-AEFADITLDIG  124 (157)
T ss_dssp             CSSSCBHHHHHHHHHHHHHCCCCEEEEESCTTSGG-GGGCSEEEECS
T ss_pred             ECCCCCHHHHHHHHHHHCCCCEEEEEECCCCHHHH-HHHCCCCCCCC
T ss_conf             56899657899999753045236987448721343-54246442246


No 130
>>2jfg_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; nucleotide-binding, peptidoglycan synthesis, MURD ligase, ATP-binding, cell division, UMA, ADP; HET: KCX UMA ADP; 1.52A {Escherichia coli} (A:1-103)
Probab=69.93  E-value=7.1  Score=18.44  Aligned_cols=80  Identities=18%  Similarity=0.282  Sum_probs=46.7

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC-----CCCCCCCCCHH---HHHHHHHCCCCEEEEECCCCC-
Q ss_conf             799799994078861528999999999769947998078-----74336688978---988742026868999648876-
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD-----RIVDGYGPNPS---LMEKFINEGAQLIITVDCGST-  161 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~-----R~~eGYGl~~~---~i~~~~~~g~~LiItvD~Gi~-  161 (600)
                      ++++|+|+|    =|.++.+. .++|.+.|.+|..+=..     +.....|....   ...... .+.++++. ..|+. 
T Consensus         5 ~~k~V~ViG----~G~~G~~~-A~~L~~~G~~V~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~v~-~~~i~~   77 (103)
T 2jfg_A            5 QGKNVVIIG----LGLTGLSC-VDFFLARGVTPRVMDTRMTPPGLDKLPEAVERHTGSLNDEWL-MAADLIVA-SPGIAL   77 (103)
T ss_dssp             TTCCEEEEC----CSHHHHHH-HHHHHHTTCCCEEEESSSSCTTGGGSCTTSCEEESBCCHHHH-HHCSEEEE-CTTSCT
T ss_pred             CCCEEEEEE----ECHHHHHH-HHHHHHCCCEEEEEECCCCCCHHHHHHHCCCEEECCCCHHHC-CCCCEEEE-CCCCCC
T ss_conf             899899999----88999999-999997879599997989932589998488976467797785-89889998-992588


Q ss_pred             CHHHHHHHHHCCCCEE
Q ss_conf             2345555541798279
Q gi|254780901|r  162 SYDALQYATNQGIDVI  177 (600)
Q Consensus       162 ~~e~i~~a~~~GidvI  177 (600)
                      .++++..++++|+.++
T Consensus        78 ~~~~~~~~~~~gi~i~   93 (103)
T 2jfg_A           78 AHPSLSAAADAGIEIV   93 (103)
T ss_dssp             TSHHHHHHHHTTCEEE
T ss_pred             CCHHHHHHHHCCCEEE
T ss_conf             9999999998599099


No 131
>>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* (A:1-117,A:229-290)
Probab=69.87  E-value=7.2  Score=18.44  Aligned_cols=84  Identities=19%  Similarity=0.394  Sum_probs=58.2

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCH---------HHHHHHHHCCCCEEEEECCC
Q ss_conf             977997999940788615289999999997699479980787433668897---------89887420268689996488
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNP---------SLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~---------~~i~~~~~~g~~LiItvD~G  159 (600)
                      ..++.+|.||-    -|+-+.+++.+..+.+-..-.+|+-+.-.-.||--.         +.++.+.+.|+++||. =|.
T Consensus        21 ~~~~~~IgifD----SG~GGLtv~~~i~~~lP~~~~iy~~D~a~~PYG~ks~~~i~~~~~~~~~~l~~~~~~~iVi-ACN   95 (179)
T 2vvt_A           21 MSNQEAIGLID----SGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVI-ACN   95 (179)
T ss_dssp             CGGGSCEEEEE----SSSTTHHHHHHHHHHCTTSCEEEEECTTTCCCTTSCHHHHHHHHHHHHHHHHTTTCSEEEE-CCH
T ss_pred             CCCCCCEEEEE----CCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEE-ECC
T ss_conf             47899689997----8968899999999978999989994488999898999999999999999997538860476-233


Q ss_pred             CCCHHHHHHHHH-CCCCEE
Q ss_conf             762345555541-798279
Q gi|254780901|r  160 STSYDALQYATN-QGIDVI  177 (600)
Q Consensus       160 i~~~e~i~~a~~-~GidvI  177 (600)
                      +.+.-+.+.+++ .++.||
T Consensus        96 Tasa~al~~l~~~~~ipvi  114 (179)
T 2vvt_A           96 TATAVALEEIKAALPIPVV  114 (179)
T ss_dssp             HHHHHHHHHHHHHCSSCEE
T ss_pred             HHHHHHHHHHHHCCCCCEE
T ss_conf             6889999988533576667


No 132
>>2pjk_A 178AA long hypothetical molybdenum cofactor biosynthesis protein B; 3D-structure, structural genomics, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii} (A:)
Probab=69.82  E-value=7.2  Score=18.43  Aligned_cols=51  Identities=20%  Similarity=0.344  Sum_probs=33.1

Q ss_pred             HHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHH-CCCCEEEEECCCCCCH
Q ss_conf             28999999999769947998--078743366889789887420-2686899964887623
Q gi|254780901|r  107 ASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFIN-EGAQLIITVDCGSTSY  163 (600)
Q Consensus       107 tstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~-~g~~LiItvD~Gi~~~  163 (600)
                      +....|...|++.|.++.++  +|+...+    =.+.+.++.+ .++++|||.  |-++.
T Consensus        40 ~n~~~l~~~l~~~G~~v~~~~~v~Dd~~~----i~~~i~~~~~~~~~DlVitt--GG~g~   93 (178)
T 2pjk_A           40 ESGDIIKQLLIENGHKIIGYSLVPDDKIK----ILKAFTDALSIDEVDVIIST--GGTGY   93 (178)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEEEECSCHHH----HHHHHHHHHTCTTCCEEEEE--SCCSS
T ss_pred             CHHHHHHHHHHHCCCEEEEEEECCCHHHH----HHHHHHHHHHCCCCEEEECC--CCCCC
T ss_conf             46999999999889989998741540999----99999998860475388526--88766


No 133
>>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} (A:144-293)
Probab=69.78  E-value=7.2  Score=18.42  Aligned_cols=74  Identities=8%  Similarity=0.055  Sum_probs=47.2

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC--CCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             979999407886152899999999976994799807874336--688978988742026868999648876234555554
Q gi|254780901|r   93 EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG--YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYAT  170 (600)
Q Consensus        93 ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eG--YGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~  170 (600)
                      ..|.+.|      .--+.|+-..+..+.......+++--..|  ||.+.+.++.+.+.|-..+  +|....   .+..++
T Consensus         3 RpivlsG------~gk~~l~~~L~~~~p~~f~~~~~~tr~~~~~YGts~~~i~~~~~~gk~~i--ldv~~~---g~~~l~   71 (150)
T 3kfv_A            3 RPVVILG------PVADIAXQKLTAEXPDQFEIAETVSRTDSPSKIIKLDTVRVIAEKDKHAL--LDVTPS---AIERLN   71 (150)
T ss_dssp             CCEEEES------TTHHHHHHHHHHHCTTTEEECCCC--------CCCHHHHHHHHHTTCEEE--ECCCHH---HHHHHH
T ss_pred             CCEEEEC------CCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEE--EECCHH---HHHHHH
T ss_conf             8669967------30457888887768424552201465657556503789999996498799--968879---999998


Q ss_pred             HCCCCEE
Q ss_conf             1798279
Q gi|254780901|r  171 NQGIDVI  177 (600)
Q Consensus       171 ~~GidvI  177 (600)
                      +...+.+
T Consensus        72 ~~~~~~~   78 (150)
T 3kfv_A           72 YVQYYPI   78 (150)
T ss_dssp             HTTCCCE
T ss_pred             HCCCCCC
T ss_conf             6267650


No 134
>>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} (F:)
Probab=69.46  E-value=7.3  Score=18.37  Aligned_cols=68  Identities=10%  Similarity=-0.010  Sum_probs=40.4

Q ss_pred             HHHHHHHHHCCCC-EEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             9999999976994-79980787433668897898874202686899964887623455555417982799
Q gi|254780901|r  110 ALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIV  178 (600)
Q Consensus       110 ail~~~L~~~g~~-v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIV  178 (600)
                      .-+...+...|.. +..+-..|.....|.+.+.+..+.+. +++-|.++-||.+.+.+..+.+.|.|-++
T Consensus       155 ~~~~~~~~~~g~~~i~~~~~~~~~~~~~~~~~~i~~~~~~-~~ipvia~GGI~s~~D~~~~l~~GadgV~  223 (252)
T 1ka9_F          155 VEWAVKGVELGAGEILLTSMDRDGTKEGYDLRLTRMVAEA-VGVPVIASGGAGRMEHFLEAFQAGAEAAL  223 (252)
T ss_dssp             HHHHHHHHHHTCCEEEEEETTTTTTCSCCCHHHHHHHHHH-CSSCEEEESCCCSHHHHHHHHHTTCSEEE
T ss_pred             HHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHCCCCEEE
T ss_conf             9999999866998899985412266678327999999862-38859997689999999999978997999


No 135
>>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer; 1.60A {Thermus thermophilus} (A:395-592)
Probab=69.41  E-value=7.3  Score=18.37  Aligned_cols=89  Identities=15%  Similarity=0.237  Sum_probs=62.1

Q ss_pred             CCEEEEECCCCCH-------------HHHHHHHHHHHHHCCCCEEEEECCCCCCCCC---------CCHHHHHHHHHCCC
Q ss_conf             9799994078861-------------5289999999997699479980787433668---------89789887420268
Q gi|254780901|r   93 EKIMIFGDYDVDG-------------AASVALMMRFLSHCSVNANMYIPDRIVDGYG---------PNPSLMEKFINEGA  150 (600)
Q Consensus        93 ekI~I~gDyD~DG-------------itstail~~~L~~~g~~v~~~IP~R~~eGYG---------l~~~~i~~~~~~g~  150 (600)
                      -+|.|+=|||.+=             .....=.|++|+..|..+.+.=|+..-.+|-         ++.+.++...+.|-
T Consensus         4 a~VAil~s~es~~a~~~~~~~~~~~~~~~~~~~y~aL~~~gi~vDvi~~~~dls~Y~lli~P~~~~~~~e~L~~~v~~GG   83 (198)
T 1kwg_A            4 APVALVFDYEAAWIYEVQPQGAEWSYLGLVYLFYSALRRLGLDVDVVPPGASLRGYAFAVVPSLPIVREEALEAFREAEG   83 (198)
T ss_dssp             CSEEEECCHHHHHHHHHCCSSTTCCHHHHHHHHHHHHHTTTCCEEEECTTSCCTTCSEEEESCCSSCCHHHHHHHHTCSS
T ss_pred             CCEEEECCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHCCC
T ss_conf             76689434666566412578887688999999999999769873003777762348289973444589999999997699


Q ss_pred             CEEEEECCCCCCHHHH--------HHHHHCCCCEEEECC
Q ss_conf             6899964887623455--------555417982799615
Q gi|254780901|r  151 QLIITVDCGSTSYDAL--------QYATNQGIDVIVIDH  181 (600)
Q Consensus       151 ~LiItvD~Gi~~~e~i--------~~a~~~GidvIVtDH  181 (600)
                      .||.|..+|..+..-.        ....-.|+.+-=.|.
T Consensus        84 ~li~~~~tG~~d~~~~~~~~~~p~~L~~l~Gv~~~~~~~  122 (198)
T 1kwg_A           84 PVLFGPRSGSKTETFQIPKELPPGPLQALLPLKVVRVES  122 (198)
T ss_dssp             CEEECTTTTCCCTTSCCCTTCTTGGGGGTSCCEEEEEEE
T ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCHHHCCCEEEEEEC
T ss_conf             689943677478766445677884203223843789874


No 136
>>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} (A:)
Probab=69.32  E-value=2.7  Score=21.79  Aligned_cols=120  Identities=11%  Similarity=0.051  Sum_probs=73.9

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCCCH-HHHHHHHHCCCCEEEEECCCC
Q ss_conf             9999999779979999407886152899999999976994799807874-33668897-898874202686899964887
Q gi|254780901|r   83 RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI-VDGYGPNP-SLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        83 ~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~-~eGYGl~~-~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      .+..+.+.+-++|+|+|--+--|-.+..+ .+.|+..|.++..+-|+.. .+=.|... ..+.++. ..+++++.+-.-.
T Consensus         4 ~~~~~~l~~p~siaViGaS~~~~~~g~~v-~~~L~~~g~~~~~~~p~~~~~~i~g~~~~~sl~~~~-~~~D~vvi~vp~~   81 (140)
T 1iuk_A            4 QELRAYLSQAKTIAVLGAHKDPSRPAHYV-PRYLREQGYRVLPVNPRFQGEELFGEEAVASLLDLK-EPVDILDVFRPPS   81 (140)
T ss_dssp             HHHHHHHHHCCEEEEETCCSSTTSHHHHH-HHHHHHTTCEEEEECGGGTTSEETTEECBSSGGGCC-SCCSEEEECSCHH
T ss_pred             HHHHHHHHCCCEEEEEEECCCCCCCHHHH-HHHHHHCCCEEEEECCCCCCCEECCEEEECCHHHCC-CCCCEEEEEECHH
T ss_conf             99999986799599992269999719999-999972898389978767642556827525567758-9972899980889


Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCCCC-----CCEEEECCCCCCCCC
Q ss_conf             62345555541798279961544765556-----725652378888643
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSEEI-----PAYALVNPNRLDDLS  204 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~~p-----~a~aivNP~~~~~~~  204 (600)
                      ...+.++.+.++|+..++.--|-..++.-     ....+|-|+=.+...
T Consensus        82 ~~~~~l~e~~~~g~~~~~~~~g~~~e~~~~~~~~~gi~vvgpnc~G~~~  130 (140)
T 1iuk_A           82 ALMDHLPEVLALRPGLVWLQSGIRHPEFEKALKEAGIPVVADRCLMVEH  130 (140)
T ss_dssp             HHTTTHHHHHHHCCSCEEECTTCCCHHHHHHHHHTTCCEEESCCHHHHH
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCEEECCCCCHHHH
T ss_conf             9899999999649898998989779999999999699799289308488


No 137
>>2yyb_A Hypothetical protein TTHA1606; structural genomics, unknown function, NPPSFA; 2.60A {Thermus thermophilus HB8} (A:103-213)
Probab=69.09  E-value=4.8  Score=19.79  Aligned_cols=38  Identities=18%  Similarity=0.242  Sum_probs=30.9

Q ss_pred             HHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             87420268689996488762345555541798279961544
Q gi|254780901|r  143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       143 ~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      +.+.+.|++++||-|.   .+-..-.|.++|+.+|...||.
T Consensus        73 ~~~~~ag~D~~ITGe~---~~h~~~~A~~~gi~li~~gH~~  110 (111)
T 2yyb_A           73 GLLPKVDADLFVTGEP---KHSVFHETFERGLNVIYAGHYD  110 (111)
T ss_dssp             GGGGGCCSSEEEESCC---CGGGHHHHHHTTCEEEECCHHH
T ss_pred             CHHHHCCCCEEEECCC---CHHHHHHHHHCCCEEEECCCHH
T ss_conf             2577468478984676---7589999997599799909589


No 138
>>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} (G:1-46,G:242-298,G:405-453)
Probab=69.08  E-value=2  Score=22.81  Aligned_cols=43  Identities=19%  Similarity=0.215  Sum_probs=27.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCE
Q ss_conf             68689996488762345555541798279961544765556725
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY  192 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~  192 (600)
                      ..+++| +-.|++-.....++.+.|.+|++.|++....|+|.++
T Consensus        11 ~~DviI-IG~G~aG~~~A~~la~~G~~VlvlE~~~~~gEl~Q~F   53 (152)
T 2bcg_G           11 DYDVIV-LGTGITECILSGLLSVDGKKVLHIDKQDHYGELPQGF   53 (152)
T ss_dssp             BCSEEE-ECCSHHHHHHHHHHHHTTCCEEEECSSSSSTHHHHHH
T ss_pred             CCCEEE-ECCCHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHH
T ss_conf             887899-8959899999999998899899988999998999999


No 139
>>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} (A:1-116)
Probab=69.06  E-value=7.4  Score=18.31  Aligned_cols=78  Identities=18%  Similarity=0.180  Sum_probs=39.2

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-------CCCC----CCCCHHHHHHHHHCCCCEEEEECC
Q ss_conf             77997999940788615289999999997699479980787-------4336----688978988742026868999648
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR-------IVDG----YGPNPSLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R-------~~eG----YGl~~~~i~~~~~~g~~LiItvD~  158 (600)
                      .++++|+|+|    =|.|+-+-+.++|...|++|..+=-+-       ..+|    +|-+++.     -.+++++|. --
T Consensus        16 ~~~~~v~viG----lG~sG~salA~~L~~~G~~V~~~D~~~~~~~~~~~~~g~~~~~g~~~~~-----l~~~d~vV~-SP   85 (116)
T 1p3d_A           16 RRVQQIHFIG----IGGAGXSGIAEILLNEGYQISGSDIADGVVTQRLAQAGAKIYIGHAEEH-----IEGASVVVV-SS   85 (116)
T ss_dssp             TTCCEEEEET----TTSTTHHHHHHHHHHHTCEEEEEESCCSHHHHHHHHTTCEEEESCCGGG-----GTTCSEEEE-CT
T ss_pred             HCCCEEEEEE----ECHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHCCCEEECCCCHHH-----CCCCCEEEE-CC
T ss_conf             1377899999----6699999999999978893999928999799999978799987999899-----699999998-99


Q ss_pred             CCC-CHHHHHHHHHCCCCEE
Q ss_conf             876-2345555541798279
Q gi|254780901|r  159 GST-SYDALQYATNQGIDVI  177 (600)
Q Consensus       159 Gi~-~~e~i~~a~~~GidvI  177 (600)
                      |+. +++.+..|+++|+.|+
T Consensus        86 gi~~~~p~~~~a~~~gi~i~  105 (116)
T 1p3d_A           86 AIKDDNPELVTSKQKRIPVI  105 (116)
T ss_dssp             TSCTTCHHHHHHHHTTCCEE
T ss_pred             CCCCCCHHHHHHHHCCCCEE
T ss_conf             74998999999998699697


No 140
>>3i09_A Periplasmic branched-chain amino acid-binding protein; YP_104442.1, periplasmic binding protein BMA293, structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} (A:123-255,A:318-375)
Probab=69.05  E-value=7.4  Score=18.31  Aligned_cols=92  Identities=13%  Similarity=0.069  Sum_probs=66.1

Q ss_pred             HHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             99999999--7799799994078861528999999999769947998078743366889789887420268689996488
Q gi|254780901|r   82 ARRIVQAI--YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        82 ~~ri~~ai--~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      +.-+.+.+  ....+|.++..=|+-|-+...-+.+.++..|.++....+....  .-=-...+.++.+.+++.|+.+-.|
T Consensus         6 a~~~a~~l~~~g~k~Vaii~~D~ayG~~~~~~~~~~l~~~G~~Vv~~~~~~~~--~tDfss~l~~i~~s~advVil~~~g   83 (191)
T 3i09_A            6 AKGTGSAVVKQGGKTWFFLTADYAFGKALEKNTADVVKANGGKVLGEVRHPLS--ASDFSSFLLQAQSSKAQILGLANAG   83 (191)
T ss_dssp             HHHHHHHHHHTTCCEEEEEEESSHHHHHHHHHHHHHHHHTTCEEEEEEEECTT--CSCCHHHHHHHHHTCCSEEEEECCH
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCC--CCCCHHHHHHHHHCCCCEEEEECCC
T ss_conf             99999998751377899951687187899999999887449648888960675--6541379988762599889990577


Q ss_pred             CCCHHHHHHHHHCCCC
Q ss_conf             7623455555417982
Q gi|254780901|r  160 STSYDALQYATNQGID  175 (600)
Q Consensus       160 i~~~e~i~~a~~~Gid  175 (600)
                      -.....+..+++.|++
T Consensus        84 ~d~~~~ikqa~e~Gl~   99 (191)
T 3i09_A           84 GDTVNAIKAAKEFGIT   99 (191)
T ss_dssp             HHHHHHHHHHHHTTGG
T ss_pred             CHHHHHHHHHHHCCCC
T ss_conf             0689999999980988


No 141
>>3fxa_A SIS domain protein; YP_013136.1, putative sugar-phosphate isomerase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Listeria monocytogenes str} (A:)
Probab=68.48  E-value=7.6  Score=18.23  Aligned_cols=94  Identities=15%  Similarity=0.235  Sum_probs=52.6

Q ss_pred             HHHHHHHHHHHCC-CCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             9999999999779-9799994078861528--999999999769947998078743366889789887420268689996
Q gi|254780901|r   80 KAARRIVQAIYNS-EKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        80 ~A~~ri~~ai~~~-ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      +..+++.+.+.+. .+|.|+|    -|.+.  +.-+...|..+|..+.+.-.     .+.+. .  ....-..-+++|.+
T Consensus        32 ~~l~~~~~~l~~a~~~I~i~G----~G~s~~~a~~~~~~l~~~g~~~~~~~~-----~~~~~-~--~~~~~~~~d~vI~i   99 (201)
T 3fxa_A           32 EALVKTVEKIAECTGKIVVAG----CGTSGVAAKKLVHSFNCIERPAVFLTP-----SDAVH-G--TLGVLQKEDILILI   99 (201)
T ss_dssp             HHHHHHHHHHHHCSSCEEEEC----CTHHHHHHHHHHHHHHHTTCCEEECCH-----HHHTT-T--GGGGCCTTCEEEEE
T ss_pred             HHHHHHHHHHHHCCCCEEEEE----ECHHHHHHHHHHHHHHHCCCCEEECCC-----HHHHH-H--HHCCCCCCCEEEEE
T ss_conf             999999999993899289997----777999999999999858994485793-----68898-8--81388988889996


Q ss_pred             CCCCCC---HHHHHHHHHCCCCEE-EECCCCCC
Q ss_conf             488762---345555541798279-96154476
Q gi|254780901|r  157 DCGSTS---YDALQYATNQGIDVI-VIDHHQVK  185 (600)
Q Consensus       157 D~Gi~~---~e~i~~a~~~GidvI-VtDHH~~~  185 (600)
                      -..-.+   .+.++.|++.|+.|| |||.-..|
T Consensus       100 S~sG~t~~~~~~~~~ak~~g~~vI~IT~~~~s~  132 (201)
T 3fxa_A          100 SKGGNTGELLNLIPACKTKGSTLIGVTENPDSV  132 (201)
T ss_dssp             CSSSCCHHHHTTHHHHHHHTCEEEEEESCTTSH
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             799982689999999998399189983699996


No 142
>>1m65_A Hypothetical protein YCDX; structural genomics, beta-alpha-barrel, zinc, metallo- enzyme, structure 2 function project, S2F, unknown function; 1.57A {Escherichia coli} (A:)
Probab=68.46  E-value=3.9  Score=20.51  Aligned_cols=30  Identities=17%  Similarity=0.268  Sum_probs=17.8

Q ss_pred             CCCCCCHHH-HHHHHHCCCC-EEEECCCCCCC
Q ss_conf             488762345-5555417982-79961544765
Q gi|254780901|r  157 DCGSTSYDA-LQYATNQGID-VIVIDHHQVKS  186 (600)
Q Consensus       157 D~Gi~~~e~-i~~a~~~Gid-vIVtDHH~~~~  186 (600)
                      ++|....++ ++.|++.|++ +.||||+.+..
T Consensus        14 ~dg~~~~e~~~~~A~~~G~~~i~iTDH~~~~~   45 (245)
T 1m65_A           14 THAYSTLSDYIAQAKQKGIKLFAITDHGPDME   45 (245)
T ss_dssp             TTCCCCHHHHHHHHHHHTCCEEEEEEECTTST
T ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             98658799999999987999999938987645


No 143
>>2is8_A Molybdopterin biosynthesis enzyme, MOAB; globular alpha/beta fold, structural genomics, NPPSFA; 1.64A {Thermus thermophilus HB8} (A:)
Probab=67.71  E-value=6.1  Score=19.00  Aligned_cols=50  Identities=22%  Similarity=0.354  Sum_probs=34.1

Q ss_pred             HHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHH-CCCCEEEEECCCCCC
Q ss_conf             28999999999769947998--078743366889789887420-268689996488762
Q gi|254780901|r  107 ASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFIN-EGAQLIITVDCGSTS  162 (600)
Q Consensus       107 tstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~-~g~~LiItvD~Gi~~  162 (600)
                      |.+..|...|+.+|.++.++  +|+...+    -.++++++.+ .++++|||.  |-++
T Consensus        21 ~n~~~l~~~l~~~G~~v~~~~~v~Dd~~~----i~~ai~~~~~~~~~dlvitt--GG~g   73 (164)
T 2is8_A           21 TTHLAIREVLAGGPFEVAAYELVPDEPPM----IKKVLRLWADREGLDLILTN--GGTG   73 (164)
T ss_dssp             CHHHHHHHHHTTSSEEEEEEEEECSCHHH----HHHHHHHHHHTSCCSEEEEE--SCCS
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECCCCHHH----HHHHHHHHHHHCCCEEEEEE--CCCC
T ss_conf             51999999999779933687633664888----76578887750267588875--1577


No 144
>>1p3w_B Cysteine desulfurase; iron sulfur cluster, NIFS, CSDB, lyase; HET: PLP; 2.10A {Escherichia coli} (B:66-232)
Probab=67.62  E-value=7.9  Score=18.10  Aligned_cols=132  Identities=14%  Similarity=0.101  Sum_probs=84.2

Q ss_pred             CCHHHHHHHHHHHH----HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             48799999999999----77997999940788615289999999997699479980787433668897898874202686
Q gi|254780901|r   76 TDCDKAARRIVQAI----YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ  151 (600)
Q Consensus        76 ~dm~~A~~ri~~ai----~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~  151 (600)
                      .+...|......++    .++..+.+..   ...-.+..-..+.+...|.++....+   .+.+.+..+.+++..+..++
T Consensus         8 ~~~t~a~~~~~~~~~~~~~~~g~~vi~~---~~~~~~~~~~~~~~~~~~~~~~~i~~---~~~~~~d~~~~~~~i~~~t~   81 (167)
T 1p3w_B            8 SGATESDNLAIKGAANFYQKKGKHIITS---KTEHKAVLDTCRQLEREGFEVTYLAP---QRNGIIDLKELEAAMRDDTI   81 (167)
T ss_dssp             SCHHHHHHHHHHHHHHHHGGGCCEEEEE---TTSCHHHHHHHHHHHHTTCEEEEECC---CTTSCCCHHHHHHHCCTTEE
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCEEEEE---CCCCHHHHHHHHHHHHCCCEEEEECC---CCCCEECHHHHHHHCCCCCE
T ss_conf             9888999999987677415899989996---47320479999999976988999568---98880777999975799945


Q ss_pred             EEEEE--CCCCC---CHHHH-HHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCC----CCCCCHHHHHHHHHHH
Q ss_conf             89996--48876---23455-5554179827996154476555672565237888864----3344304788999999
Q gi|254780901|r  152 LIITV--DCGST---SYDAL-QYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDL----SGQGHLCAAGVVFLVL  219 (600)
Q Consensus       152 LiItv--D~Gi~---~~e~i-~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~----~p~~~l~gaGvaf~l~  219 (600)
                      +++.+  -+-+.   +.+++ +.+++.|+-+++=+.|......      ++|...+++    +..|.+++.|+.|.++
T Consensus        82 ~v~~~~~~n~~g~~~~i~~i~~~~~~~~~~~~~D~~~~~~~~~------~~~~~~g~d~~~~s~~K~~g~~g~G~~~~  153 (167)
T 1p3w_B           82 LVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLP------IDLSQLKVDLMSFSGHKIYGPKGIGALYV  153 (167)
T ss_dssp             EEECCSBCTTTCCBCCHHHHHHHHHHHTCEEEEECTTTTTTSC------CCTTTSCCSEEEEESTTTTSCTTCEEEEE
T ss_pred             EEEEEECCCCCCEECCHHHHHHHHHHCCCEEEEECCCCCCCCC------CCHHHCCCCEEEECCEEECCCCCEEEEEE
T ss_conf             9999327888722677999999985539889984542347766------66433177603200545536787189998


No 145
>>1g57_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavine biosynthesis, skeletal rearrangement, antimicrobial target; 1.40A {Escherichia coli} (A:)
Probab=67.57  E-value=6.2  Score=18.91  Aligned_cols=100  Identities=12%  Similarity=0.110  Sum_probs=53.0

Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCH--------HHHHHHHHHHH-HHCCCCEEEEECCCCCCCCCCCHHHH
Q ss_conf             5561487999999999997799799994078861--------52899999999-97699479980787433668897898
Q gi|254780901|r   72 PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDG--------AASVALMMRFL-SHCSVNANMYIPDRIVDGYGPNPSLM  142 (600)
Q Consensus        72 P~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DG--------itstail~~~L-~~~g~~v~~~IP~R~~eGYGl~~~~i  142 (600)
                      +..++.+...+++..+++++++.|.|+-|.|-++        -+.|.=...|+ +.-+.-++.-++.+.-+--||..-.-
T Consensus         6 ~~~~~~~~~~v~~ai~alr~G~~Viv~D~~~re~egdlv~aAe~~t~e~i~fm~~~~~Glic~a~~~~~a~~L~Lp~m~~   85 (217)
T 1g57_A            6 LSSFGTPFERVENALAALREGRGVMVLDDEDRENEGDMIFPAETMTVEQMALTIRHGSGIVCLCITEDRRKQLDLPMMVE   85 (217)
T ss_dssp             GGGGCCHHHHHHHHHHHHHTTCCEEEEC----CCCEEEEEETTTCCHHHHHHHHHHBCSCCEEEECHHHHHHTTCCBSCS
T ss_pred             HHHCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCEEEEECCHHHHHHCCCCCCCC
T ss_conf             43516942369999999988997999868998765058988565999999999981898199806899995559857454


Q ss_pred             HHHHHCCCCEEEEEC------CCCCCHHHHHHHHH
Q ss_conf             874202686899964------88762345555541
Q gi|254780901|r  143 EKFINEGAQLIITVD------CGSTSYDALQYATN  171 (600)
Q Consensus       143 ~~~~~~g~~LiItvD------~Gi~~~e~i~~a~~  171 (600)
                      ..-...+..--|+||      .|||+.+...-++.
T Consensus        86 ~~~~~~~~~ftvsVd~~~g~~TGISa~DRa~Tir~  120 (217)
T 1g57_A           86 NNTSAYGTGFTVTIEAAEGVTTGVSAADRITTVRA  120 (217)
T ss_dssp             SCCCTTCCCBBSCEEESSSCSSSCSHHHHHHHHHH
T ss_pred             CCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHH
T ss_conf             55667777545666515675688688899999999


No 146
>>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} (A:61-168,A:301-332)
Probab=67.56  E-value=7.9  Score=18.09  Aligned_cols=79  Identities=13%  Similarity=0.117  Sum_probs=52.3

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCE
Q ss_conf             99999769947998078743366889789887420268689996488762345555541798279961544765556725
Q gi|254780901|r  113 MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY  192 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~  192 (600)
                      .+.++..|..+.++-.+.-.+   -....++.+.+.+++-+|.+.+. .+.+.++.+.+.|+-++..|.+......+  +
T Consensus        31 e~~a~~~Gy~vii~~~~~~~~---~~~~~i~~l~~~~vDGiIi~~~~-~~~~~v~~l~~~~IPvV~id~~~~~~~~~--~  104 (140)
T 3kjx_A           31 NQVLEDTELQPVVGVTDYLPE---KEEKVLYEXLSWRPSGVIIAGLE-HSEAARAXLDAAGIPVVEIXDSDGKPVDA--X  104 (140)
T ss_dssp             HHHHTSSSSEEEEEECTTCHH---HHHHHHHHHHTTCCSEEEEECSC-CCHHHHHHHHHCSSCEEEEEECSSCCSSE--E
T ss_pred             HHHHHHHHCCCCCCCCCCCCH---HHHHHHHHHHHCCCCEEEEEECC-CCHHHHHHHHCCCCCEEEEEECCCCCCCC--E
T ss_conf             342210000111011235421---25899999995388514543102-31013444311688627884024688887--7


Q ss_pred             EEECC
Q ss_conf             65237
Q gi|254780901|r  193 ALVNP  197 (600)
Q Consensus       193 aivNP  197 (600)
                      ..+|.
T Consensus       105 V~~D~  109 (140)
T 3kjx_A          105 VGISC  109 (140)
T ss_dssp             EEECC
T ss_pred             EEECC
T ss_conf             75319


No 147
>>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} (A:236-373)
Probab=67.53  E-value=7.9  Score=18.09  Aligned_cols=71  Identities=11%  Similarity=0.226  Sum_probs=50.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCH----HHHHHHHHCCCCEEEE
Q ss_conf             999999999977997999940788615289999999997699479980787433668897----8988742026868999
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNP----SLMEKFINEGAQLIIT  155 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~----~~i~~~~~~g~~LiIt  155 (600)
                      +++..+.....++++++||    |..+..+-.|++.|+..|.++..+-..       ++.    ..++.+.+...+.+|+
T Consensus        20 ~~l~~~i~~~~~~~~~lIf----~~t~~~~~~l~~~L~~~~~~~~~~~~~-------~~~~~r~~~~~~f~~~~~~~lv~   88 (138)
T 2v1x_A           20 EDIVKLINGRYKGQSGIIY----CFSQKDSEQVTVSLQNLGIHAGAYHAN-------LEPEDKTTVHRKWSANEIQVVVA   88 (138)
T ss_dssp             HHHHHHHTTTTTTCEEEEE----CSSHHHHHHHHHHHHHTTCCEEEECTT-------SCHHHHHHHHHHHHTTSSSEEEE
T ss_pred             HHHHHHHHHHCCCCCCEEE----EEEEEHHHHHHHHHHHCCCEEEECCCC-------CHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             7888988763357761699----754221456778876418603310475-------22989999999997799768998


Q ss_pred             ECCCCC
Q ss_conf             648876
Q gi|254780901|r  156 VDCGST  161 (600)
Q Consensus       156 vD~Gi~  161 (600)
                      .|+...
T Consensus        89 t~~~~~   94 (138)
T 2v1x_A           89 TVAFGM   94 (138)
T ss_dssp             CTTSCT
T ss_pred             ECHHHH
T ss_conf             450554


No 148
>>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, enzyme, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} (A:205-389,A:582-616)
Probab=67.21  E-value=8  Score=18.04  Aligned_cols=131  Identities=15%  Similarity=0.149  Sum_probs=73.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE------ECCCCC------CCCCCCHHHHHHHH
Q ss_conf             999999999997799799994078861528999999999769947998------078743------36688978988742
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY------IPDRIV------DGYGPNPSLMEKFI  146 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~------IP~R~~------eGYGl~~~~i~~~~  146 (600)
                      +.+++++.+.|.+-++.+|+..+.+...-+..-+.++...+|+-|...      +|+.--      .|++-+.. ...+.
T Consensus         9 ~~~i~~~~~~L~~AkrPvIi~G~g~~~~~a~~~l~~Lae~lgiPV~~t~~~kg~~~~~hP~~~G~~~g~~~~~~-~~~~l   87 (220)
T 2pan_A            9 RXQIEKAVEXLIQAERPVIVAGGGVINADAAALLQQFAELTSVPVIPTLXGWGCIPDDHELXAGXVGLQTAHRY-GNATL   87 (220)
T ss_dssp             HHHHHHHHHHHHTCSSEEEEECHHHHHTTCHHHHHHHHHHHTCCEEECTTTTTSSCTTSTTBCCCCSSSSCCHH-HHHHH
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH-HHHHC
T ss_conf             06899999999738982899777501130899999999720787323435567532333232322345444223-44303


Q ss_pred             HCCCCEEEEECCCCCCHHHHHH-HHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             0268689996488762345555-541798279961544765556725652378888643344304788999999999997
Q gi|254780901|r  147 NEGAQLIITVDCGSTSYDALQY-ATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRI  225 (600)
Q Consensus       147 ~~g~~LiItvD~Gi~~~e~i~~-a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~  225 (600)
                      ++ ++|||.+++-.+.+.--.. .......+|-+|.              ||...+..|+ .+++-+|-+-.++.+|.+.
T Consensus        88 ~~-aDlIL~iG~~l~~~~t~~~~~~~~~~~iI~I~~--------------d~~~l~~~~~-~dv~i~gD~~~~L~~L~~~  151 (220)
T 2pan_A           88 LA-SDXVFGIGNRFANRHTGSVEKYTEGRKIVHIDI--------------EPTQIGRVLC-PDLGIVSDAKAALTLLVEV  151 (220)
T ss_dssp             HH-CSEEEEESCCCCHHHHSSHHHHHTTCEEEEEES--------------CGGGTTSSSC-CSSCEECCHHHHHHHHHHH
T ss_pred             CC-CCEEEEECCCCCCCCCCCCCCCCCCCEEEEEEC--------------CHHHHCCCCC-CCCCCCHHHHHHHHHHHHH
T ss_conf             43-311344144555434322123588981899978--------------6576002445-6400010167888877655


Q ss_pred             H
Q ss_conf             0
Q gi|254780901|r  226 L  226 (600)
Q Consensus       226 l  226 (600)
                      +
T Consensus       152 l  152 (220)
T 2pan_A          152 A  152 (220)
T ss_dssp             H
T ss_pred             H
T ss_conf             6


No 149
>>2g2c_A Putative molybdenum cofactor biosynthesis protein; structural genomics, PSI, protein structure initiative; 1.50A {Corynebacterium diphtheriae} (A:)
Probab=67.07  E-value=5.5  Score=19.31  Aligned_cols=63  Identities=21%  Similarity=0.218  Sum_probs=35.6

Q ss_pred             EEEEEC-------CCCCHHHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             999940-------78861528999999999769947998--0787433668897898874202686899964887623
Q gi|254780901|r   95 IMIFGD-------YDVDGAASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        95 I~I~gD-------yD~DGitstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      |.+.||       -|.-|-.-...+...|+.+|.++.++  +|+...+    -.+.++++.+.+++||||.  |-++.
T Consensus        10 ii~tGdEi~~g~~~d~~g~~~~~~~~~~l~~~G~~~~~~~iv~Dd~~~----i~~~l~~~~~~~~DlVitt--GG~g~   81 (167)
T 2g2c_A           10 IIVVSDRISTGTRENKALPLLQRLXSDELQDYSYELISEVVVPEGYDT----VVEAIATALKQGARFIITA--GGTGI   81 (167)
T ss_dssp             EEEECHHHHHTSSCCCHHHHHHHHHCC----CEEEEEEEEEECSSHHH----HHHHHHHHHHTTCSEEEEE--SCCSS
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCHHHH----HHHHHHHHHHCCCCEEEEC--CCCCC
T ss_conf             999788441577457884899999999999789379999841742889----9999999985699999962--77668


No 150
>>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis} (A:1-96,A:209-272)
Probab=66.82  E-value=8.2  Score=17.99  Aligned_cols=82  Identities=18%  Similarity=0.388  Sum_probs=53.1

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHH---------HHHHHHHC-CCCEEEEECCCC
Q ss_conf             79979999407886152899999999976994799807874336688978---------98874202-686899964887
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPS---------LMEKFINE-GAQLIITVDCGS  160 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~---------~i~~~~~~-g~~LiItvD~Gi  160 (600)
                      ++.+|.||-    -|+-+.+++.+..+.+-..-..|+-+.-.=.||....         .++.+.++ |+++||. =|-+
T Consensus         2 ~~~~IgifD----SGiGGLtv~~~i~~~lP~e~~iy~~D~~~~PYG~ks~~~i~~~~~~~~~~l~~~~~~~~iVi-ACNT   76 (160)
T 1zuw_A            2 LEQPIGVID----SGVGGLTVAKEIMRQLPKENIIYVGDTKRCPYGPRPEEEVLQYTWELTNYLLENHHIKMLVI-ACNT   76 (160)
T ss_dssp             TTSCEEEEE----SSSTTHHHHHHHHHHSTTCCEEEEECGGGCCCSSSCHHHHHHHHHHHHHHHHHHSCCSEEEE-CCHH
T ss_pred             CCCCEEEEE----CCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEE-CCCH
T ss_conf             999889998----89768999999999789998899956889998989999999999999999863369829998-2747


Q ss_pred             CCHHHHHHHHH-CCCCEE
Q ss_conf             62345555541-798279
Q gi|254780901|r  161 TSYDALQYATN-QGIDVI  177 (600)
Q Consensus       161 ~~~e~i~~a~~-~GidvI  177 (600)
                      .+.-..+.+++ ..+.||
T Consensus        77 asa~al~~lr~~~~iPii   94 (160)
T 1zuw_A           77 ATAIALDDIQRSVGIPVV   94 (160)
T ss_dssp             HHHHHHHHHHHHCSSCEE
T ss_pred             HHHHHHHHHHHHCCCEEE
T ss_conf             889999998864697288


No 151
>>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} (A:)
Probab=66.79  E-value=8.2  Score=17.99  Aligned_cols=39  Identities=18%  Similarity=0.236  Sum_probs=27.8

Q ss_pred             CCEEEEEC---CCCCHHHHHHHHHHHHHHHHCEEEEEEECCC
Q ss_conf             75026205---7858122222278998842010799886379
Q gi|254780901|r  368 ASVIVVEG---DRWHPGIVGLLAARLKEKFGRPSFAISFEED  406 (600)
Q Consensus       368 ~~~ivv~~---~~wh~GViGIVAsrL~e~y~kP~iv~s~~~d  406 (600)
                      ...||+..   ..|..-++|=++.++...-..|++++-..++
T Consensus       252 ~dliV~G~~~~~~~~~~~~Gs~s~~il~~~~~pVliv~~~~~  293 (294)
T 3loq_A          252 ATTIFXGSRGAGSVXTXILGSTSESVIRRSPVPVFVCKRGDD  293 (294)
T ss_dssp             CSEEEEECCCCSCHHHHHHHCHHHHHHHHCSSCEEEECSCTT
T ss_pred             CCEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
T ss_conf             989999478886531030380999999609998999948989


No 152
>>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} (A:1-113)
Probab=66.70  E-value=8.2  Score=17.97  Aligned_cols=76  Identities=9%  Similarity=-0.008  Sum_probs=42.0

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHC--------------CCCEEE
Q ss_conf             977997999940788615289999999997699479980787433668897898874202--------------686899
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE--------------GAQLII  154 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~--------------g~~LiI  154 (600)
                      ..++++|+|+|    =|.|+-+-+.++|...|++|..+=-+     +   ....+.+.+.              +++++|
T Consensus         9 ~~~~~~v~viG----lG~sG~salA~~L~~~G~~V~~~D~~-----~---~~~~~~l~~~gi~~~~g~~~~~~~~~d~vV   76 (113)
T 1j6u_A            9 HHHHXKIHFVG----IGGIGXSAVALHEFSNGNDVYGSNIE-----E---TERTAYLRKLGIPIFVPHSADNWYDPDLVI   76 (113)
T ss_dssp             ---CCEEEEET----TTSHHHHHHHHHHHHTTCEEEEECSS-----C---CHHHHHHHHTTCCEESSCCTTSCCCCSEEE
T ss_pred             CCCCCEEEEEE----ECHHHHHHHHHHHHHCCCEEEEEECC-----C---CHHHHHHHHCCCEEECCCCHHHCCCCCEEE
T ss_conf             46877799998----86999999999999689959998299-----9---989999998889898798978879998999


Q ss_pred             EECCCCC-CHHHHHHHHHCCCCEE
Q ss_conf             9648876-2345555541798279
Q gi|254780901|r  155 TVDCGST-SYDALQYATNQGIDVI  177 (600)
Q Consensus       155 tvD~Gi~-~~e~i~~a~~~GidvI  177 (600)
                      . -.|+. +++++.+|+++|+.|+
T Consensus        77 ~-SPgi~~~~p~~~~a~~~gi~i~   99 (113)
T 1j6u_A           77 K-TPAVRDDNPEIVRARXERVPIE   99 (113)
T ss_dssp             E-CTTCCTTCHHHHHHHHTTCCEE
T ss_pred             E-CCCCCCCCHHHHHHHHCCCCEE
T ss_conf             8-8946888899999998599786


No 153
>>3ff4_A Uncharacterized protein; structural genomics, PSI- 2, protein structure initiative, midwest center for structural genomics; 2.10A {Cytophaga hutchinsonii atcc 33406} (A:)
Probab=66.54  E-value=8.3  Score=17.95  Aligned_cols=86  Identities=12%  Similarity=0.028  Sum_probs=51.4

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-CCC---C--------------C----CHHHHHHHHH
Q ss_conf             7799799994078861528999999999769947998078743-366---8--------------8----9789887420
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV-DGY---G--------------P----NPSLMEKFIN  147 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~-eGY---G--------------l----~~~~i~~~~~  147 (600)
                      ++.++|+|+|--+--|-.+.. +.+.|+..|.+|...-|..-+ +|.   .              .    ..++++++.+
T Consensus         2 ~~~k~iAViGaS~~~~~~g~~-v~~~l~~~g~~V~pVnp~~~~v~G~~~y~~l~~~~~~D~v~i~~~~~~~~~~~~e~~~   80 (122)
T 3ff4_A            2 NAXKKTLILGATPETNRYAYL-AAERLKSHGHEFIPVGRKKGEVLGKTIINERPVIEGVDTVTLYINPQNQLSEYNYILS   80 (122)
T ss_dssp             CCCCCEEEETCCSCTTSHHHH-HHHHHHHHTCCEEEESSSCSEETTEECBCSCCCCTTCCEEEECSCHHHHGGGHHHHHH
T ss_pred             CCCCEEEEEEECCCCCCCHHH-HHHHHHHCCCEEEEECCCCCEEEEEEEEECCCCCCCCCEEEEEECHHHHHHHHHHHHH
T ss_conf             976639999876999980999-9999997899899985657600005899734346898799999688998999999985


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEE
Q ss_conf             268689996488762345555541798279
Q gi|254780901|r  148 EGAQLIITVDCGSTSYDALQYATNQGIDVI  177 (600)
Q Consensus       148 ~g~~LiItvD~Gi~~~e~i~~a~~~GidvI  177 (600)
                      .|++.++.. .|.-+.+..+++++.||.+|
T Consensus        81 ~gik~v~~~-~~~~~e~~~~~a~~~gi~ii  109 (122)
T 3ff4_A           81 LKPKRVIFN-PGTENEELEEILSENGIEPV  109 (122)
T ss_dssp             HCCSEEEEC-TTCCCHHHHHHHHHTTCEEE
T ss_pred             CCCCEEEEE-CCCCCHHHHHHHHHCCCEEE
T ss_conf             399999993-59879999999999699799


No 154
>>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} (A:1-98,A:233-276)
Probab=66.11  E-value=8.4  Score=17.89  Aligned_cols=68  Identities=7%  Similarity=-0.041  Sum_probs=47.9

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             999997699479980787433668897898874202686899964887623455555417982799615447
Q gi|254780901|r  113 MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      .+.++..|.++..+..+.-.+   .....++.+.+.+++-||..-. ..+.+.++.+.+.|+.+|+.|...+
T Consensus        22 ~~~a~~~G~~l~i~~~~~~~~---~~~~~i~~ll~~~vDGIIl~~~-~~~~~~~~~l~~~~iPvV~id~~~~   89 (142)
T 2h0a_A           22 EGVLLEQRYDLALFPILSLAR---LKRYLENTTLAYLTDGLILASY-DLTERFEEGRLPTERPVVLVDAQNP   89 (142)
T ss_dssp             HHHHGGGTCEEEECCCCSCCC---CC---------CCCSEEEEESC-CCC------CCSCSSCEEEESSCCT
T ss_pred             HHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEECC-CCHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             999998699899997899869---9999999998558987898413-3006789987651465212223576


No 155
>>3ke8_A 4-hydroxy-3-methylbut-2-ENYL diphosphate reductase; induced FIT mechanism, FS4-iron-sulfure-cluster, 3Fe-4S, iron, iron-sulfur; HET: EIP; 1.70A {Escherichia coli} PDB: 3ke9_A* 3kef_A* 3kel_A 3kem_A* 3f7t_A (A:21-106)
Probab=66.08  E-value=8.4  Score=17.89  Aligned_cols=42  Identities=12%  Similarity=0.057  Sum_probs=26.0

Q ss_pred             CHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             879999999999977-99799994078861528999999999769947
Q gi|254780901|r   77 DCDKAARRIVQAIYN-SEKIMIFGDYDVDGAASVALMMRFLSHCSVNA  123 (600)
Q Consensus        77 dm~~A~~ri~~ai~~-~ekI~I~gDyD~DGitstail~~~L~~~g~~v  123 (600)
                      +..+|++...++.++ +++|.++|+-     .---...+.|+..|..+
T Consensus         4 GV~rAi~~a~~~~~~~~~~i~tlG~l-----IHN~~vv~~L~~~Gv~~   46 (86)
T 3ke8_A            4 GVDRAISIVENALAIYGAPIYVRHEV-----VHNRYVVDSLRERGAIF   46 (86)
T ss_dssp             HHHHHHHHHHHHHHHHCSCEEEESCS-----SSCHHHHHHHHHHTEEE
T ss_pred             CHHHHHHHHHHHHHHCCCCEEECCCC-----CCCHHHHHHHHHCCCEE
T ss_conf             39999999999998709978767746-----64989999999888999


No 156
>>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} (A:153-274)
Probab=66.05  E-value=8.4  Score=17.88  Aligned_cols=80  Identities=16%  Similarity=0.272  Sum_probs=55.1

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHH----HHCCCCEEEEECCCCCCHHHH
Q ss_conf             7997999940788615289999999997699479980787433668897898874----202686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKF----INEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~----~~~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++.+|++.||+  ..=+.-+ +..++..+|.++...-|.    ||-+..+.++.+    .+.|.++-+|-|-    .|++
T Consensus         2 ~g~ki~~vGd~--~~rv~~S-~~~~~~~~g~~v~~~~P~----~~~~~~~~~~~~~~~a~~~g~~i~~~~~~----~ea~   70 (122)
T 1dxh_A            2 HDISYAYLGDA--RNNMGNS-LLLIGAKLGMDVRIAAPK----ALWPHDEFVAQCKKFAEESGAKLTLTEDP----KEAV   70 (122)
T ss_dssp             GGCEEEEESCC--SSHHHHH-HHHHHHHTTCEEEEECCG----GGSCCHHHHHHHHHHHHHHTCEEEEESCH----HHHT
T ss_pred             CCCEEEEECCC--CCCHHHH-HHHHHHHCCCEEEEECCC----CCCCCHHHHHHHHHHHHHCCCEEEEECCH----HHHH
T ss_conf             68489980787--6407999-999998769989998895----34889899999999999739989998699----9982


Q ss_pred             HHHHHCCCCEEEECCCCCCC
Q ss_conf             55541798279961544765
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~~~  186 (600)
                           .|.|||.||-=....
T Consensus        71 -----~~aDviy~~~w~~~~   85 (122)
T 1dxh_A           71 -----KGVDFVHTDVWVSMG   85 (122)
T ss_dssp             -----TTCSEEEECCCSCSS
T ss_pred             -----CCCCEEEEEEEEECC
T ss_conf             -----889899441076236


No 157
>>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, sugar binding protein, structural genomics; 2.05A {Burkholderia phymatum STM815} (A:1-110,A:244-265)
Probab=66.00  E-value=8.4  Score=17.88  Aligned_cols=117  Identities=8%  Similarity=-0.046  Sum_probs=68.1

Q ss_pred             CCCEEEEECCCCCHHHHHHHH---HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             997999940788615289999---99999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALM---MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail---~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ...|.++-+ +.+.--.+.++   .+.++..|..+..+..+.-.+....-.+.++.+.+.+++=+|..... ..-+.++.
T Consensus         8 S~tIgviip-~~~~~f~~~ii~gi~~~a~~~gy~lii~~~~~~~~~~~~~~~~i~~l~~~~vDGiIi~~~~-~~~~~i~~   85 (132)
T 2rgy_A            8 LGIIGLFVP-TFFGSYYGTILKQTDLELRAVHRHVVVATGCGESTPREQALEAVRFLIGRDCDGVVVISHD-LHDEDLDE   85 (132)
T ss_dssp             CCEEEEECS-CSCSHHHHHHHHHHHHHHHHTTCEEEEECCCSSSCHHHHHHHHHHHHHHTTCSEEEECCSS-SCHHHHHH
T ss_pred             CCEEEEECC-CCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECCC-CCHHHHHH
T ss_conf             997999928-9878899999999999999869979999688986419999999999985699989852232-10478998


Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             541798279961544765556725652378888643344304788999999999
Q gi|254780901|r  169 ATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLI  222 (600)
Q Consensus       169 a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al  222 (600)
                      +.+.|+-+++.|.=.. +..    ..|.+.       -.+|.--.|-|+.-+..
T Consensus        86 l~~~~IPvV~id~~~~-~~~----~~V~~D-------~~~~~~~~~~~~~~~~~  127 (132)
T 2rgy_A           86 LHRXHPKXVFLNRAFD-ALP----DASFCP-------TAELTQNAVRWLINQCY  127 (132)
T ss_dssp             HHHHCSSEEEESSCCT-TSG----GGEECC-------HHHHHHHHHHHHHHHHH
T ss_pred             HHHCCCCCEEEEECCC-CCC----CCCCCC-------HHHHHHHHHHHHHHHHC
T ss_conf             7403764203520343-223----442035-------99999999999999854


No 158
>>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis; 2.10A {Gloeobacter violaceus pcc 7421} (A:155-282)
Probab=65.87  E-value=8.5  Score=17.86  Aligned_cols=75  Identities=17%  Similarity=0.298  Sum_probs=52.3

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHH----HCCCCEEEEECCCCCCHHHH
Q ss_conf             79979999407886152899999999976994799807874336688978988742----02686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFI----NEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~----~~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++.+|++.|||   +-+.. -+..++..+|.++.+.-|.    +|.+....++.+.    +.|.++.+|-|     .++ 
T Consensus         2 ~g~ki~~vGd~---~~v~~-S~~~~~~~~g~~v~~~~P~----~~~~~~~~~~~~~~~~~~~g~~i~~~~d-----~~e-   67 (128)
T 3gd5_A            2 AGLKLAYVGDG---NNVAH-SLLLGCAKVGMSIAVATPE----GFTPDPAVSARASEIAGRTGAEVQILRD-----PFE-   67 (128)
T ss_dssp             TTCEEEEESCC---CHHHH-HHHHHHHHHTCEEEEECCT----TCCCCHHHHHHHHHHHHHHTCCEEEESC-----HHH-
T ss_pred             CCCEEEEECCC---HHHHH-HHHHHHHHCCCCEEEEECC----CCCCCHHHHHHHHHHHHCCCCCCCCCCC-----HHH-
T ss_conf             79769996463---02667-9999998559863884023----4688788999987655315871133578-----999-


Q ss_pred             HHHHHCCCCEEEECCC
Q ss_conf             5554179827996154
Q gi|254780901|r  167 QYATNQGIDVIVIDHH  182 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH  182 (600)
                         .=.|.|||.||-=
T Consensus        68 ---av~~aDvvyt~~w   80 (128)
T 3gd5_A           68 ---AARGAHILYTDVW   80 (128)
T ss_dssp             ---HHTTCSEEEECCC
T ss_pred             ---HHHCCCEEEHHHH
T ss_conf             ---9716760001356


No 159
>>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii OT3} (A:1-126)
Probab=65.67  E-value=6.1  Score=18.98  Aligned_cols=89  Identities=13%  Similarity=0.116  Sum_probs=61.6

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCH-HHHHHHHHCCCCEEEEECCCCCCHHHHH
Q ss_conf             977997999940788615289999999997699479980787433668897-8988742026868999648876234555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNP-SLMEKFINEGAQLIITVDCGSTSYDALQ  167 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~-~~i~~~~~~g~~LiItvD~Gi~~~e~i~  167 (600)
                      +.+.++|.|+|--+--|-.++.++......++..|...=|.. ++=+|+.. ..+.++ ...+++++.+--.-...+.++
T Consensus         5 l~~p~~iaVvG~s~~~~~~~~~v~~~l~~~~~~~V~pVnp~~-~~i~g~~~y~sl~el-~~~~D~v~i~~p~~~~~~~v~   82 (126)
T 2csu_A            5 FFNPKGIAVIGASNDPKKLGYEVFKNLKEYKKGKVYPVNIKE-EEVQGVKAYKSVKDI-PDEIDLAIIVVPKRFVKDTLI   82 (126)
T ss_dssp             TTSCSEEEEETCCSCTTSHHHHHHHHHTTCCSSEEEEECSSC-SEETTEECBSSTTSC-SSCCSEEEECSCHHHHHHHHH
T ss_pred             HCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEECCCC-CEECCEECCCCHHHC-CCCCCEEEEEECHHHHHHHHH
T ss_conf             269986999885799986379999999847996189978998-607987576998886-999898999977899899999


Q ss_pred             HHHHCCCCEEEE
Q ss_conf             554179827996
Q gi|254780901|r  168 YATNQGIDVIVI  179 (600)
Q Consensus       168 ~a~~~GidvIVt  179 (600)
                      .+.++|+..++.
T Consensus        83 e~~~~gi~~ii~   94 (126)
T 2csu_A           83 QCGEKGVKGVVI   94 (126)
T ss_dssp             HHHHHTCCEEEE
T ss_pred             HHHHCCCCEEEE
T ss_conf             999849988997


No 160
>>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} (A:)
Probab=65.35  E-value=8.7  Score=17.79  Aligned_cols=95  Identities=14%  Similarity=0.160  Sum_probs=58.9

Q ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC---CCCCCCCHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             99999779979999407886152899999999976994799807874---336688978988742026868999648876
Q gi|254780901|r   85 IVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI---VDGYGPNPSLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        85 i~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~---~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      +.+.+.+.++|+|+|--+--|-.+..+ .+.|+..|.++..+-|.+-   -+|.-.-. .++++. ..+++++.+-....
T Consensus         6 ~~~~l~~pk~iAViG~S~~~~~~g~~v-~~~l~~~g~~v~~v~p~~~~~ei~G~~~~~-sl~eip-~~iD~v~i~~p~~~   82 (145)
T 2duw_A            6 IAGILTSTRTIALVGASDKPDRPSYRV-MKYLLDQGYHVIPVSPKVAGKTLLGQQGYA-TLADVP-EKVDMVDVFRNSEA   82 (145)
T ss_dssp             HHHHHHHCCCEEEESCCSCTTSHHHHH-HHHHHHHTCCEEEECSSSTTSEETTEECCS-STTTCS-SCCSEEECCSCSTH
T ss_pred             HHHHHHCCCEEEEEEECCCCCCCHHHH-HHHHHHCCCEEEEECCCCCEEEEEEEECCC-CHHHCC-CCCCEEEEECCHHH
T ss_conf             999986689399992079999838999-999986898689852454412562062257-544467-62116899514999


Q ss_pred             CHHHHHHHHHCCCCEEEECCC
Q ss_conf             234555554179827996154
Q gi|254780901|r  162 SYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIVtDHH  182 (600)
                      ..+.++.+.++|+..++.==.
T Consensus        83 ~~~~i~e~~~~g~k~~~~~~~  103 (145)
T 2duw_A           83 AWGVAQEAIAIGAKTLWLQLG  103 (145)
T ss_dssp             HHHHHHHHHHHTCCEEECCTT
T ss_pred             HHHHHHHHHHCCCCEEEECCC
T ss_conf             999999999729975995245


No 161
>>1m3s_A Hypothetical protein YCKF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} (A:)
Probab=64.96  E-value=8.8  Score=17.73  Aligned_cols=103  Identities=16%  Similarity=0.115  Sum_probs=58.1

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHH--HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             99999999999779979999407886152899--9999999769947998078743366889789887420268689996
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVA--LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitsta--il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      .+..+++.+.+.+.++|.++|   + |.+..+  -+...|..+|..+...-+..            ...... -+++|.+
T Consensus        24 ~~~~~~i~~~i~~a~~I~~~G---~-G~S~~~a~~~~~~l~~~g~~~~~~~~~~------------~~~~~~-~~~vI~i   86 (186)
T 1m3s_A           24 NEEADQLADHILSSHQIFTAG---A-GRSGLMAKSFAMRLMHMGFNAHIVGEIL------------TPPLAE-GDLVIIG   86 (186)
T ss_dssp             HHHHHHHHHHHHHCSCEEEEC---S-HHHHHHHHHHHHHHHHTTCCEEETTSTT------------CCCCCT-TCEEEEE
T ss_pred             HHHHHHHHHHHHCCCEEEEEE---C-CHHHHHHHHHHHHHHHCCCCCCCCCHHH------------CCCCCC-CCEEEEE
T ss_conf             999999999997499599997---8-7899999999999985099867777211------------356889-9889998


Q ss_pred             CCCCC---CHHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCC
Q ss_conf             48876---23455555417982799-61544765556725652378
Q gi|254780901|r  157 DCGST---SYDALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       157 D~Gi~---~~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~  198 (600)
                      ..+=.   -.+.++.|+++|+.+|. |++...|=....-+.+.-|.
T Consensus        87 S~sG~t~~~~~~~~~ak~~g~~ii~IT~~~~s~l~~~ad~~l~~~~  132 (186)
T 1m3s_A           87 SGSGETKSLIHTAAKAKSLHGIVAALTINPESSIGKQADLIIRMPG  132 (186)
T ss_dssp             CSSSCCHHHHHHHHHHHHTTCEEEEEESCTTSHHHHHCSEEEECSC
T ss_pred             ECCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHCCEEEEECC
T ss_conf             1899864678999999986996999989999978996999999689


No 162
>>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, protein structure initiative; 1.88A {Caenorhabditis elegans} (A:313-481)
Probab=64.91  E-value=8.2  Score=17.97  Aligned_cols=95  Identities=20%  Similarity=0.280  Sum_probs=56.2

Q ss_pred             HHHHHHHHHHHH---CCCCEEEEECC---CCC--HHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHC--
Q ss_conf             999999999997---79979999407---886--15289999999997699479980787433668897898874202--
Q gi|254780901|r   79 DKAARRIVQAIY---NSEKIMIFGDY---DVD--GAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE--  148 (600)
Q Consensus        79 ~~A~~ri~~ai~---~~ekI~I~gDy---D~D--Gitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~--  148 (600)
                      ...++++.+++.   ++.+|+|+|=-   ++|  --|.+.-+.+-|...|++|.+|=|.-       +.+.+......  
T Consensus         7 ~~v~~~i~~~l~~~~~~~rVailGlafK~ntdD~R~Spa~~li~~L~~~Ga~V~~yDP~v-------~~~~~~~~~~~~~   79 (169)
T 2o3j_A            7 RRFADKIIAELFNTVTDKKIAIFGFAFKKNTGDTRESSAIHVIKHLMEEHAKLSVYDPKV-------QKSQMLNDLASVT   79 (169)
T ss_dssp             HHHHHHHHHHTTTCCTTCEEEEECCSSSTTCCCCTTCHHHHHHHHHHHTTCEEEEECSSS-------CHHHHHHHHHHHS
T ss_pred             HHCCCEEEHHHCCCCCCCEEEEEEECCCCCCCCHHCCCCHHHHHHHHHCCCEEEEECCCC-------CHHHHHHHHHHCC
T ss_conf             000113322105775665699974224666641111632158999998199378756854-------6898865653212


Q ss_pred             ----CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             ----68689996488762345555541798279961544765
Q gi|254780901|r  149 ----GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       149 ----g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                          ....+..+|+   ..++   +.+-..=||.|||++...
T Consensus        80 ~~~~~~~~~~~~~~---~~~a---~~~aDaiVi~t~h~ef~~  115 (169)
T 2o3j_A           80 SAQDVERLITVESD---PYAA---ARGAHAIVVLTEWDEFVE  115 (169)
T ss_dssp             CHHHHHHHEEEESS---HHHH---HTTCSEEEECSCCGGGTT
T ss_pred             CHHHHHHCCEECCC---HHHH---HCCCCEEEEECCCHHHCC
T ss_conf             02332210022279---9999---657988999559967723


No 163
>>3dbi_A Sugar-binding transcriptional regulator, LACI family; structural genomics, protein structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} (A:1-163,A:297-318)
Probab=64.44  E-value=9  Score=17.66  Aligned_cols=147  Identities=9%  Similarity=0.084  Sum_probs=85.1

Q ss_pred             HHHHHHHHCCCH-HHHHHHHHCC-CCHHHHHHHCCCCHHHCCCCHHHCCCHHHHHHHHHHHH--HCCCCEEEEE-CCCCC
Q ss_conf             999998819999-9999999678-89789886619667771899556148799999999999--7799799994-07886
Q gi|254780901|r   30 ALAITQKHAIPD-IVARVLVNRN-VSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAI--YNSEKIMIFG-DYDVD  104 (600)
Q Consensus        30 ~~~l~~~~~~~~-~~a~iL~~Rg-i~~~~~~~fL~p~l~~l~~dP~~l~dm~~A~~ri~~ai--~~~ekI~I~g-DyD~D  104 (600)
                      ...+++.+|+|. .++|.|-+++ ++++..+.-+.-- ..+          .-......+..  .+...|.++- +..-+
T Consensus         6 ~~dIA~~agVS~~TVSRaLn~~~~Vs~~Tr~rV~~~a-~el----------gY~~~~~a~~l~~~~~~~I~ivi~~~~~~   74 (185)
T 3dbi_A            6 XLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAV-EES----------GYRPNLLARNLSAKSTQTLGLVVTNTLYH   74 (185)
T ss_dssp             -----------------------------------------------------------------CCSEEEEEECTTTTS
T ss_pred             HHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHH-HHH----------CCCCCHHHHHHHCCCCCEEEEEEECCCCC
T ss_conf             9999999898899999996897999999999999999-995----------89878778865117874799997304555


Q ss_pred             HHHHHHHHH---HHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             152899999---99997699479980787433668897898874202686899964887623455555417982799615
Q gi|254780901|r  105 GAASVALMM---RFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       105 Gitstail~---~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDH  181 (600)
                      +.--..++.   ..++..|.++..+.-+.-.+   ...+.++.+.+.+++=+|.+-.-.+..+-.+.+.+.|+-+++.|.
T Consensus        75 ~~f~~~ii~gi~~~~~~~gy~~~i~~~~~d~~---~~~~~i~~l~~~~vdGiIi~~~~~~~~~~~~~l~~~~iPvV~id~  151 (185)
T 3dbi_A           75 GIYFSELLFHAARXAEEKGRQLLLADGKHSAE---EERQAIQYLLDLRCDAIXIYPRFLSVDEIDDIIDAHSQPIXVLNR  151 (185)
T ss_dssp             TTHHHHHHHHHHHHHHHTTCEEEEEECTTSHH---HHHHHHHHHHHTTCSEEEECCSSSCHHHHHHHHHHCSSCEEEESS
T ss_pred             CHHHHHHHHHHHHHHHHHCCEEEECCCCCCHH---HHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCCEEEECC
T ss_conf             51399999999999997184787325788778---899999999955988799758877758899999854997899367


Q ss_pred             CCCCCCCCC
Q ss_conf             447655567
Q gi|254780901|r  182 HQVKSEEIP  190 (600)
Q Consensus       182 H~~~~~~p~  190 (600)
                      ..+....+.
T Consensus       152 ~~~~~~~~s  160 (185)
T 3dbi_A          152 RLRKNSSHS  160 (185)
T ss_dssp             CCSSSGGGE
T ss_pred             CCCCCCCCE
T ss_conf             666777852


No 164
>>2anu_A Hypothetical protein TM0559; predicted metal-dependent phosphoesterase (PHP family), structural genomics; 2.40A {Thermotoga maritima MSB8} (A:)
Probab=64.42  E-value=3.9  Score=20.53  Aligned_cols=31  Identities=19%  Similarity=0.294  Sum_probs=20.7

Q ss_pred             CCCCCCHHHHHHHHHCCCCEE-EECCCCCCCC
Q ss_conf             488762345555541798279-9615447655
Q gi|254780901|r  157 DCGSTSYDALQYATNQGIDVI-VIDHHQVKSE  187 (600)
Q Consensus       157 D~Gi~~~e~i~~a~~~GidvI-VtDHH~~~~~  187 (600)
                      |+-.+-.+-+..|+++|+|+| ||||+.+..-
T Consensus        32 Dg~~~~~e~~~~A~~~Gl~~iaiTDH~~~~~~   63 (255)
T 2anu_A           32 DGHLPLGEVVDLFGKHGVDVVSITDHIVDRRT   63 (255)
T ss_dssp             TCSSCHHHHHHHHHHTTCSEEEEEEEEECHHH
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEECCCCCCCCH
T ss_conf             89999999999999869988998289963224


No 165
>>1k4i_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, isomerase; 0.98A {Magnaporthe grisea} (A:)
Probab=64.22  E-value=5.9  Score=19.09  Aligned_cols=28  Identities=18%  Similarity=0.274  Sum_probs=19.7

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             56148799999999999779979999407886
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIFGDYDVD  104 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~D  104 (600)
                      ..+..+++    ..+++++++.|+|+-|.|-+
T Consensus        10 ~~~~~i~~----ai~al~~G~~Viv~Dd~~rE   37 (233)
T 1k4i_A           10 SNFDAIPD----VIQAFKNGEFVVVLDDPSRE   37 (233)
T ss_dssp             --CCCHHH----HHHHHHTTCCEEEECCTTTT
T ss_pred             CCCCCHHH----HHHHHHCCCEEEEEECCCCC
T ss_conf             23865999----99999889969999679988


No 166
>>3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structural genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} (A:1-108,A:245-290)
Probab=63.97  E-value=9.2  Score=17.60  Aligned_cols=82  Identities=13%  Similarity=0.144  Sum_probs=51.7

Q ss_pred             HHHHHHHCCCCEEEE-ECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC-HHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             999999769947998-078743366889789887420268689996488762-345555541798279961544765556
Q gi|254780901|r  112 MMRFLSHCSVNANMY-IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS-YDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       112 l~~~L~~~g~~v~~~-IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~-~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      +...++..|.++.++ .++--.+   -..+.++.+...+++-||.+=...+. .+.++.+++.|+.+++.|-=.++ ...
T Consensus        26 ie~aa~~~Gy~vil~~~s~~d~~---~q~~~ie~li~q~VDGIIi~~~d~~~~~~~i~~l~~~gIpvV~id~~~~~-~~~  101 (154)
T 3d02_A           26 VVQAGKEFNLNASQVGPSSTDAP---QQVKIIEDLIARKVDAITIVPNDANVLEPVFKKARDAGIVVLTNESPGQP-SAN  101 (154)
T ss_dssp             HHHHHHHTTEEEEEECCSSSCHH---HHHHHHHHHHHTTCSEEEECCSCHHHHHHHHHHHHHTTCEEEEESCTTCT-TCS
T ss_pred             HHHHHHHCCCEEEEEECCCCCHH---HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEECCCCCCC-CCC
T ss_conf             99999974998999978999999---99999999997599989994258411048999999769958844788887-777


Q ss_pred             CCEEEECC
Q ss_conf             72565237
Q gi|254780901|r  190 PAYALVNP  197 (600)
Q Consensus       190 ~a~aivNP  197 (600)
                      ..+...||
T Consensus       102 ~~~v~dD~  109 (154)
T 3d02_A          102 WDVEIIDP  109 (154)
T ss_dssp             EEEESSCH
T ss_pred             CEEEEECH
T ss_conf             40998579


No 167
>>3isx_A Endoglucanase; TM1050, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.40A {Thermotoga maritima} (A:1-74,A:165-343)
Probab=63.91  E-value=9.2  Score=17.59  Aligned_cols=57  Identities=11%  Similarity=0.127  Sum_probs=38.1

Q ss_pred             HCCCCEEEEECCCC--------------CHHHHHHHHHHHHHHCCCCEEEEE--CCCCCCCCCC--CHHHHHHHHHC
Q ss_conf             77997999940788--------------615289999999997699479980--7874336688--97898874202
Q gi|254780901|r   90 YNSEKIMIFGDYDV--------------DGAASVALMMRFLSHCSVNANMYI--PDRIVDGYGP--NPSLMEKFINE  148 (600)
Q Consensus        90 ~~~ekI~I~gDyD~--------------DGitstail~~~L~~~g~~v~~~I--P~R~~eGYGl--~~~~i~~~~~~  148 (600)
                      .++.+|++.|++|.              |..+++++|.+.++.+..+....+  -+  .|-+|+  +...++.....
T Consensus        62 ~~~~~i~~~~H~Ds~~~~~~~~~~~GA~Dn~sGva~lLe~ar~~~~~~~v~fv~~~--~EE~G~~Gs~~~~~~~~~~  136 (253)
T 3isx_A           62 SGEKKVILDAHIDSGFVEVSGKYVSKAXDDRIGCAVIVEVFKRIKPAVTLYGVFSV--QEEVGLVGASVAGYGVPAD  136 (253)
T ss_dssp             CCSSEEEEEEECCCCCEEETTEEEESCHHHHHHHHHHHHHHHHCCCSSEEEEEEEC--CCCTTSCCSTTTGGGCCCS
T ss_pred             CCCCEEEEEECCCCCCEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEECCCC--CEEECCCCCCCEEECCCCC
T ss_conf             99970899942675314516743335544241799999876630345651001322--1022465553011002332


No 168
>>3k8a_A Putative primosomal replication protein; beta-barrel, OB-fold, DNA binding protein; 2.70A {Neisseria gonorrhoeae fa 1090} (A:)
Probab=63.80  E-value=9.2  Score=17.58  Aligned_cols=50  Identities=20%  Similarity=0.179  Sum_probs=39.4

Q ss_pred             EEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEECCC
Q ss_conf             7999997787870123553069987999999766545781105899998011131
Q gi|254780901|r  540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG  594 (600)
Q Consensus       540 ~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~~s~QL~I~Di~p~e~  594 (600)
                      .+.+++|+-    ..+......|..+-+-++++.+.|.++. .++.+.+++..|+
T Consensus        54 ~~~v~~~g~----~Ae~~~l~kG~~V~V~G~l~~~~~~~~~-~~v~~~~i~~l~g  103 (103)
T 3k8a_A           54 EIPARILGR----QAEEWQYRQGDCATVEGFLAQKSRRSLM-PMLRIQNIKEYKG  103 (103)
T ss_dssp             EEEEEEEHH----HHHHSTTCTTCEEEEEEEEEESSSSCCC-EEEEEEEEEECCC
T ss_pred             EEEEEEEHH----HHHHHHHCCCCEEEEEEEEEECCCCCCE-EEEEEEEEEECCC
T ss_conf             999999948----8566644899999999993750466874-8999989998169


No 169
>>1tuo_A Putative phosphomannomutase; thermus thermophilus HB8, biosynthesis of alginate, structural genomics; 1.70A {Thermus thermophilus} (A:157-266)
Probab=63.71  E-value=9.2  Score=17.57  Aligned_cols=44  Identities=9%  Similarity=0.011  Sum_probs=28.2

Q ss_pred             HHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC-CCCCCCC
Q ss_conf             7420268689996488762345555541798279961-5447655
Q gi|254780901|r  144 KFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID-HHQVKSE  187 (600)
Q Consensus       144 ~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtD-HH~~~~~  187 (600)
                      .+.+.+.++++.+-+|+++.-.-+.+.++|++|+++- |+.|...
T Consensus        16 ~i~~~~~kIvvD~~~G~~~~~~~~ll~~lg~~v~~~~~~~~~~~~   60 (110)
T 1tuo_A           16 ALSGFSGVLYHDSMGGAGAGFLKGFLRHVGLEIPVRPIREEPHPL   60 (110)
T ss_dssp             HHTTCCSCEEEECTTSTTTTHHHHHHHHTTCCCCEEEESCSCCTT
T ss_pred             HCCCCCCCCCCCCHHCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             002456654466110143145666777764123323101567676


No 170
>>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} (A:153-280)
Probab=63.51  E-value=9.3  Score=17.54  Aligned_cols=76  Identities=18%  Similarity=0.270  Sum_probs=53.8

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHH----HHCCCCEEEEECCCCCCHHHH
Q ss_conf             7997999940788615289999999997699479980787433668897898874----202686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKF----INEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~----~~~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++.+|++.||+   |-+.-+ +..+|..+|.++.+.-|.    +|.+....++.+    ...|.++.+|-|     .++ 
T Consensus         2 ~g~kia~vGd~---~rv~~S-l~~~ls~~g~~~~~~~P~----~~~~~~~~~~~~~~~~~~~g~~i~~~~~-----~~e-   67 (128)
T 1pvv_A            2 KGVKVVYVGDG---NNVAHS-LMIAGTKLGADVVVATPE----GYEPDEKVIKWAEQNAAESGGSFELLHD-----PVK-   67 (128)
T ss_dssp             TTCEEEEESCC---CHHHHH-HHHHHHHTTCEEEEECCT----TCCCCHHHHHHHHHHHHHHTCEEEEESC-----HHH-
T ss_pred             CCCEEEEECCC---CCCHHH-HHHHHHHHCCCEEEECCC----CCCCCHHHHHHHHHHHHHCCCEEEEECC-----HHH-
T ss_conf             67579997788---752677-999999715768998898----6578789999999977751984999769-----999-


Q ss_pred             HHHHHCCCCEEEECCCC
Q ss_conf             55541798279961544
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~  183 (600)
                         .=.|.|||.||--.
T Consensus        68 ---ai~~aDviyt~~w~   81 (128)
T 1pvv_A           68 ---AVKDADVIYTDVWA   81 (128)
T ss_dssp             ---HTTTCSEEEECCCC
T ss_pred             ---HHCCCCEEEEHHHH
T ss_conf             ---85479999432888


No 171
>>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* (A:1-104,A:238-280)
Probab=63.19  E-value=9.4  Score=17.50  Aligned_cols=84  Identities=20%  Similarity=0.304  Sum_probs=54.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC-HHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             9999999769947998078743366889789887420268689996488762-345555541798279961544765556
Q gi|254780901|r  111 LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS-YDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       111 il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~-~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      =+.+.++..|.++.++-+...+.  -...+.++.+.+.+++-||..=.+.++ .+.++.+++.|+-|++.|-...+....
T Consensus        21 gie~~a~~~G~~v~i~~~~~~d~--~~q~~~Le~li~~~vDGIIi~~~d~~~~~~~i~~l~~~gIPVV~vd~~~~~~~~~   98 (147)
T 2h3h_A           21 GVKAAGKALGVDTKFFVPQKEDI--NAQLQMLESFIAEGVNGIAIAPSDPTAVIPTIKKALEMGIPVVTLDTDSPDSGRY   98 (147)
T ss_dssp             HHHHHHHHHTCEEEEECCSSSCH--HHHHHHHHHHHHTTCSEEEECCSSTTTTHHHHHHHHHTTCCEEEESSCCTTSCCS
T ss_pred             HHHHHHHHHCCEEEEEECCCCCH--HHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCE
T ss_conf             99999998199799997999999--9999999999976999999972503442489999874356249993357765420


Q ss_pred             CCEEEECC
Q ss_conf             72565237
Q gi|254780901|r  190 PAYALVNP  197 (600)
Q Consensus       190 ~a~aivNP  197 (600)
                       ++.-.||
T Consensus        99 -~~Vg~D~  105 (147)
T 2h3h_A           99 -VYIGTDP  105 (147)
T ss_dssp             -CEEECCH
T ss_pred             -EECCCHH
T ss_conf             -0025529


No 172
>>2pbq_A Molybdenum cofactor biosynthesis MOG; molybdopterin, MPT, structural genomics, NPPSFA; 1.70A {Aquifex aeolicus VF5} PDB: 2qq1_A 2f7w_A 2f7y_A 2fuw_A (A:)
Probab=63.02  E-value=9.5  Score=17.48  Aligned_cols=58  Identities=19%  Similarity=0.269  Sum_probs=35.1

Q ss_pred             EEEEECCCCCH---HHHHHHHHHHHHHCCCCE--EE--EECCCCCCCCCCCHHHHHHH-HHCCCCEEEEE
Q ss_conf             99994078861---528999999999769947--99--80787433668897898874-20268689996
Q gi|254780901|r   95 IMIFGDYDVDG---AASVALMMRFLSHCSVNA--NM--YIPDRIVDGYGPNPSLMEKF-INEGAQLIITV  156 (600)
Q Consensus        95 I~I~gDyD~DG---itstail~~~L~~~g~~v--~~--~IP~R~~eGYGl~~~~i~~~-~~~g~~LiItv  156 (600)
                      |.+.||==..|   =|.+..|...|+..|.++  .+  .+|+...+    -.+++++. .++++++|||.
T Consensus        10 vi~~GdEi~~G~~~d~n~~~l~~~l~~~G~~v~~i~~~iv~Dd~~~----I~~~i~~~~~~~~~dliitt   75 (178)
T 2pbq_A           10 VVTISDRASKGIYEDISGKAIIDYLKDVIITPFEVEYRVIPDERDL----IEKTLIELADEKGCSLILTT   75 (178)
T ss_dssp             EEEECHHHHHTSSCCHHHHHHHHHHHHHBCSCCEEEEEEECSCHHH----HHHHHHHHHHTSCCSEEEEE
T ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCHHHH----HHHHHHHHHHHCCCEEEEEE
T ss_conf             9994766436888586799999999982798748988834867999----99999998873286199971


No 173
>>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} (A:)
Probab=61.77  E-value=10  Score=17.32  Aligned_cols=79  Identities=11%  Similarity=0.158  Sum_probs=53.5

Q ss_pred             CCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEE
Q ss_conf             4879999999999977--99799994078861528999999999769947998078743366889789887420268689
Q gi|254780901|r   76 TDCDKAARRIVQAIYN--SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLI  153 (600)
Q Consensus        76 ~dm~~A~~ri~~ai~~--~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~Li  153 (600)
                      +.-++-.+.+.+.++.  .+++.||    |.....+--++..|+..|..+..+-.+.-.+   --..+++.+.+...+.+
T Consensus        12 ~~~~~k~~~L~~ll~~~~~~k~iVF----~~s~~~~~~l~~~L~~~g~~~~~~h~~~~~~---~R~~~~~~f~~g~~~iL   84 (165)
T 1fuk_A           12 EEEEYKYECLTDLYDSISVTQAVIF----CNTRRKVEELTTKLRNDKFTVSAIYSDLPQQ---ERDTIMKEFRSGSSRIL   84 (165)
T ss_dssp             ESGGGHHHHHHHHHHHTTCSCEEEE----ESSHHHHHHHHHHHHHTTCCEEEECTTSCHH---HHHHHHHHHHTTSCSEE
T ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEE----ECCHHHHHHHHHHHHHCCCCEEEEECCCCHH---HHHHHHHHHHHCCCCEE
T ss_conf             8857899999999970899809999----8858999999999985799789985799989---99999999970898689


Q ss_pred             EEECCCCC
Q ss_conf             99648876
Q gi|254780901|r  154 ITVDCGST  161 (600)
Q Consensus       154 ItvD~Gi~  161 (600)
                      |+.|.++.
T Consensus        85 v~Td~~~r   92 (165)
T 1fuk_A           85 ISTDLLAR   92 (165)
T ss_dssp             EEEGGGTT
T ss_pred             EEECCCCC
T ss_conf             86120014


No 174
>>1rdu_A Conserved hypothetical protein; structure determination, structural proteomics, atnos, candid, joint center for structural genomics (JCSG); NMR {Thermotoga maritima} (A:)
Probab=61.51  E-value=9.5  Score=17.47  Aligned_cols=56  Identities=18%  Similarity=0.491  Sum_probs=38.0

Q ss_pred             EECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             80787433668897898874202686899964887623455555417982799615447
Q gi|254780901|r  126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       126 ~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      .+-+|-..+.|-.....+.+...+++.+|+-..|-.+..   .+.+.||+|+.++-=.+
T Consensus        39 ~~e~~~~~~~~~~~~~~~~l~~~~v~~vi~~~iG~~~~~---~l~~~GI~v~~~~~~~v   94 (116)
T 1rdu_A           39 VVENTIADAHGTGPKVVQSLVSKGVEYLIASNVGRNAFE---TLKAAGVKVYRFEGGTV   94 (116)
T ss_dssp             EEECCCCSCCCSSCSHHHHHHTTTCCEEECSSCCSSCHH---HHHTTTCEEECCCSCBH
T ss_pred             EEECCCCCCCCCCHHHHHHHHHCCCCEEEECCCCHHHHH---HHHHCCCEEEECCCCCH
T ss_conf             997668887654317999999879989998887988999---99988999997399899


No 175
>>1ylo_A Hypothetical protein SF2450; structural genomics, MCSG, PSI, protein structure initiative, midwest center for structural genomics; 2.15A {Shigella flexneri 2a str} (A:1-68,A:154-348)
Probab=61.32  E-value=7.3  Score=18.35  Aligned_cols=31  Identities=23%  Similarity=0.296  Sum_probs=26.3

Q ss_pred             HCCCCEEEEECCCC---------------CHHHHHHHHHHHHHHCC
Q ss_conf             77997999940788---------------61528999999999769
Q gi|254780901|r   90 YNSEKIMIFGDYDV---------------DGAASVALMMRFLSHCS  120 (600)
Q Consensus        90 ~~~ekI~I~gDyD~---------------DGitstail~~~L~~~g  120 (600)
                      ..+++|+++|++|+               |..+++|+|.+.++.+.
T Consensus        55 ~~~~~i~~~~H~D~~~~~~~~~~~~~GA~Dn~sGva~lLe~ar~l~  100 (263)
T 1ylo_A           55 STGPKVXICAHXDETFQVLPHQRVXGKAFDDRLSCYLLVTLLRELH  100 (263)
T ss_dssp             CSSCEEEEEEECCCCCEEETTTEEEETTHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCEEEEEECCCCEEEEECCCCEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             9998699996277502565143301222346430467777789876


No 176
>>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid binding, structural genomics; HET: Z99 NAG; 1.90A {Homo sapiens} PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* (A:181-319,A:446-496)
Probab=61.06  E-value=10  Score=17.23  Aligned_cols=102  Identities=11%  Similarity=0.011  Sum_probs=56.0

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHHCCCCEEEEEC
Q ss_conf             99999999997799799994078861528999999999769947998--0787433668897898874202686899964
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFINEGAQLIITVD  157 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD  157 (600)
                      +|.-.|.+... -.+|.|...-|.-|......+.+.++..|..+.+.  +|.....+=--....+.++...+++.||. .
T Consensus         6 ~Al~~li~~fg-W~~V~iI~~d~~YG~~~~~~f~~~~~~~gi~I~~~~~~~~~~~~~~~d~~~~l~~i~~~~a~vVv~-~   83 (190)
T 3ks9_A            6 RAMLDIVKRYN-WTYVSAVHTEGNYGESGMDAFKELAAQEGLSIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVC-F   83 (190)
T ss_dssp             HHHHHHHHHTT-CCEEEEEEESSHHHHHHHHHHHHHHHHTTCEEEEEEEECTTCCHHHHHHHHHHHHTTTTTTCEEEE-E
T ss_pred             HHHHHHHHHCC-CCEEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEE-E
T ss_conf             99999998629-978999995367888999999999997598799999826899878999999998874026427999-8


Q ss_pred             CCCCCHHH-HHHHHHCCCC----EEEECCCC
Q ss_conf             88762345-5555417982----79961544
Q gi|254780901|r  158 CGSTSYDA-LQYATNQGID----VIVIDHHQ  183 (600)
Q Consensus       158 ~Gi~~~e~-i~~a~~~Gid----vIVtDHH~  183 (600)
                      |....... +..|+++|+.    .|++|...
T Consensus        84 ~~~~~~~~il~~a~~~gltg~~~wI~sd~w~  114 (190)
T 3ks9_A           84 CEGMTVRGLLSAMRRLGVVGEFSLIGSDGWA  114 (190)
T ss_dssp             CCHHHHHHHHHHHHHHTCCSCCEEEECTTTT
T ss_pred             ECHHHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             4679999999999983455762499965544


No 177
>>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 1zpd_A* (A:181-357)
Probab=60.66  E-value=10  Score=17.18  Aligned_cols=85  Identities=18%  Similarity=0.225  Sum_probs=57.9

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE------CCCCC------CCCCCCHHHHHHH
Q ss_conf             79999999999977997999940788615289999999997699479980------78743------3668897898874
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI------PDRIV------DGYGPNPSLMEKF  145 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~I------P~R~~------eGYGl~~~~i~~~  145 (600)
                      -..+++++.+.+.+-++.+|+.++.+..--+..-+.++...+|+.|....      |+...      -|++-+... .++
T Consensus        15 ~~~~i~~~~~~L~~A~rPvii~G~g~~~~~a~~~l~~lae~~g~Pv~~t~~g~g~~~~~~p~~~G~~~g~~~~~~~-~~~   93 (177)
T 2wvg_A           15 LNAAVEETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFADALGGAVATMAAAKSFFPEENPHYIGTSWGEVSYPGV-EKT   93 (177)
T ss_dssp             HHHHHHHHHHHHTTCCCEEEEECTTTTTTTCHHHHHHHHHHHCCEEEEEGGGTTSSCTTSTTEEEEECGGGSCTTH-HHH
T ss_pred             CHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHH-HHH
T ss_conf             7999999999986176876851676342026999999998758880143566777866676656765776546999-999


Q ss_pred             HHCCCCEEEEECCCCCCHH
Q ss_conf             2026868999648876234
Q gi|254780901|r  146 INEGAQLIITVDCGSTSYD  164 (600)
Q Consensus       146 ~~~g~~LiItvD~Gi~~~e  164 (600)
                      .++ +||||.+.+-.+...
T Consensus        94 l~~-aDlil~iG~~~~~~~  111 (177)
T 2wvg_A           94 MKE-ADAVIALAPVFNDYS  111 (177)
T ss_dssp             HHH-CSEEEEESCCCBTTT
T ss_pred             HHH-CCEEEEECCCCCCCC
T ss_conf             861-888999666146412


No 178
>>3eme_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics; 2.00A {Staphylococcus aureus subsp} PDB: 3iwh_A (A:)
Probab=60.13  E-value=8.6  Score=17.80  Aligned_cols=34  Identities=21%  Similarity=0.372  Sum_probs=29.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             2686899964887623455555417982799615
Q gi|254780901|r  148 EGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       148 ~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDH  181 (600)
                      .+-.+++.|.+|..+......++++|.++.+.|=
T Consensus        55 ~~~~iv~~c~~g~rs~~~a~~l~~~G~~v~~l~G   88 (103)
T 3eme_A           55 KNEIYYIVCAGGVRSAKVVEYLEANGIDAVNVEG   88 (103)
T ss_dssp             TTSEEEEECSSSSHHHHHHHHHHTTTCEEEEETT
T ss_pred             CCCCCEEECCCCHHHHHHHHHHHHCCCCEEEECC
T ss_conf             2345100579965499999999986997799778


No 179
>>1snn_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, isomerase; HET: 5RP; 1.55A {Methanocaldococcus jannaschii} (A:)
Probab=60.03  E-value=11  Score=17.10  Aligned_cols=91  Identities=13%  Similarity=0.164  Sum_probs=53.5

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCH---------HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHH-----------
Q ss_conf             999999997799799994078861---------528999999999769947998078743366889789-----------
Q gi|254780901|r   82 ARRIVQAIYNSEKIMIFGDYDVDG---------AASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSL-----------  141 (600)
Q Consensus        82 ~~ri~~ai~~~ekI~I~gDyD~DG---------itstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~-----------  141 (600)
                      ++...+++++++.|+|+-|-|-.+         ..+...+....+.-+.-+++-++...-+--||..-.           
T Consensus         4 ie~ai~al~~G~~Viv~D~~~RE~Egdlv~~Ae~~T~e~i~fm~~~a~GliC~a~~~~~a~~L~Lp~m~~~~~~~~~~~~   83 (227)
T 1snn_A            4 VEKAIEALKKGEIILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHPDICNKLGIPFMVDILEFASQKFK   83 (227)
T ss_dssp             HHHHHHHHHTTCCEEEECCTTTTCCEEEEEEGGGCCHHHHHHHHHHTEEEEEEEECHHHHHHHTCCCHHHHHHHHTTTCH
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCEEEEHHHCCHHHHHHHHHHCCCCEEECCCHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             99999999879979998589987651489885659999999999957998774589999987699511230000111233


Q ss_pred             -HHH------HHHCCCCEEEEEC-----CCCCCHHHHHHHHHC
Q ss_conf             -887------4202686899964-----887623455555417
Q gi|254780901|r  142 -MEK------FINEGAQLIITVD-----CGSTSYDALQYATNQ  172 (600)
Q Consensus       142 -i~~------~~~~g~~LiItvD-----~Gi~~~e~i~~a~~~  172 (600)
                       +..      -...++..-|+||     .|||+.+...-++.+
T Consensus        84 ~~~~~~~~~~~~~~~t~FtvsVd~~~~~TGISa~DRa~Tir~l  126 (227)
T 1snn_A           84 VLRELYPNDIPYDEKSSFSITINHRKTFTGITDNDRAFTIKKL  126 (227)
T ss_dssp             HHHHTCCTTCTTSSSCCEEEEEEETTCSSSCSHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             2123445677666774169987046776897606788899998


No 180
>>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP- binding, helicase, nucleotide-binding; 2.80A {Thermus thermophilus HB27} (A:1-180)
Probab=60.02  E-value=11  Score=17.10  Aligned_cols=70  Identities=14%  Similarity=0.236  Sum_probs=49.6

Q ss_pred             HHHHHH--CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             999997--79979999407886152899999999976994799807874336688978988742026868999648876
Q gi|254780901|r   85 IVQAIY--NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        85 i~~ai~--~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      +.+.++  ++++++||    |+....+--+++.|+..|..+.++-..-..+   -....++++.....+.+|+.|++..
T Consensus        19 l~~~i~~~~~~k~lVf----~~s~~~~~~l~~~L~~~~~~~~~ih~~~~~~---~r~~~~~~f~~g~~~vli~t~~~~~   90 (180)
T 3i32_A           19 LSDLLYVASPDRAMVF----TRTKAETEEIAQGLLRLGHPAQALHGDMSQG---ERERVMGAFRQGEVRVLVATDVAAR   90 (180)
T ss_dssp             HHHHHHHHCCSSEEEE----CSSHHHHHHHHHHHHTTTCCEEEECSCCCTH---HHHHHHHHHHHTSCCEEEECSTTTC
T ss_pred             HHHHHHHCCCCEEEEE----ECCHHHHHHHHHHHHHCCCCEEEEECCCCHH---HHHHHHHHHHCCCCCCCCHHHHHHH
T ss_conf             9999985798969999----8968999999999986899689997899767---7666776531023223321555541


No 181
>>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} (A:1-93,A:213-254)
Probab=59.95  E-value=11  Score=17.09  Aligned_cols=79  Identities=22%  Similarity=0.352  Sum_probs=56.0

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC---------HHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             799994078861528999999999769947998078743366889---------78988742026868999648876234
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN---------PSLMEKFINEGAQLIITVDCGSTSYD  164 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~---------~~~i~~~~~~g~~LiItvD~Gi~~~e  164 (600)
                      +|.||   | -|+-+.+++.+..+.+-..-.+|.-+.-.-.||--         .+.++.+.+.++++||. =|-+.+.-
T Consensus         2 pIgiF---D-SGiGGLTVlk~l~~~lP~~~~iY~aD~a~~PYG~Ks~eeI~~~~~~i~~~L~~~~vk~IVI-ACNTASa~   76 (135)
T 1b73_A            2 KIGIF---D-SGVGGLTVLKAIRNRYRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKDKGVDIIVV-ACNTASAY   76 (135)
T ss_dssp             EEEEE---E-SSSGGGTHHHHHHHHSTTCEEEEEECTTTCCCTTSCHHHHHHHHHHHHHHHHTTTCSEEEE-CCHHHHTT
T ss_pred             EEEEE---E-CCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE-ECCCHHHH
T ss_conf             79999---5-8976799999999978999889993379999988999999999999999998659989999-47745889


Q ss_pred             HHHHHHHC-CCCEE
Q ss_conf             55555417-98279
Q gi|254780901|r  165 ALQYATNQ-GIDVI  177 (600)
Q Consensus       165 ~i~~a~~~-GidvI  177 (600)
                      +++.+++. .+.+|
T Consensus        77 AL~~LR~~~~iPIV   90 (135)
T 1b73_A           77 ALERLKKEINVPVF   90 (135)
T ss_dssp             SHHHHHHHSSSCEE
T ss_pred             HHHHHHHHHCCCEE
T ss_conf             99999987148758


No 182
>>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A (A:146-274)
Probab=59.79  E-value=11  Score=17.07  Aligned_cols=78  Identities=23%  Similarity=0.382  Sum_probs=54.0

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHH----HHCCCCEEEEECCCCCCHHHH
Q ss_conf             7997999940788615289999999997699479980787433668897898874----202686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKF----INEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~----~~~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++.||++.||  .-+=+..+ +..++..+|.++...-|.    +|.+....++.+    .+.|.++.+|-|-    .+++
T Consensus         2 ~g~kv~~vGd--~~~rv~~S-~~~~~~~~g~~~~~~~P~----~~~~~~~~~~~~~~~~~~~g~~~~~~~d~----~ea~   70 (129)
T 2i6u_A            2 RGLRLSYFGD--GANNMAHS-LLLGGVTAGIHVTVAAPE----GFLPDPSVRAAAERRAQDTGASVTVTADA----HAAA   70 (129)
T ss_dssp             TTCEEEEESC--TTSHHHHH-HHHHHHHTTCEEEEECCT----TSCCCHHHHHHHHHHHHHHTCCEEEESCH----HHHH
T ss_pred             CCCEEEEECC--CCCCHHHH-HHHHHHHCCCEEECCCCC----CCCCCHHHHHHHHHHHHHCCCCEEEEECH----HHCC
T ss_conf             8988999679--88860146-898886169346514773----23477688887777775248742898411----1013


Q ss_pred             HHHHHCCCCEEEECCCCC
Q ss_conf             555417982799615447
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~  184 (600)
                           .|.|||.||--.-
T Consensus        71 -----~~aDvvyt~~w~~   83 (129)
T 2i6u_A           71 -----AGADVLVTDTWTS   83 (129)
T ss_dssp             -----TTCSEEEECCSSC
T ss_pred             -----CCCEEEEEECHHH
T ss_conf             -----5960999721553


No 183
>>2cf4_A Protein PH0519, phtet1-12S; aminopeptidase, metalloprotein, hyperthermophIle, archaea, tetrahedral, hydrolase; 3.08A {Pyrococcus horikoshii} (A:1-65,A:158-332)
Probab=59.74  E-value=8.1  Score=18.02  Aligned_cols=31  Identities=16%  Similarity=0.265  Sum_probs=26.2

Q ss_pred             HCCCCEEEEECCCC---------------CHHHHHHHHHHHHHHCC
Q ss_conf             77997999940788---------------61528999999999769
Q gi|254780901|r   90 YNSEKIMIFGDYDV---------------DGAASVALMMRFLSHCS  120 (600)
Q Consensus        90 ~~~ekI~I~gDyD~---------------DGitstail~~~L~~~g  120 (600)
                      ..+.+|+++|++|+               |..+++|++.+.++.+.
T Consensus        52 ~~~~~i~~~~H~D~~~~~~~~~~~~~GA~Dn~sGva~lLe~ar~l~   97 (240)
T 2cf4_A           52 EGEERILFXAHXDEHFSVLNGKYVSTRGLDDRFGVVALIEAIKDLV   97 (240)
T ss_dssp             CSSCCCEEEEECCCCCEECSSSEEECTTHHHHHHHHHHHHHHHSSG
T ss_pred             CCCCEEEEEECCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             9998699993477347996363223453456310355689999987


No 184
>>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} (A:110-229)
Probab=59.31  E-value=11  Score=17.01  Aligned_cols=102  Identities=9%  Similarity=0.031  Sum_probs=66.6

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             99999999779979999407886152899999999976994-79980787433668897898874202686899964887
Q gi|254780901|r   82 ARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        82 ~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~-v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      +-.+......+.+|.+.|-++...-...  ..++|+..+.. +......-..+ ..-...+.+.+.+++++.|++ -++.
T Consensus         7 ag~~a~~~~~~~~ig~i~~~~~~~R~~G--f~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~~~~~d~I~~-~nD~   82 (120)
T 2hqb_A            7 GGXVAASXSETHKVGVIAAFPWQPEVEG--FVDGAKYXNESEAFVRYVGEWTD-ADKALELFQELQKEQVDVFYP-AGDG   82 (120)
T ss_dssp             HHHHHHHTCSSSEEEEEESCTTCHHHHH--HHHHHHHTTCCEEEEEECSSSSC-HHHHHHHHHHHHTTTCCEEEC-CCTT
T ss_pred             HHHHHHHHCCCCCEEEECCCCCCHHHHH--HHHHHHHHCCCEEEEEECCCCCH-HHHHHHHHHHHHHHCCCEEEE-CCCC
T ss_conf             9999987367884148834016288889--99998741454169997488222-047999999998505546775-0588


Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             623455555417982799615447655
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSE  187 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~  187 (600)
                      .+...+..+++.|+.||-.|......-
T Consensus        83 ~A~g~~~a~~~~g~~ViG~d~~~~~~~  109 (120)
T 2hqb_A           83 YHVPVVEAIKDQGDFAIGYVGDQADLG  109 (120)
T ss_dssp             THHHHHHHHHHHTCEEEEEESCCSSSS
T ss_pred             CCHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             555899999975974530036621147


No 185
>>1mb4_A Aspartate-semialdehyde dehydrogenase; enzyme, complex, oxidoreductase; HET: NDP; 1.84A {Vibrio cholerae} (A:1-132,A:354-370)
Probab=59.01  E-value=11  Score=16.98  Aligned_cols=86  Identities=14%  Similarity=0.100  Sum_probs=52.1

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE--CCCCCCCC-----CCCH---HHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             7999940788615289999999997699479980--78743366-----8897---898874202686899964887623
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI--PDRIVDGY-----GPNP---SLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~~g~~v~~~I--P~R~~eGY-----Gl~~---~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      ||.|.|   +-|.++..++...++.-..++.+..  .++-..|.     +.+.   ...+....+++++++++=-...+.
T Consensus         2 kVaIvG---ATG~vG~eLirlL~~hp~~ei~~l~~~ss~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvvf~al~~~~s~   78 (149)
T 1mb4_A            2 RVGLVG---WRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTE   78 (149)
T ss_dssp             EEEEES---CSSHHHHHHHHHHHHTTGGGGSEEEEEESSCCSSBCCCSSSCCCBCEETTCHHHHTTCSEEEECSCHHHHH
T ss_pred             EEEEEC---CCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCEECCCCCCCCCCCCCHHHHHCCCEEEECCCCCHHH
T ss_conf             799999---73399999999998556999406999983455897624488420120246842650299999988985002


Q ss_pred             HHHHHHHHCCCCEEEECCC
Q ss_conf             4555554179827996154
Q gi|254780901|r  164 DALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       164 e~i~~a~~~GidvIVtDHH  182 (600)
                      +-+..+.+.|.++.|.|-=
T Consensus        79 ~~~~~~~~ag~~v~viD~S   97 (149)
T 1mb4_A           79 KVYPALRQAGWKGYWIDAA   97 (149)
T ss_dssp             HHHHHHHHTTCCSEEEESS
T ss_pred             HHCHHHHHCCCCEEEEECC
T ss_conf             3242456438708999796


No 186
>>1vkf_A Glycerol uptake operon antiterminator-related protein; TM1436, structural genomics, JCSG, PSI, protein structure initiative; HET: CIT; 1.65A {Thermotoga maritima MSB8} (A:)
Probab=58.99  E-value=11  Score=16.97  Aligned_cols=86  Identities=17%  Similarity=0.220  Sum_probs=60.1

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             97799799994078861528999999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ++..-++...-+-|   +..-.=+.+.+++-|..|..|+-  +-+|-|-.+.+++.+++-+++=|||.     -..-+.+
T Consensus        28 l~s~~~~ifll~g~---I~~L~~~v~~lk~~gK~vfVHiD--li~GL~~D~~ai~fLk~~~~dGIIST-----k~~~i~~   97 (188)
T 1vkf_A           28 GEIEPDVVFLLKSD---ILNLKFHLKILKDRGKTVFVDXD--FVNGLGEGEEAILFVKKAGADGIITI-----KPKNYVV   97 (188)
T ss_dssp             CCCCSSEEEECCEE---TTTHHHHHHHHHHTTCEEEEEGG--GEETCCSSHHHHHHHHHHTCSEEEES-----CHHHHHH
T ss_pred             HHCCCCEEEEECCC---HHHHHHHHHHHHHCCCEEEEEEE--CCCCCCCCHHHHHHHHHCCCCEEEEC-----CHHHHHH
T ss_conf             52799999995684---88899999999986998999865--16777888799999997599999978-----8999999


Q ss_pred             HHHCCCCEE----EECCCCC
Q ss_conf             541798279----9615447
Q gi|254780901|r  169 ATNQGIDVI----VIDHHQV  184 (600)
Q Consensus       169 a~~~GidvI----VtDHH~~  184 (600)
                      |+++|+-+|    ++|-+..
T Consensus        98 Ak~~gl~tIqRiFliDS~al  117 (188)
T 1vkf_A           98 AKKNGIPAVLRFFALDSKAV  117 (188)
T ss_dssp             HHHTTCCEEEEEECCSHHHH
T ss_pred             HHHCCCEEEEEEEEEEHHHH
T ss_conf             99779928987654527789


No 187
>>1nmo_A Hypothetical protein YBGI; toroidal structure, structure 2 function project, S2F, structural genomics, unknown functio; 2.20A {Escherichia coli} (A:1-102,A:218-247)
Probab=58.84  E-value=9.8  Score=17.38  Aligned_cols=30  Identities=23%  Similarity=0.408  Sum_probs=24.6

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             868999648876234555554179827996154
Q gi|254780901|r  150 AQLIITVDCGSTSYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       150 ~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH  182 (600)
                      .+..+++|.   +.+-|+.|.+.|.|+|||-|=
T Consensus        36 ~kI~valD~---t~~vIe~Ai~~g~dLIItHHP   65 (132)
T 1nmo_A           36 QKIVTGVTA---SQALLDEAVRLGADAVIVHHG   65 (132)
T ss_dssp             CEEEEEEEC---CHHHHHHHHHTTCSEEEEEEC
T ss_pred             CEEEEEECC---CHHHHHHHHHCCCCEEEECCC
T ss_conf             989999769---999999999779999997985


No 188
>>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* (A:1-69,A:187-260,A:371-427)
Probab=58.45  E-value=11  Score=16.91  Aligned_cols=112  Identities=15%  Similarity=0.163  Sum_probs=63.5

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCCHHHHHHHHHCCCCEEE
Q ss_conf             48799999999999779979999407886152899999999976994799807874336-68897898874202686899
Q gi|254780901|r   76 TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG-YGPNPSLMEKFINEGAQLII  154 (600)
Q Consensus        76 ~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eG-YGl~~~~i~~~~~~g~~LiI  154 (600)
                      .......+.+..--....+++|+|    =|.++. -+...|.+.|.+|..+=....--| +-++....+.+.+.|++++.
T Consensus        16 ~~~~~~~~~~~~~~~~~~~v~iiG----~G~~g~-~~a~~~~~~g~~v~~~~~~~~~~~p~~l~~~l~~~~~~~Gv~i~~   90 (200)
T 2rgh_A           16 FSNKTRQDSIQKXQQEELDLLIIG----GGITGA-GVAVQAAASGIKTGLIEXQDFAEGDARLVIDNIKKAAEDGAYLVS   90 (200)
T ss_dssp             SSHHHHHHHHHHHHHSCBSEEEEC----CSHHHH-HHHHHHHHTTCCEEEECSSSTTCSHHHHHHHHHHHHHHTTCEEES
T ss_pred             CCHHHHHHHHHHHHCCCCCEEEEC----CCHHHH-HHHHHHHHCCCCEEEEECCCCCCHCHHHHHHHHHHHHHHHHCCCC
T ss_conf             687779999987106987499989----619999-999999977998999969978540378888887777765420255


Q ss_pred             EECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECC
Q ss_conf             9648876234555554179827996154476555672565237
Q gi|254780901|r  155 TVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNP  197 (600)
Q Consensus       155 tvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP  197 (600)
                        .+-++.   +..-......|.++|...-..+...|+.+|+-
T Consensus        91 --~~~V~~---i~~~~~~~~~v~~~~~~t~~~~~i~ad~Vv~A  128 (200)
T 2rgh_A           91 --KXKAVG---FLYEGDQIVGVKARDLLTDEVIEIKAKLVINT  128 (200)
T ss_dssp             --SEEEEE---EEEETTEEEEEEEEETTTCCEEEEEBSCEEEC
T ss_pred             --CEEEEE---EEECCCEEEEEEEEECCCCCEEEEECCEEEEH
T ss_conf             --305888---76237504431332215784245404434553


No 189
>>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* (A:1-105,A:237-273)
Probab=57.84  E-value=11  Score=16.84  Aligned_cols=82  Identities=16%  Similarity=0.350  Sum_probs=58.3

Q ss_pred             HCCCCEEEE-ECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC-CHHH--------HHHHHHCCCCEEEEECCC
Q ss_conf             779979999-407886152899999999976994799807874336688-9789--------887420268689996488
Q gi|254780901|r   90 YNSEKIMIF-GDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGP-NPSL--------MEKFINEGAQLIITVDCG  159 (600)
Q Consensus        90 ~~~ekI~I~-gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl-~~~~--------i~~~~~~g~~LiItvD~G  159 (600)
                      ..+.+|.|+ |     |+-+-+++-+..+.....-..|++|+-.=-||- +.+.        ++.+.+.|+++|+. =|-
T Consensus        10 ~~~~~IGIfDS-----GiGgLavl~~i~~~~p~~~~iyv~D~~~~PYG~ks~e~i~~~~~~~~~~L~~~g~~~IVI-ACN   83 (142)
T 2oho_A           10 MDTRPIGFLDS-----GVGGLTVVCELIRQLPHEKIVYIGDSARAPYGPRPKKQIKEYTWELVNFLLTQNVKMIVF-ACN   83 (142)
T ss_dssp             CCCCCEEEEES-----SSTTHHHHHHHHHHCTTCCEEEEECGGGCCCTTSCHHHHHHHHHHHHHHHHTTTCSEEEE-CCH
T ss_pred             CCCCCEEEEEC-----CCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE-ECC
T ss_conf             79997899978-----977799999999978999999994688999899999999999999999998557875999-615


Q ss_pred             CCCHHHHHHHHH-CCCCEE
Q ss_conf             762345555541-798279
Q gi|254780901|r  160 STSYDALQYATN-QGIDVI  177 (600)
Q Consensus       160 i~~~e~i~~a~~-~GidvI  177 (600)
                      +++.-..+.+++ ..+.+|
T Consensus        84 TAsa~~ld~Lr~~~~iPiI  102 (142)
T 2oho_A           84 TATAVAWEEVKAALDIPVL  102 (142)
T ss_dssp             HHHHHHHHHHHHHCSSCEE
T ss_pred             HHHHHHHHHHHHHCCCCEE
T ss_conf             7887637877640467646


No 190
>>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} (A:118-254)
Probab=57.21  E-value=7.3  Score=18.36  Aligned_cols=79  Identities=13%  Similarity=0.151  Sum_probs=44.6

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHH---HH
Q ss_conf             799799994078861528999999999769947998078743366889789887420268689996488762345---55
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDA---LQ  167 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~---i~  167 (600)
                      ++.+|+|.-|    --+...++...|+.+|..+...-     .    ..++++.+.+..++++| +|......+.   ++
T Consensus        11 ~~~~iLiVdd----~~~~~~~l~~~L~~~g~~v~~a~-----~----~~~Al~~~~~~~~dlii-lD~~lp~~~G~~l~~   76 (137)
T 2ayx_A           11 DDMMILVVDD----HPINRRLLADQLGSLGYQCKTAN-----D----GVDALNVLSKNHIDIVL-SDVNMPNMDGYRLTQ   76 (137)
T ss_dssp             CCCEEEEEES----SHHHHHHHHHHHHHHTSEEEEEC-----C----SHHHHHHHHHSCCSEEE-EEESSCSSCCHHHHH
T ss_pred             CCCEEEEECC----CHHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHCCCCCEEE-EECCCCCCCCHHHHH
T ss_conf             9988999919----89999999999998799999979-----8----79999998628999999-807877885669999


Q ss_pred             HHHHC--CCCEEE-ECCCC
Q ss_conf             55417--982799-61544
Q gi|254780901|r  168 YATNQ--GIDVIV-IDHHQ  183 (600)
Q Consensus       168 ~a~~~--GidvIV-tDHH~  183 (600)
                      .+++.  .+.+|+ |.|-.
T Consensus        77 ~ir~~~~~~pii~lt~~~~   95 (137)
T 2ayx_A           77 RIRQLGLTLPVIGVTANAL   95 (137)
T ss_dssp             HHHHHHCCSCEEEEESSTT
T ss_pred             HHHHHCCCCCEEEEECCCC
T ss_conf             9997389997899978899


No 191
>>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* (A:1-93,A:210-255)
Probab=57.20  E-value=12  Score=16.76  Aligned_cols=118  Identities=22%  Similarity=0.295  Sum_probs=68.8

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC---------HHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             799994078861528999999999769947998078743366889---------78988742026868999648876234
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN---------PSLMEKFINEGAQLIITVDCGSTSYD  164 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~---------~~~i~~~~~~g~~LiItvD~Gi~~~e  164 (600)
                      +|.||   | -|+-+.+++.+..+.+-..-..|+-|.-.-.||--         .+.++.+.+.++++||. -|-+.+.-
T Consensus         2 pIGVF---D-SGiGGLTVlk~i~k~lP~~~~IY~aD~a~~PYG~Ks~eeI~~~~~~iv~~L~~~~vk~IVI-ACNTASa~   76 (139)
T 2jfz_A            2 KIGVF---D-SGVGGFSVLKSLLKARLFDEIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKPHEIELLIV-ACNTASAL   76 (139)
T ss_dssp             EEEEE---E-SSSTTHHHHHHHHHTTCCSEEEEEECTTTCCCTTSCHHHHHHHHHHHHHHHGGGCCSCEEE-CCHHHHHH
T ss_pred             EEEEE---E-CCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE-ECCHHHHH
T ss_conf             79999---4-8976799999999978999989995378899899999999999999999876336567887-05468774


Q ss_pred             HHHHHHHC-CCCEEE-ECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHH-HHHHHH
Q ss_conf             55555417-982799-61544765556725652378888643344304788-999999
Q gi|254780901|r  165 ALQYATNQ-GIDVIV-IDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAG-VVFLVL  219 (600)
Q Consensus       165 ~i~~a~~~-GidvIV-tDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaG-vaf~l~  219 (600)
                      +.+.+++. .+.||= .--...-+-+-..+++   |...|.+|--+..++| |.|+--
T Consensus        77 aL~~LR~~~~iPVIGvI~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~  131 (139)
T 2jfz_A           77 ALEEMQKYSKIPIVGVISGDAIVEYLQQKYAL---KNNACTFPKVEFHASGDVIWLER  131 (139)
T ss_dssp             THHHHHHHCSSCEECSSHHHHHHHHHHHHTTC---CSCSCSSCEEEEEESSCHHHHHH
T ss_pred             HHHHHHHCCCEEEEECCHHHHHHHHHHHHHHH---HCCCCCCCCEEEEECCCHHHHHH
T ss_conf             26888644861799664089999999987620---22479998559998999899999


No 192
>>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* (A:131-309)
Probab=57.18  E-value=12  Score=16.76  Aligned_cols=78  Identities=12%  Similarity=0.008  Sum_probs=43.0

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHH-HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHH
Q ss_conf             97799799994078861528999-99999976994799807874336688978988742026868999648876234555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVAL-MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQ  167 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstai-l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~  167 (600)
                      ++.+++|+|+|     |.+++.+ +....+..|+++...+..+        ++..+...+-|++-+|.-+......+..+
T Consensus        23 ~~~g~~VlI~g-----a~~~~g~~a~qlak~~g~~vv~~~~~~--------~~~~~~~~~lGad~vid~~~~~~~~~~~~   89 (179)
T 2j3h_A           23 PKEGETVYVSA-----ASGAVGQLVGQLAKMMGCYVVGSAGSK--------EKVDLLKTKFGFDDAFNYKEESDLTAALK   89 (179)
T ss_dssp             CCTTCEEEESS-----TTSHHHHHHHHHHHHTTCEEEEEESSH--------HHHHHHHHTSCCSEEEETTSCSCSHHHHH
T ss_pred             CCCCCEEEEEC-----CCCCHHHHHHHHHHHHCCCEEEEECCC--------CCCEECCCCCCCHHHCCCCCCCCHHHHEE
T ss_conf             57884453330-----565312578799987228559996461--------01020113566211024333211011000


Q ss_pred             HHHHCCCCEEEE
Q ss_conf             554179827996
Q gi|254780901|r  168 YATNQGIDVIVI  179 (600)
Q Consensus       168 ~a~~~GidvIVt  179 (600)
                      .....|.|+++-
T Consensus        90 ~~~~~~~dvv~d  101 (179)
T 2j3h_A           90 RCFPNGIDIYFE  101 (179)
T ss_dssp             HHCTTCEEEEEE
T ss_pred             CCCCCCCCEEEE
T ss_conf             013578675422


No 193
>>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix; 1.90A {Lactococcus lactis} (A:1-163,A:294-332)
Probab=57.09  E-value=12  Score=16.75  Aligned_cols=144  Identities=12%  Similarity=0.086  Sum_probs=86.3

Q ss_pred             HHHHHHHHCCCH-HHHHHHHHCC-CCHHHHHHHCCC--CHHHCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCH
Q ss_conf             999998819999-9999999678-897898866196--677718995561487999999999997799799994078861
Q gi|254780901|r   30 ALAITQKHAIPD-IVARVLVNRN-VSIDYAKDFLNP--SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDG  105 (600)
Q Consensus        30 ~~~l~~~~~~~~-~~a~iL~~Rg-i~~~~~~~fL~p--~l~~l~~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DG  105 (600)
                      ...+++.+|+|. .++++|-+|+ ++++..+.-+.-  .+... |++.          .-.........|.+..+..-|.
T Consensus         8 l~dIA~~agVS~sTVSRvLn~~~~Vs~~TrerV~~aa~elgY~-~~~~----------a~~~~~~~~~~i~~i~~~~~~~   76 (202)
T 2o20_A            8 IYDVARVAGVSMATVSRVVNGNANVKEKTRQKVLEAIAELDYR-PNAV----------ARGLASKRTTTVGVILPTITST   76 (202)
T ss_dssp             -----------------------------------------------------------------CCCEEEEEESCTTCH
T ss_pred             HHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCC-CCHH----------HHHHHCCCCCEECCCCCCCCCC
T ss_conf             9999999796999999997896999999999999999996897-6988----------9976308874520013455565


Q ss_pred             HHHHHHH--HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             5289999--99999769947998078743366889789887420268689996488762345555541798279961544
Q gi|254780901|r  106 AASVALM--MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       106 itstail--~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      ..+..+-  .+.++..|..+..+..+.-.+   -..+.++.+...+++-+|.+... ...+.+..+.+.|+-++++|-..
T Consensus        77 ~~~~il~gi~~~a~~~G~~v~i~~~~~d~~---~~~~~l~~l~~~~vdGiIi~~~~-~~~~~~~~l~~~~iPvVlid~~~  152 (202)
T 2o20_A           77 YFAAITRGVDDIASMYKYNMILANSDNDVE---KEEKVLETFLSKQVDGIVYMGSS-LDEKIRTSLKNSRTPVVLVGTID  152 (202)
T ss_dssp             HHHHHHHHHHHHHHHTTCEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEECSSC-CCHHHHHHHHHHCCCEEEESCCC
T ss_pred             CCCCCCCCCHHHHHHCCCCEEECCCCCCHH---HHHHHHHHHHHCCCCCCCCCCCC-CCHHHHHHHCCCCCCEEEECCCC
T ss_conf             211112220345552585245134568778---89999999982075654010134-53677766315778778630355


Q ss_pred             CCCCC
Q ss_conf             76555
Q gi|254780901|r  184 VKSEE  188 (600)
Q Consensus       184 ~~~~~  188 (600)
                      +....
T Consensus       153 ~~~~~  157 (202)
T 2o20_A          153 GDKEI  157 (202)
T ss_dssp             TTSCS
T ss_pred             CCCCC
T ss_conf             44567


No 194
>>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* (A:1-129,A:316-336)
Probab=56.94  E-value=12  Score=16.73  Aligned_cols=104  Identities=17%  Similarity=0.178  Sum_probs=59.9

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEC-CCCCCCCCCCH-------HHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             9979999407886152899999999976994799807-87433668897-------898874202686899964887623
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP-DRIVDGYGPNP-------SLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP-~R~~eGYGl~~-------~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      .-||+|.|   +-|.++..|+...+..-..++..+.. +|..+|-.+..       ..+....-+++++++.+=-+-.+.
T Consensus         3 ~~kVaIiG---ATG~vG~eLl~lL~~h~~~~~~~~~~~s~~~~g~~~~~~~~~~~~~~~~~~~~~~~DvVf~a~~~~~s~   79 (150)
T 2r00_A            3 QFNVAIFG---ATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALFSAGGELSA   79 (150)
T ss_dssp             CEEEEEET---TTSHHHHHHHHHHHHTTCCEEEEEEEECTTTTTCEEEETTEEEEEEEGGGCCGGGCSEEEECSCHHHHH
T ss_pred             CCEEEEEC---CCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCCEEEEECCCHHHHHCCCEEEECCCCCHHH
T ss_conf             76799999---862999999999971999861289998788799732048956478244632230074664268851215


Q ss_pred             HHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCC
Q ss_conf             455555417982799-61544765556725652378
Q gi|254780901|r  164 DALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       164 e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~  198 (600)
                      +-...+.+.|..||- +=.|...++.|-.+.=+|+.
T Consensus        80 ~~~~~~~~~G~~vIDlS~~~R~~~~~py~lPEvn~~  115 (150)
T 2r00_A           80 KWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPE  115 (150)
T ss_dssp             HHHHHHHHTTCEEEECSSTTTTCTTSCBCCTTTCGG
T ss_pred             HHHHHHHHCCCEEECCCHHHHCCCCHHHHHCCCCHH
T ss_conf             553888864966861652332376312310114599


No 195
>>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* (A:1-175,A:352-379)
Probab=56.83  E-value=12  Score=16.72  Aligned_cols=71  Identities=17%  Similarity=0.165  Sum_probs=40.1

Q ss_pred             CCCEEEEEC--CCC-CHHHHHHHHHHHHHHCCC-CEEEEECC----C----CCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             997999940--788-615289999999997699-47998078----7----43366889789887420268689996488
Q gi|254780901|r   92 SEKIMIFGD--YDV-DGAASVALMMRFLSHCSV-NANMYIPD----R----IVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        92 ~ekI~I~gD--yD~-DGitstail~~~L~~~g~-~v~~~IP~----R----~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      ++.+.|...  .++ |-+.-..++..+++..|+ ++...||-    |    +..|==.+..+...+...|++-+||||--
T Consensus        79 g~dV~IIqs~~~~~nd~lmELlllidAlr~~gA~~ItlViPYl~YaRQDr~~~~g~~~a~~va~~L~~~g~d~VitvD~H  158 (203)
T 2ji4_A           79 GKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLH  158 (203)
T ss_dssp             TCEEEEECCCCSCHHHHHHHHHHHHHHHHHTTCSEEEEECSSCSSCCC-------CCHHHHHHHHHHHTTCCEEEEESCS
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             99689992799981378999999999998737752589722456432452002565058899877775288722254137


Q ss_pred             CCC
Q ss_conf             762
Q gi|254780901|r  160 STS  162 (600)
Q Consensus       160 i~~  162 (600)
                      +..
T Consensus       159 s~~  161 (203)
T 2ji4_A          159 QKE  161 (203)
T ss_dssp             SGG
T ss_pred             CHH
T ss_conf             355


No 196
>>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} (A:59-159,A:294-316)
Probab=56.62  E-value=12  Score=16.69  Aligned_cols=74  Identities=11%  Similarity=0.148  Sum_probs=48.5

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             999999769947998078743366889789887420268689996488762345555541798279961544765556
Q gi|254780901|r  112 MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       112 l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      +.+.++..|..+..+....-.+   ...+.++.+.+.+++-+|.+. .....+.++.+.+.|+.+|..|.+.+....|
T Consensus        24 ie~~a~~~Gy~l~i~~t~~~~~---~e~~~i~~l~~~~vdGiIi~~-~~~~~~~~~~l~~~~iPvV~i~~~~~~~~~~   97 (124)
T 2hsg_A           24 IEDIATMYKYNIILSNSDQNQD---KELHLLNNMLGKQVDGIIFMS-GNVTEEHVEELKKSPVPVVLAASIESTNQIP   97 (124)
T ss_dssp             HHHHHHHHTCEEEEEECCSHHH---HHHHHHHHTSCCSSCCEEECC-SSCCHHHHHHHTTSSSCEEEESCCCSCTTSC
T ss_pred             CCCCCCCCCCEEEEECCCCCHH---HHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             4221111332035411467758---899999877632753697214-4310345666531002233322347875544


No 197
>>2otd_A Glycerophosphodiester phosphodiesterase; structural genomics, MCSG, PSI-2, protein structure initiative, midwest center for structural genomics; 2.60A {Shigella flexneri} (A:)
Probab=56.54  E-value=12  Score=16.68  Aligned_cols=28  Identities=21%  Similarity=0.279  Sum_probs=18.9

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             6234555554179827996154476555
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      ++.++...|.+.|.|.|=+|=+.-.+..
T Consensus        22 NTl~af~~A~~~Gad~iE~DV~~TkDg~   49 (247)
T 2otd_A           22 NTLAAIDVGAKYGHKXIEFDAKLSKDGE   49 (247)
T ss_dssp             SSHHHHHHHHHTTCSEEEEEEEECTTCC
T ss_pred             CHHHHHHHHHHCCCCEEEEEEEEECCCC
T ss_conf             2499999999859898999889925998


No 198
>>3k4h_A Putative transcriptional regulator; structural genomics, protein structure initiative; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} (A:1-114,A:247-292)
Probab=56.13  E-value=12  Score=16.63  Aligned_cols=69  Identities=10%  Similarity=0.038  Sum_probs=47.1

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             9999976994799807874336688978988742026868999648876234555554179827996154476
Q gi|254780901|r  113 MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK  185 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~  185 (600)
                      .+.++..|..+..+..+.-.+   .-...++.+...+++=+|.+.. ..+.+.++.+.+.|+.++++|...++
T Consensus        36 ~~~~~~~g~~lil~~~~~~~~---~~~~~~~~l~~~~vDGiIi~~~-~~~~~~~~~l~~~~iPvV~id~~~~~  104 (160)
T 3k4h_A           36 SSFAHVEGYALYXSTGETEEE---IFNGVVKXVQGRQIGGIILLYS-RENDRIIQYLHEQNFPFVLIGKPYDR  104 (160)
T ss_dssp             HHHHHHTTCEEEECCCCSHHH---HHHHHHHHHHTTCCCEEEESCC-BTTCHHHHHHHHTTCCEEEESCCSSC
T ss_pred             HHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHCCCCCEEEEECC-CCCCHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             999998599999983899889---9999999986378665765302-34312333455325322334655444


No 199
>>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} (A:1-133,A:354-367)
Probab=56.07  E-value=11  Score=16.93  Aligned_cols=88  Identities=15%  Similarity=0.174  Sum_probs=54.3

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCH--------HHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             9799994078861528999999999769947998--0787433668897--------89887420268689996488762
Q gi|254780901|r   93 EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNP--------SLMEKFINEGAQLIITVDCGSTS  162 (600)
Q Consensus        93 ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~--------~~i~~~~~~g~~LiItvD~Gi~~  162 (600)
                      .||.|.|   +-|.++..++...++.-..++.+.  -.++-..|.-+..        .....-.-.++++++.+=-+..+
T Consensus         2 ~kV~IvG---ATG~vG~eLirlL~~hp~~ei~~l~~~ss~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DvVf~al~~~~s   78 (147)
T 1t4b_A            2 QNVGFIG---WRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDIIVTCQGGDYT   78 (147)
T ss_dssp             CEEEEES---TTSHHHHHHHHHHHHTTGGGGSEEEEEESSSTTSBCCGGGTCCCBCEETTCHHHHHTCSEEEECSCHHHH
T ss_pred             CEEEEEC---CCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCEECCCEEEEECCCCHHHCCCCCEEEECCCCCCC
T ss_conf             6899969---8039999999999847799850799998303279860358943467625897583488889988885423


Q ss_pred             HHHHHHHHHCCCCEEEECCCC
Q ss_conf             345555541798279961544
Q gi|254780901|r  163 YDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       163 ~e~i~~a~~~GidvIVtDHH~  183 (600)
                      .+-+..+.+.|.+++|.|.-.
T Consensus        79 ~~~~~~~~~~g~~~~vid~s~   99 (147)
T 1t4b_A           79 NEIYPKLRESGWQGYWIDAAS   99 (147)
T ss_dssp             HHHHHHHHHTTCCCEEEECSS
T ss_pred             CCCCHHHHHCCCCEEEEECCH
T ss_conf             100678885388369994140


No 200
>>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavoprotein, 3D-structure, oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} (A:40-108,A:319-376)
Probab=55.99  E-value=12  Score=16.62  Aligned_cols=79  Identities=15%  Similarity=0.137  Sum_probs=46.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCC-HHHHHHHHHHHHHHHHHHC
Q ss_conf             686899964887623455555417982799615447655567256523788886433443-0478899999999999702
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGH-LCAAGVVFLVLVLIYRILR  227 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~-l~gaGvaf~l~~al~~~l~  227 (600)
                      ..+.+| +-.|++-.....++.+.|.+|+|.|-+.......... ...........++.. -.....++.|-.+|.+.++
T Consensus         5 ~~dViI-IGAG~aGl~aA~~La~~G~kV~VlEk~~~~~~~~~~a-~~~~~~e~~~~~~~~~rq~aea~~~~~~~~~~~~~   82 (127)
T 2e1m_A            5 PKRILI-VGAGIAGLVAGDLLTRAGHDVTILEANANRVGGRIKT-FHAKKGEPSPFADPAQYAEAGASRMLPETLAKDLR   82 (127)
T ss_dssp             CCEEEE-ECCBHHHHHHHHHHHHTSCEEEEECSCSSCCBTTCCE-ECCCTTSCCSSSSTTCCEESSCTTHHHHHHHHHGG
T ss_pred             CCEEEE-ECCCHHHHHHHHHHHHCCCCEEEEECCCCCCEEEEEE-EECCCCCCCCCCCCCEEEECCCHHHHHHHHHHHCC
T ss_conf             996999-8978899999999985899589996799971445899-97378876665578839967879999999998579


Q ss_pred             CC
Q ss_conf             14
Q gi|254780901|r  228 QD  229 (600)
Q Consensus       228 ~~  229 (600)
                      +.
T Consensus        83 ~~   84 (127)
T 2e1m_A           83 DQ   84 (127)
T ss_dssp             GT
T ss_pred             CE
T ss_conf             92


No 201
>>2fyw_A Conserved hypothetical protein; structural genomics, PSI, midwest center for structural genomics, MCSG; 2.40A {Streptococcus pneumoniae TIGR4} (A:22-106,A:230-267)
Probab=55.82  E-value=11  Score=16.86  Aligned_cols=29  Identities=21%  Similarity=0.552  Sum_probs=23.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             68999648876234555554179827996154
Q gi|254780901|r  151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       151 ~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH  182 (600)
                      +..+++|.   ..+-++.|.+.|+++|||-|=
T Consensus        19 ~I~valD~---t~evi~~Ai~~~~nlIItHHP   47 (123)
T 2fyw_A           19 RVXVALDI---REETVAEAIEKGVDLIIVKHA   47 (123)
T ss_dssp             EEEEESCC---CHHHHHHHHHTTCSEEEESSC
T ss_pred             EEEEEECC---CHHHHHHHHHCCCCEEEEECC
T ss_conf             89999729---999999999769998997074


No 202
>>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} (A:)
Probab=55.47  E-value=12  Score=16.56  Aligned_cols=108  Identities=10%  Similarity=0.019  Sum_probs=60.5

Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH---HHHCCCCEEE-EECCCCCCCCCCCHHHHHHH-H
Q ss_conf             55614879999999999977997999940788615289999999---9976994799-80787433668897898874-2
Q gi|254780901|r   72 PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRF---LSHCSVNANM-YIPDRIVDGYGPNPSLMEKF-I  146 (600)
Q Consensus        72 P~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~---L~~~g~~v~~-~IP~R~~eGYGl~~~~i~~~-~  146 (600)
                      +++-.-..++.++|..++..+++|+|--   -=|.-|+++|+.+   .+..+.++.. ++-+...  +--..+.++++ .
T Consensus        26 ~~l~~~~~~~~~~i~~~~~~~~~v~va~---SGGkDS~~lL~ll~~l~~~~~~~i~~~~~d~g~~--~~~~~~~~~~~~~  100 (325)
T 1zun_A           26 THLKQLEAESIHIIREVAAEFDNPVXLY---SIGKDSAVXLHLARKAFFPGKLPFPVXHVDTRWK--FQEXYRFRDQXVE  100 (325)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHCSSEEEEC---CSSHHHHHHHHHHHHHHTTSCCSSCEEEECCSCC--CHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEEE---CCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCC--CHHHHHHHHHHHH
T ss_conf             7999999999999999999669879996---6768999999999998764089856999668885--0899999999999


Q ss_pred             HCCCCEEEEE-CC---------CCCCHH---------HHHHHHHCCCCEEEECCCCC
Q ss_conf             0268689996-48---------876234---------55555417982799615447
Q gi|254780901|r  147 NEGAQLIITV-DC---------GSTSYD---------ALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       147 ~~g~~LiItv-D~---------Gi~~~e---------~i~~a~~~GidvIVtDHH~~  184 (600)
                      +-|+.+.+.- +.         |.+...         -...+++.|.++|+|-||.-
T Consensus       101 ~~~i~~~v~~~~~~~~~~~~~~~~~~~~~~r~~r~~~l~~~~~~~~~~~i~~gh~~d  157 (325)
T 1zun_A          101 EXGLDLITHINPDGVAQGINPFTHGSAKHTDIXKTEGLKQALDKHGFDAAFGGARRD  157 (325)
T ss_dssp             TTTCCEEEECC--------------CCHHHHHHTHHHHHHHHHHHTCSEEECCCCTT
T ss_pred             HHCCCCCEECCHHHHHCCCCCCCCCCHHCCEEHHCCHHHHHHHHHCCCEEEEEEECC
T ss_conf             953565042170465517563224611124001011066778760886589742023


No 203
>>2pc8_A Hypothetical protein XOG1; EXO-glucanase, carbohydrate binding, additional CH binding site, hydrolase; HET: BGC; 1.80A {Candida albicans} PDB: 2pb1_A* 2pbo_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A (A:)
Probab=55.36  E-value=12  Score=16.57  Aligned_cols=54  Identities=19%  Similarity=0.131  Sum_probs=32.1

Q ss_pred             CCCCHHHHHHHHHCCCCEE---E-----EECCC-CCC------H-HHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             6889789887420268689---9-----96488-762------3-4555554179827996154476555
Q gi|254780901|r  135 YGPNPSLMEKFINEGAQLI---I-----TVDCG-STS------Y-DALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       135 YGl~~~~i~~~~~~g~~Li---I-----tvD~G-i~~------~-e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      |.+.++-++.+++.|.+.+   |     ..+-+ .-+      . +.++.|++.||.|||+=||.+....
T Consensus        73 ~~~~~~Di~~~~~~G~n~vRi~v~w~~~~~~~~~~~~~~~~~~~d~~i~~~~~~Gl~vil~lh~~~~~~~  142 (400)
T 2pc8_A           73 TWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQN  142 (400)
T ss_dssp             HSSCHHHHHHHHHTTCCEEEEEEEGGGTCCCTTCCCCCCHHHHHHHHHHHHHHTTCEEEEEEEECTTCSS
T ss_pred             HCCCHHHHHHHHHCCCCEEEEEECHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             3388999999997699989998158994688877652368999999999999789889999423467766


No 204
>>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} (A:)
Probab=55.36  E-value=13  Score=16.54  Aligned_cols=63  Identities=16%  Similarity=0.206  Sum_probs=37.2

Q ss_pred             EEEEECC-CCCHHHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHHC-CCCEEEEECCCCCCH
Q ss_conf             9999407-8861528999999999769947998--0787433668897898874202-686899964887623
Q gi|254780901|r   95 IMIFGDY-DVDGAASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFINE-GAQLIITVDCGSTSY  163 (600)
Q Consensus        95 I~I~gDy-D~DGitstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~~-g~~LiItvD~Gi~~~  163 (600)
                      |...||- .-.==+.+..+...|+..|.++.++  +|+...    .-.++++++.+. ++++|||.  |-+..
T Consensus        18 ii~~GdE~G~~~d~n~~~l~~~l~~~G~~v~~~~~v~Dd~~----~i~~~i~~~~~~~~~dlVitt--GG~g~   84 (169)
T 1y5e_A           18 IVTISDTRTEETDKSGQLLHELLKEAGHKVTSYEIVKDDKE----SIQQAVLAGYHKEDVDVVLTN--GGTGI   84 (169)
T ss_dssp             EEEECSSCCTTTCHHHHHHHHHHHHHTCEEEEEEEECSSHH----HHHHHHHHHHTCTTCSEEEEE--CCCSS
T ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEEEEECCCHH----HHHHHHHHHHHCCCCCEEEEE--CCCCC
T ss_conf             99971888877584099999999977995678656358799----999999987525667589984--35555


No 205
>>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} (A:)
Probab=55.27  E-value=13  Score=16.53  Aligned_cols=66  Identities=12%  Similarity=0.046  Sum_probs=37.5

Q ss_pred             HHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHH-CCCCEEEEECCCCCCH---HHHHH-HHHCCCCEEEE
Q ss_conf             28999999999769947998--078743366889789887420-2686899964887623---45555-54179827996
Q gi|254780901|r  107 ASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFIN-EGAQLIITVDCGSTSY---DALQY-ATNQGIDVIVI  179 (600)
Q Consensus       107 tstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~-~g~~LiItvD~Gi~~~---e~i~~-a~~~GidvIVt  179 (600)
                      +.+.+|...|+..|.++..+  +|+...+    -.+.++.+.+ ..+++|||.  |-++.   +-... ..++| +..+.
T Consensus        28 ~n~~~l~~~l~~~G~~v~~~~~v~Dd~~~----i~~~i~~~~~~~~~Divitt--GG~g~g~~D~t~~~l~~~~-~~~~~  100 (172)
T 1mkz_A           28 TSGHYLRDSAQEAGHHVVDKAIVKENRYA----IRAQVSAWIASDDVQVVLIT--GGTGLTEGDQAPEALLPLF-DREVE  100 (172)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEEEECSCHHH----HHHHHHHHHHSSSCCEEEEE--SCCSSSTTCCHHHHHGGGC-SEECH
T ss_pred             CHHHHHHHHHHHCCCEEEEEEEECCCHHH----HHHHHHHHHHCCCCEEEEEC--CEEECCCCCCCHHHHHHHH-HHHHH
T ss_conf             73999999999859946665672898899----99999998753684289856--7786688889989998756-53520


No 206
>>3eua_A Putative fructose-aminoacid-6-phosphate deglycase; NP_391141.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 1.90A {Bacillus subtilis} (A:1-155)
Probab=54.89  E-value=13  Score=16.49  Aligned_cols=115  Identities=10%  Similarity=0.120  Sum_probs=60.5

Q ss_pred             CCCHHHHHHHHHHHHH--CCCCEEEEECCCCCHHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHH-HHH-C
Q ss_conf             1487999999999997--799799994078861528--999999999769947998078743366889789887-420-2
Q gi|254780901|r   75 LTDCDKAARRIVQAIY--NSEKIMIFGDYDVDGAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEK-FIN-E  148 (600)
Q Consensus        75 l~dm~~A~~ri~~ai~--~~ekI~I~gDyD~DGits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~-~~~-~  148 (600)
                      +..+++..+++.+.+.  +.++|.++|-    |.+.  +.-+...|..++..+....+.        ....+.. ... .
T Consensus         6 ~~~i~~~i~~~~~~i~~~~a~~I~i~G~----G~S~~~a~~~~~~l~~~~~~~~~~~~~--------~~~~~~~~~~~~~   73 (155)
T 3eua_A            6 TAKVNREVQAFLQDLKGKTIDHVFFVAC----GGSSAIXYPSKYVFDRESKSINSDLYS--------ANEFIQRNPVQLG   73 (155)
T ss_dssp             GGGSCHHHHHHHHHHTTCCCCEEEEEEC----THHHHTTHHHHHHHHHHCSSCEEEEEE--------HHHHHHHCCTTCS
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEE----CHHHHHHHHHHHHHHHHCCCCCEEEEC--------HHHHHHCCCCCCC
T ss_conf             9999999999999997389998999980----159999999999999856899789962--------2886504876789


Q ss_pred             CCCEEEEECCCCCC---HHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEEECCCCCC
Q ss_conf             68689996488762---3455555417982799-61544765556725652378888
Q gi|254780901|r  149 GAQLIITVDCGSTS---YDALQYATNQGIDVIV-IDHHQVKSEEIPAYALVNPNRLD  201 (600)
Q Consensus       149 g~~LiItvD~Gi~~---~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~aivNP~~~~  201 (600)
                      .-+++|.+..+-.+   .+.++.|+++|+.+|. |+...-+=..---..+.-|..+.
T Consensus        74 ~~dlvi~iS~sG~t~~~~~~~~~a~~~g~~~I~iT~~~~s~l~~~ad~~l~~~~~~~  130 (155)
T 3eua_A           74 EKSLVILCSHSGNTPETVKAAAFARGKGALTIAXTFKPESPLAQEAQYVAQYDWGDE  130 (155)
T ss_dssp             TTEEEEEEESSSCCHHHHHHHHHHHHTTCEEEEEESCTTSHHHHHSSEEEECCCSTT
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCHHHCCCCCCEECCCCC
T ss_conf             996899980899986799999865530221332127632111212454400023643


No 207
>>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} (A:1-149,A:331-350)
Probab=54.69  E-value=11  Score=17.10  Aligned_cols=88  Identities=8%  Similarity=0.015  Sum_probs=56.9

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC------CC------CHHH-------HHHHHHCCCC
Q ss_conf             799799994078861528999999999769947998078743366------88------9789-------8874202686
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY------GP------NPSL-------MEKFINEGAQ  151 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGY------Gl------~~~~-------i~~~~~~g~~  151 (600)
                      +.-||+|.|   +=|.++..++-..++.-..++.+...+|-..|-      +.      ....       .......|++
T Consensus         3 ~~~kVaIvG---ATG~vG~~L~~lL~~~p~~~~v~i~~s~~~~g~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~D   79 (169)
T 2ep5_A            3 DKIKVSLLG---STGMVGQKMVKMLAKHPYLELVKVSASPSKIGKKYKDAVKWIEQGDIPEEVQDLPIVSTNYEDHKDVD   79 (169)
T ss_dssp             CCEEEEEES---CSSHHHHHHHHHHTTCSSEEEEEEECCGGGTTSBHHHHCCCCSSSSCCHHHHTCBEECSSGGGGTTCS
T ss_pred             CCCEEEEEC---CCHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCHHHCCCCCCCCCCCCCCCCEEEECCCCCCCCCC
T ss_conf             998899999---54299999999997399960899996064378660441551004776520135258853323455787


Q ss_pred             EEEEE-CCCCCCHHHHHHHHHCCCCEEE--ECCC
Q ss_conf             89996-4887623455555417982799--6154
Q gi|254780901|r  152 LIITV-DCGSTSYDALQYATNQGIDVIV--IDHH  182 (600)
Q Consensus       152 LiItv-D~Gi~~~e~i~~a~~~GidvIV--tDHH  182 (600)
                      +++.+ |.+ .+.+-.+.+.+.|..+|.  .|+-
T Consensus        80 ~vf~av~~~-~~~~~a~~~~~~G~~vidlssa~r  112 (169)
T 2ep5_A           80 VVLSALPNE-LAESIELELVKNGKIVVSNASPFR  112 (169)
T ss_dssp             EEEECCCHH-HHHHHHHHHHHTTCEEEECSSTTT
T ss_pred             EEEEECCCC-HHHHHHHHHHHCCCCEECCCHHHC
T ss_conf             899803540-267899999975885130440001


No 208
>>2yxo_A Histidinol phosphatase; metal-dependent, hydrolase; 1.60A {Thermus thermophilus} PDB: 2yz5_A 2z4g_A (A:)
Probab=54.51  E-value=11  Score=16.94  Aligned_cols=29  Identities=21%  Similarity=0.316  Sum_probs=21.0

Q ss_pred             CCCCCHHH-HHHHHHCCCCEE-EECCCCCCC
Q ss_conf             88762345-555541798279-961544765
Q gi|254780901|r  158 CGSTSYDA-LQYATNQGIDVI-VIDHHQVKS  186 (600)
Q Consensus       158 ~Gi~~~e~-i~~a~~~GidvI-VtDHH~~~~  186 (600)
                      .|....++ ++.|+++|++.| ||||.....
T Consensus        13 DG~~~~eeli~~A~~~Gl~~iaiTDH~~~~~   43 (267)
T 2yxo_A           13 HAEGHPEAYLEEARAKGLKGVVFTDHSPMPP   43 (267)
T ss_dssp             SCCSCHHHHHHHHHHTTCSEEEEEEECCCCT
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             8687899999999984999999968998757


No 209
>>2yyb_A Hypothetical protein TTHA1606; structural genomics, unknown function, NPPSFA; 2.60A {Thermus thermophilus HB8} (A:1-102,A:214-242)
Probab=54.51  E-value=13  Score=16.44  Aligned_cols=29  Identities=17%  Similarity=0.355  Sum_probs=24.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             86899964887623455555417982799615
Q gi|254780901|r  150 AQLIITVDCGSTSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       150 ~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDH  181 (600)
                      .+..+|+|.   ..+-++.|.++|.|+|||-|
T Consensus        37 ~kI~valD~---T~evi~~Ai~~g~dlIItHH   65 (131)
T 2yyb_A           37 RKVGAAVDA---GEAIFRKALEEEVDFLIVHH   65 (131)
T ss_dssp             CCEEEEEEC---SHHHHHHHHHTTCSEEEEEE
T ss_pred             CEEEEEECC---CHHHHHHHHHCCCCEEEECC
T ss_conf             889999779---99999999987999999897


No 210
>>1zcz_A Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} (A:336-464)
Probab=54.34  E-value=13  Score=16.42  Aligned_cols=103  Identities=17%  Similarity=0.158  Sum_probs=63.8

Q ss_pred             CCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHH----HH----HHHH-HHHHHHCCCCEEEEECCCCCCCCCCCHH
Q ss_conf             9955614879999999999977997999940788615----28----9999-9999976994799807874336688978
Q gi|254780901|r   70 PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGA----AS----VALM-MRFLSHCSVNANMYIPDRIVDGYGPNPS  140 (600)
Q Consensus        70 ~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGi----ts----tail-~~~L~~~g~~v~~~IP~R~~eGYGl~~~  140 (600)
                      |.+..+.||.=| ..+.++.+ ..-|.++.|.-.-|+    ||    +-+- .++-..+..-+..      +|.+=.=..
T Consensus        12 p~~~~~~dl~Fa-~~v~k~~k-SNAI~~~~~g~~~gig~Gq~srv~~~~~a~~~a~~~l~g~vla------SDAFFPF~D   83 (129)
T 1zcz_A           12 LSEKELEDLEFA-YRVVEGAK-SNAVLIAKDGVTVGIGSGQPSRKRAAWIATVMAGEKAKGAVAA------SDAFFPFPD   83 (129)
T ss_dssp             CCHHHHHHHHHH-HHHHHHSC-SSCEEEEETTEEEEEECSCSSHHHHHHHHHHHHGGGGTTCEEE------ESSCCSSHH
T ss_pred             CCHHHHHHHHHH-HHHHHHCC-CCCEEEECCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEE------ECCCCCCCH
T ss_conf             866666769999-99997678-6757996399389768896677999999999851021787999------456878755


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             9887420268689996488762345555541798279961
Q gi|254780901|r  141 LMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       141 ~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtD  180 (600)
                      .|+.+.+.|++-||..--.+.+-+-|+.|++.||-.+.|-
T Consensus        84 ~v~~A~~~GV~~IiqPgGSirD~evI~aane~gi~mvfTg  123 (129)
T 1zcz_A           84 SLEILAQAGVKAVVAPLGSIRDEEVIEKARELGITFYKAP  123 (129)
T ss_dssp             HHHHHHHTTCCEEEECCCCTTHHHHHHHHHHHTCEEEECS
T ss_pred             HHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHCCEEEECC
T ss_conf             8999998399499979874361999999997598899868


No 211
>>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} (A:9-131)
Probab=54.21  E-value=9.3  Score=17.55  Aligned_cols=99  Identities=17%  Similarity=0.123  Sum_probs=57.1

Q ss_pred             CCHHHHHHHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC--CCCCCCHHHHHHHHHCCCC-
Q ss_conf             48799999999999779-9799994078861528999999999769947998078743--3668897898874202686-
Q gi|254780901|r   76 TDCDKAARRIVQAIYNS-EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV--DGYGPNPSLMEKFINEGAQ-  151 (600)
Q Consensus        76 ~dm~~A~~ri~~ai~~~-ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~--eGYGl~~~~i~~~~~~g~~-  151 (600)
                      .++.++++++...+..+ +...|.| -+.-|+.=+..+.+.   +|....+....|..  ..++.+... ....-.|-+ 
T Consensus         2 ~~~~~~~~~la~~i~~~~~~~~iv~-v~~gG~~~a~~la~~---l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~g~~V   76 (123)
T 1nul_A            2 DMLQIHARKLASRLMPSEQWKGIIA-VSRGGLVPGALLARE---LGIRHVDTVCISSYDHDNQRELKVL-KRAEGDGEGF   76 (123)
T ss_dssp             HHHHHHHHHHHHHHCSGGGCSEEEE-EETTTHHHHHHHHHH---HTCCCEEEEEEEC--------CEEE-ECCSSCCTTE
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEE-ECCCHHHHHHHHHHH---HCCCCEEEEEEEECCCCCCCCEEEE-ECCCCCCCCE
T ss_conf             9999999999999986689989999-886509999999998---6898468999850278644642687-2257789827


Q ss_pred             EEE--EECCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             899--9648876234555554179827996
Q gi|254780901|r  152 LII--TVDCGSTSYDALQYATNQGIDVIVI  179 (600)
Q Consensus       152 LiI--tvD~Gi~~~e~i~~a~~~GidvIVt  179 (600)
                      |||  .+|.|.|..+.++.+++.|..+++.
T Consensus        77 liVDDii~tG~Tl~~~~~~l~~~ga~~v~~  106 (123)
T 1nul_A           77 IVIDDLVDTGGTAVAIREMYPKAHFVTIFA  106 (123)
T ss_dssp             EEEEEEECTTSSHHHHHHHCTTSEEEEEEE
T ss_pred             EEEEECCCCHHHHHHHHHHCCCCEEEEEEE
T ss_conf             999704365399999998667764999998


No 212
>>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, structural genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus JCSC1435} (A:1-127,A:257-305)
Probab=54.11  E-value=13  Score=16.40  Aligned_cols=80  Identities=5%  Similarity=-0.042  Sum_probs=51.5

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCE
Q ss_conf             99999769947998078743366889789887420268689996488762345555541798279961544765556725
Q gi|254780901|r  113 MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY  192 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~  192 (600)
                      .+.+...|..+..+..+.-.+   .....++.+...+++=+|.+.+- .+.+.++.+++.|+-+|++|...++...  ..
T Consensus        50 ~~~a~~~Gy~l~i~~~~~d~~---~~~~~i~~l~~~~vdGIII~g~~-~~~~~i~~L~~~~iPvVlId~~~~~~~~--~~  123 (176)
T 3huu_A           50 NQACNVRGYSTRMTVSENSGD---LYHEVKTMIQSKSVDGFILLYSL-KDDPIEHLLNEFKVPYLIVGKSLNYENI--IH  123 (176)
T ss_dssp             HHHHHHHTCEEEECCCSSHHH---HHHHHHHHHHTTCCSEEEESSCB-TTCHHHHHHHHTTCCEEEESCCCSSTTC--CE
T ss_pred             HHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEECCC-CCHHHHHHHHHCCCCEEEEEECCCCCCC--CE
T ss_conf             999997599899996788759---99999999983898889984367-8758999999649997999504357887--77


Q ss_pred             EEECCC
Q ss_conf             652378
Q gi|254780901|r  193 ALVNPN  198 (600)
Q Consensus       193 aivNP~  198 (600)
                      ..+||.
T Consensus       124 V~~D~~  129 (176)
T 3huu_A          124 IDNDPD  129 (176)
T ss_dssp             EECCHH
T ss_pred             EEECHH
T ss_conf             850799


No 213
>>3l6u_A ABC-type sugar transport system periplasmic component; structural genomics, nysgrc, target 11006S, PSI-2, protein structure initiative; 1.90A {Exiguobacterium sibiricum} (A:1-111,A:250-293)
Probab=53.91  E-value=13  Score=16.38  Aligned_cols=92  Identities=13%  Similarity=0.006  Sum_probs=60.4

Q ss_pred             HCCCCEEEEECCCCCHHHHHH--HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCC-CHHHH
Q ss_conf             779979999407886152899--999999976994799807874336688978988742026868999648876-23455
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVA--LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST-SYDAL  166 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitsta--il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~-~~e~i  166 (600)
                      .+..+|.+.-..--+...+..  -+.+.++..|.++.....+.-.+   --.+.++.+.+.+++-+|.+..... ..+.+
T Consensus         6 ~ks~tIgvIi~~~~npf~~~i~~gi~~~a~~~Gy~lii~~~~~d~~---~q~~~i~~li~~~vdGiII~p~~~~~~~~~l   82 (155)
T 3l6u_A            6 PKRNIVGFTIVNDKHEFAQRLINAFKAEAKANKYEALVATSQNSRI---SEREQILEFVHLKVDAIFITTLDDVYIGSAI   82 (155)
T ss_dssp             ---CEEEEEESCSCSHHHHHHHHHHHHHHHHTTCEEEEEECSSCHH---HHHHHHHHHHHTTCSEEEEECSCTTTTHHHH
T ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEECCCCCHHHHHHH
T ss_conf             9999899999789879999999999999998799899997999989---9999999999769989997156630159999


Q ss_pred             HHHHHCCCCEEEECCCCC
Q ss_conf             555417982799615447
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~  184 (600)
                      +.+.+.||.+|++|==.+
T Consensus        83 ~~L~~~gIPvV~id~~~~  100 (155)
T 3l6u_A           83 EEAKKAGIPVFAIDRXIR  100 (155)
T ss_dssp             HHHHHTTCCEEEESSCCC
T ss_pred             HHHHHCCCEEEEECCCCC
T ss_conf             999976992999887788


No 214
>>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* (A:1-109,A:247-284)
Probab=53.70  E-value=13  Score=16.35  Aligned_cols=85  Identities=15%  Similarity=0.195  Sum_probs=52.2

Q ss_pred             CCCCEEEEECCC-C-C-HHHH--HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHH
Q ss_conf             799799994078-8-6-1528--999999999769947998078743366889789887420268689996488762345
Q gi|254780901|r   91 NSEKIMIFGDYD-V-D-GAAS--VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDA  165 (600)
Q Consensus        91 ~~ekI~I~gDyD-~-D-Gits--tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~  165 (600)
                      .+-||.+.-|-. . | |-+.  -.=+.++-+.+|.++.++-+.--.+    -.+.++.+.++|++|||++  |..-.+.
T Consensus         3 ~~~kVa~v~~~g~~~D~sfn~s~~~G~~~~~~~~gi~~~~~e~~~~~~----~~~~~~~~a~~g~dlIi~~--g~~~~~~   76 (147)
T 2fqx_A            3 GDFVVGMVTDSGDIDDKSFNQQVWEGISRFAQENNAKCKYVTASTDAE----YVPSLSAFADENMGLVVAC--GSFLVEA   76 (147)
T ss_dssp             CCCEEEEEESSSCTTSSSHHHHHHHHHHHHHHHTTCEEEEEECCSGGG----HHHHHHHHHHTTCSEEEEE--STTTHHH
T ss_pred             CCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCCHHH----HHHHHHHHHHCCCCEEEEC--CCCCCCH
T ss_conf             875899998788999877899999999999998598599994599899----9999999997799989991--7543468


Q ss_pred             HHHHHHC--CCCEEEECC
Q ss_conf             5555417--982799615
Q gi|254780901|r  166 LQYATNQ--GIDVIVIDH  181 (600)
Q Consensus       166 i~~a~~~--GidvIVtDH  181 (600)
                      +..+...  .+..+++|=
T Consensus        77 ~~~vA~~yPd~~F~~idg   94 (147)
T 2fqx_A           77 VIETSARFPKQKFLVIDA   94 (147)
T ss_dssp             HHHHHHHCTTSCEEEESS
T ss_pred             HHHHHHHCCCCEEEEECC
T ss_conf             999998889987999567


No 215
>>2ax3_A Hypothetical protein TM0922; TM0922, hypothetical protein, structural genomics, joint center for structural genomics, JCSG; 2.27A {Thermotoga maritima MSB8} (A:1-213)
Probab=53.64  E-value=13  Score=16.34  Aligned_cols=82  Identities=16%  Similarity=0.164  Sum_probs=46.2

Q ss_pred             EEEECCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCE
Q ss_conf             0020342589999999999899-999999999999999998752112434750262057858122222278998842010
Q gi|254780901|r  319 RLLISDDSQELEMLAMKLDVLN-QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRP  397 (600)
Q Consensus       319 ~lL~~~d~~~a~~la~~L~~lN-~~Rk~~e~~i~~~a~~~~~~~~~~~~~~~~ivv~~~~wh~GViGIVAsrL~e~y~kP  397 (600)
                      ++++.+...++++.+.+  +.. ..-+.+|.....-++ .+.....+.+..+++|+.+++ +-|=-|+|++|.....+..
T Consensus         6 ~i~t~~q~~~ld~~~~~--~~g~~~~~LME~Ag~~~a~-~i~~~~~~~~~~~v~vlcG~G-nNGGDGlv~AR~L~~~G~~   81 (213)
T 2ax3_A            6 IHHHHHHXKEIDELTIK--EYGVDSRILXERAGISVVL-AXEEELGNLSDYRFLVLCGGG-NNGGDGFVVARNLLGVVKD   81 (213)
T ss_dssp             -----CCHHHHHHHHHH--TTCCCHHHHHHHHHHHHHH-HHHHHHSCCTTCEEEEEECSS-HHHHHHHHHHHHHTTTSSE
T ss_pred             CCCCHHHHHHHHHHHHH--HHCCCHHHHHHHHHHHHHH-HHHHHCCCCCCCEEEEEECCC-CCHHHHHHHHHHHHHCCCC
T ss_conf             44126899999999998--7493999999999999999-999966745799699998899-7899999999999868995


Q ss_pred             EEEEEEC
Q ss_conf             7998863
Q gi|254780901|r  398 SFAISFE  404 (600)
Q Consensus       398 ~iv~s~~  404 (600)
                      |.|+...
T Consensus        82 V~v~~~~   88 (213)
T 2ax3_A           82 VLVVFLG   88 (213)
T ss_dssp             EEEEECC
T ss_pred             EEEEEEC
T ss_conf             7999968


No 216
>>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.99A {Actinobacillus succinogenes 130Z} (A:1-107,A:239-285)
Probab=53.62  E-value=13  Score=16.34  Aligned_cols=71  Identities=7%  Similarity=-0.105  Sum_probs=47.2

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9999976994799807874336688978988742026868999648876234555554179827996154476555
Q gi|254780901|r  113 MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      .++++..|.++..+-.+--.+   ...+.++.+...+++-+|.+  |....+++..+.+.|+.++.+|........
T Consensus        31 ~~~a~~~Gy~lvI~~~~~d~~---~~~~~i~~l~~~~vDGIII~--~~~~~~~~~~~l~~~IPvVlid~~~~~~~~  101 (154)
T 3c3k_A           31 EKTAEKNGYRILLCNTESDLA---RSRSCLTLLSGKMVDGVITM--DALSELPELQNIIGAFPWVQCAEYDPLSTV  101 (154)
T ss_dssp             HHHHHHTTCEEEEEECTTCHH---HHHHHTHHHHTTCCSEEEEC--CCGGGHHHHHHHHTTSSEEEESSCCTTSSS
T ss_pred             HHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHCCCCCCCCCC--CCCCCHHHHHHHCCCCCEEEEEECCCCCCC
T ss_conf             999998599899997899989---99998766540455423321--234328999850368878998404787776


No 217
>>3g68_A Putative phosphosugar isomerase; YP_001089791.1, SIS domain, double-SIS domain protein, structural genomics; HET: MSE CIT; 1.80A {Clostridium difficile 630} (A:1-188)
Probab=53.42  E-value=13  Score=16.32  Aligned_cols=136  Identities=15%  Similarity=0.083  Sum_probs=65.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHH--HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEC
Q ss_conf             9999999999779979999407886152899--99999997699479980787433668897898874202686899964
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVA--LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD  157 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitsta--il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD  157 (600)
                      +..+.+.+.+.+.++|.|+|   + |.+..+  -+...|..++.....+.... .    ........+.+  -+++|...
T Consensus        22 ~~~~~~~~~i~~a~~I~i~G---~-G~S~~~A~~~~~~l~~~~~~~~~~~~~~-~----~~~~~~~~~~~--~d~vI~iS   90 (188)
T 3g68_A           22 ADSLFNEVKRTNLKKIIITG---S-GTSYHSGVQVQPYLQNLLDIDVVKXYPF-X----ITEDTFKFDNE--NTLVVGVS   90 (188)
T ss_dssp             HHHHTTTGGGSCCSEEEEEC---S-HHHHHHHHHHHHHHHHHCSSEEEEECGG-G----CCGGGGSSCCT--TEEEEEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEE---E-HHHHHHHHHHHHHHHHHHCCCEEEEEHH-H----HEECCCCCCCC--CCEEEEEE
T ss_conf             89999999867999799999---7-1089999999999999859998994124-5----30033212468--86388760


Q ss_pred             C-CCC--CHHHHHHHHHCCCCEEE-ECCCCCCCCCCCCEEE-ECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             8-876--23455555417982799-6154476555672565-23788886433443047889999999999970214
Q gi|254780901|r  158 C-GST--SYDALQYATNQGIDVIV-IDHHQVKSEEIPAYAL-VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD  229 (600)
Q Consensus       158 ~-Gi~--~~e~i~~a~~~GidvIV-tDHH~~~~~~p~a~ai-vNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~  229 (600)
                      . |-+  -.+.++.|+++|+.+|. ||....|=... ++.+ +-|.-.+ . .+....+--..+.++.+|...+...
T Consensus        91 ~sG~t~e~~~~~~~ak~~g~~vi~iT~~~~s~l~~~-ad~~l~~~~~~~-~-~~~~~~s~~~~~~l~~~L~~~l~~~  164 (188)
T 3g68_A           91 QGGSSYSTYNAXKLAEDKGCKIASXAGCKNALIDEI-SDYILTVNCGEE-K-SGAKTKGYYCTKLNLXLLGLQIARE  164 (188)
T ss_dssp             SSSCCHHHHHHHHHHHHTTCEEEEEESSTTCGGGGG-CSEECCCCCCCC-C-CSSCSHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHH-CCCCCCCCCCCC-C-CCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             786858999999877653864223556666620100-365311035665-3-2234322104789999999998875


No 218
>>2bpl_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing]; amidotransferase, ammonia channeling, glucosamine 6- phosphate synthase; HET: F6R; 2.05A {Escherichia coli} (A:244-449)
Probab=53.15  E-value=13  Score=16.29  Aligned_cols=89  Identities=12%  Similarity=0.097  Sum_probs=48.7

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCHHHHHHH--HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH-CCCCEEEEEC-C
Q ss_conf             99999997799799994078861528999--999999769947998078743366889789887420-2686899964-8
Q gi|254780901|r   83 RRIVQAIYNSEKIMIFGDYDVDGAASVAL--MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN-EGAQLIITVD-C  158 (600)
Q Consensus        83 ~ri~~ai~~~ekI~I~gDyD~DGitstai--l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~-~g~~LiItvD-~  158 (600)
                      +++.+.|.+-++|.+||    -|.+..+-  +...|..+|..+.+..+...         ....... ..-+++|.+. .
T Consensus        40 ~~~~~~i~~a~~I~~~G----~G~S~~~a~~~~~~l~~~g~~~~~~~~~~~---------~~~~~~~~~~~dlvI~iS~s  106 (206)
T 2bpl_A           40 PNADELLSKVEHIQILA----CGTSYNSGMVSRYWFESLAGIPCDVEIASE---------FRYRKSAVRRNSLMITLSQS  106 (206)
T ss_dssp             TTHHHHHHHCCEEEEEE----CHHHHHHHHHHHHHHHHHSCCCEEEEEHHH---------HTTSCCCCCTTEEEEEEESS
T ss_pred             CCCHHHHHHHCCEEEEE----ECCHHHHHHHHHHHHHHHCCCCEEEEECCC---------CCCCCCCCCCCCEEEEECCC
T ss_conf             65156553211358998----565477899999999997098749997401---------31124556898589997378


Q ss_pred             CCC--CHHHHHHHHHCC-CCEE-EECCCCC
Q ss_conf             876--234555554179-8279-9615447
Q gi|254780901|r  159 GST--SYDALQYATNQG-IDVI-VIDHHQV  184 (600)
Q Consensus       159 Gi~--~~e~i~~a~~~G-idvI-VtDHH~~  184 (600)
                      |-+  -.+.++.|+++| +.+| ||+.+.-
T Consensus       107 G~t~~~~~~~~~ak~~g~~~vi~iT~~~~s  136 (206)
T 2bpl_A          107 GETADTLAGLRLSKELGYLGSLAICNVPGS  136 (206)
T ss_dssp             SCCHHHHHHHHHHHHTTCSEEEEEESSTTC
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             873889999998875387559999746997


No 219
>>2p1z_A Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129} (A:)
Probab=52.92  E-value=14  Score=16.26  Aligned_cols=128  Identities=7%  Similarity=0.084  Sum_probs=66.9

Q ss_pred             HHHHHHHHHCCCCHHH-H-------HHHCCCCHHHCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH
Q ss_conf             9999999967889789-8-------8661966777189955614879999999999977997999940788615289999
Q gi|254780901|r   41 DIVARVLVNRNVSIDY-A-------KDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALM  112 (600)
Q Consensus        41 ~~~a~iL~~Rgi~~~~-~-------~~fL~p~l~~l~~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail  112 (600)
                      .+++++|..++++..+ +       ..|++...  +..+|..   +...++.|.+.+...+.=.|.| .|..|+.-+.- 
T Consensus         8 ~~~a~ll~~~~~~~~~~~~~~~~hs~~~~d~~~--~~~~~~~---~~~~~~~la~~~~~~~~d~V~g-~~~ggi~~a~~-   80 (180)
T 2p1z_A            8 AELAELVKELAVVHGKVTLSSGKEADYYVDLRR--ATLHARA---SRLIGELLRELTADWDYVAVGG-LTLGADPVATS-   80 (180)
T ss_dssp             HHHHHHHHHHTC---------------CCCTHH--HHTSHHH---HHHHHHHHHHTTTTSCCSEEEE-ETTTHHHHHHH-
T ss_pred             HHHHHHHHHCCCEECEEEECCCCCCCEEEECCC--CCCHHHH---HHHHHHHHHHHHCCCCCEEEEE-CCCCCHHHHHH-
T ss_conf             999999983560648599468996797676876--3342889---9987799998632334147841-23342146676-


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEE---ECCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             9999976994799807874336688978988742026868999---64887623455555417982799
Q gi|254780901|r  113 MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIIT---VDCGSTSYDALQYATNQGIDVIV  178 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiIt---vD~Gi~~~e~i~~a~~~GidvIV  178 (600)
                        .-+.++....+.--.|-..|++-....... ..+|-+.+|.   ++.|.|..+.++.+++.|..++-
T Consensus        81 --~a~~l~~~~~~~~k~~~~~~~~~~~~~~~~-~~~G~~vliVDDii~tG~T~~~~~~~l~~~Ga~~v~  146 (180)
T 2p1z_A           81 --VXHADGREIHAFVVRKEAKKHGXQRRIEGP-DVVGKKVLVVEDTTTTGNSPLTAVKALREAGAEVVG  146 (180)
T ss_dssp             --HHHSSSSCCEEEEECSCCC-CC-CCSEESS-CCTTCEEEEEEEECSSSHHHHHHHHHHHHHTCEEEE
T ss_pred             --HHHHHHCCCCEEEEEEECCCHHHCCCCCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             --888761368638997504310000010013-245532433487877656599999999987997999


No 220
>>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} (A:)
Probab=52.82  E-value=14  Score=16.25  Aligned_cols=104  Identities=10%  Similarity=0.001  Sum_probs=55.2

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH----CCCCEEEEECC
Q ss_conf             99999997799799994078861528999999999769947998078743366889789887420----26868999648
Q gi|254780901|r   83 RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN----EGAQLIITVDC  158 (600)
Q Consensus        83 ~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~----~g~~LiItvD~  158 (600)
                      .+....+...+.-.+..-.+..-.....-.......++.............|..+.....+.+.+    ....+.+.+.+
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~~  142 (265)
T 1wv2_A           63 PNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLDGHNLVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYT  142 (265)
T ss_dssp             -------CTTTSEEEEECTTCCSHHHHHHHHHHHHTTTTSCCEEEECCBSCTTTCCBCHHHHHHHHHHHHTTTCEEEEEE
T ss_pred             CCHHHHHCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             00676502478476685899861999999999999970897558975425755567328889999999974791699950


Q ss_pred             CCCCHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             87623455555417982799615447655
Q gi|254780901|r  159 GSTSYDALQYATNQGIDVIVIDHHQVKSE  187 (600)
Q Consensus       159 Gi~~~e~i~~a~~~GidvIVtDHH~~~~~  187 (600)
                      + ...+....+.+.|.|.|+.........
T Consensus       143 ~-~~~~~a~~~~~~g~d~i~v~g~~~gg~  170 (265)
T 1wv2_A          143 S-DDPIIARQLAEIGCIAVMPLAGLIGSG  170 (265)
T ss_dssp             C-SCHHHHHHHHHSCCSEEEECSSSTTCC
T ss_pred             C-CCHHHHHHHHHCCCCEEEECCCHHHHC
T ss_conf             7-439999999866984875343565544


No 221
>>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence of substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} (A:1-12,A:84-263)
Probab=52.48  E-value=14  Score=16.21  Aligned_cols=104  Identities=10%  Similarity=0.088  Sum_probs=72.5

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCE
Q ss_conf             56148799999999999779979999407886152899999999976994799807874336688978988742026868
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQL  152 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~L  152 (600)
                      ..-.+...|...+.+++-+.....++-+.-=..      ....++.+|.++..+ |.+-.++|.+..+.+++........
T Consensus        20 ~vt~Gs~~al~~~~~~l~~~Gd~Vlv~~p~y~~------~~~~~~~~g~~~~~v-~~~~~~~~~~d~~~l~~~~~~~~~~   92 (192)
T 1gd9_A           20 MVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVS------YAPAVILAGGKPVEV-PTYEEDEFRLNVDELKKYVTDKTRA   92 (192)
T ss_dssp             EEESSTTHHHHHHHTTTCCTTCEEEEEESCCTT------HHHHHHHHTCEEEEE-ECCGGGTTCCCHHHHHHHCCTTEEE
T ss_pred             EECCCHHHHHHHHHHHHCCCCCEEECCCCCHHH------HHHHHHHCCCEEEEE-ECCCCCCCCCCHHHHHHCCCCCCEE
T ss_conf             984858999999999841499989805886047------899999849989996-3450015445799996246878489


Q ss_pred             EEEECCCC-----CCHHH----HHHHHHCCCCEEEECCCC
Q ss_conf             99964887-----62345----555541798279961544
Q gi|254780901|r  153 IITVDCGS-----TSYDA----LQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       153 iItvD~Gi-----~~~e~----i~~a~~~GidvIVtDHH~  183 (600)
                      ++.+...-     -+.++    ++.+++.|+-+|+-|.|.
T Consensus        93 ~i~~~~~nPtg~~~~~~~~~~i~~~~~~~~~~ii~D~~y~  132 (192)
T 1gd9_A           93 LIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYE  132 (192)
T ss_dssp             EEEESSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEECTTT
T ss_pred             EEECCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEHHHHH
T ss_conf             9978999987826789999999988877698995045443


No 222
>>2o8n_A APOA-I binding protein; rossmann fold, protein binding; 2.00A {Mus musculus} PDB: 2dg2_A (A:)
Probab=52.05  E-value=14  Score=16.16  Aligned_cols=38  Identities=26%  Similarity=0.307  Sum_probs=24.7

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHHHCEEEEEEEC
Q ss_conf             347502620578581222222789988420107998863
Q gi|254780901|r  366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE  404 (600)
Q Consensus       366 ~~~~~ivv~~~~wh~GViGIVAsrL~e~y~kP~iv~s~~  404 (600)
                      ...+++|+.+++ +-|==|++|+|..-.++.+|.|+...
T Consensus        78 ~~~~V~il~G~G-nNGGDGl~~Ar~L~~~G~~V~v~~~~  115 (265)
T 2o8n_A           78 SPPTVLVICGPG-NNGGDGLVCARHLKLFGYQPTIYYPK  115 (265)
T ss_dssp             SSCEEEEEECSS-HHHHHHHHHHHHHHHTTCEEEEECCS
T ss_pred             CCCEEEEEECCC-CCHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             797399998789-86388899999999869806999957


No 223
>>1tlt_A Putative oxidoreductase (virulence factor MVIM homolog); structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} (A:1-126,A:262-319)
Probab=52.00  E-value=14  Score=16.16  Aligned_cols=80  Identities=16%  Similarity=0.303  Sum_probs=37.1

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHH-CCCCEEE-EECCCC-----CCCCCCCHH-HHHHHHHCCCCEEEEECCCCCCHHH
Q ss_conf             7999940788615289999999997-6994799-807874-----336688978-9887420268689996488762345
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSH-CSVNANM-YIPDRI-----VDGYGPNPS-LMEKFINEGAQLIITVDCGSTSYDA  165 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~-~g~~v~~-~IP~R~-----~eGYGl~~~-~i~~~~~~g~~LiItvD~Gi~~~e~  165 (600)
                      +|.|+|   +.++.....+ ..|+. -+.++.. |-|++.     .+.||+..- .++.+. ..++.++.+-...+-.+-
T Consensus         7 RVgiIG---lG~ia~~~~l-~~L~~~~~~~ivgi~d~~~eka~~~~~~~~i~~~~s~~~L~-~~~DaV~I~tp~~~H~e~   81 (184)
T 1tlt_A            7 RIGVVG---LGGIAQKAWL-PVLAAASDWTLQGAWSPTRAKALPICESWRIPYADSLSSLA-ASCDAVFVHSSTASHFDV   81 (184)
T ss_dssp             EEEEEC---CSTHHHHTHH-HHHHSCSSEEEEEEECSSCTTHHHHHHHHTCCBCSSHHHHH-TTCSEEEECSCTTHHHHH
T ss_pred             EEEEEE---CCHHHHHHHH-HHHHHCCCCEEEEEECCCHHHHHHHHHHHCCCCCCHHHHHH-CCCCCCCCCCCCCCCCCC
T ss_conf             899995---9999999999-99983899689999879999999999981998348199984-044311234321000123


Q ss_pred             HHHHHHCCCCEEE
Q ss_conf             5555417982799
Q gi|254780901|r  166 LQYATNQGIDVIV  178 (600)
Q Consensus       166 i~~a~~~GidvIV  178 (600)
                      +..+.+.|+.|+|
T Consensus        82 a~~aL~~GkhVlv   94 (184)
T 1tlt_A           82 VSTLLNAGVHVCV   94 (184)
T ss_dssp             HHHHHHTTCEEEE
T ss_pred             CCCCCCCCHHHHH
T ss_conf             3223332223330


No 224
>>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} (A:)
Probab=51.86  E-value=12  Score=16.77  Aligned_cols=22  Identities=23%  Similarity=0.453  Sum_probs=9.2

Q ss_pred             HHHHHHHHHCCCCEEEECCCCC
Q ss_conf             3455555417982799615447
Q gi|254780901|r  163 YDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       163 ~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      .++++.+++...|+|++|...|
T Consensus        45 ~eal~~~~~~~~diiilDi~mP   66 (143)
T 2qv0_A           45 LDVLKFLQHNKVDAIFLDINIP   66 (143)
T ss_dssp             HHHHHHHHHCCCSEEEECSSCS
T ss_pred             HHHHHHHHHCCCCEEEECCCCC
T ss_conf             9999999866999999878899


No 225
>>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* (A:416-602)
Probab=51.76  E-value=14  Score=16.13  Aligned_cols=78  Identities=8%  Similarity=0.092  Sum_probs=57.9

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             87999999999997799799994078861528999999999769947998078743366889789887420268689996
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      .++..++.+.+..++++++.||    |.=...+-.++..|+..|.++..+-...-.+   --...++++.+.....+|+.
T Consensus        15 k~~~ll~~i~~~~~~~~k~iIF----~~~~~~~~~l~~~l~~~~~~~~~~~g~~~~~---~R~~~~~~F~~g~~~ili~T   87 (187)
T 2d7d_A           15 QIDDLIGEIQARIERNERVLVT----TLTKKMSEDLTDYLKEIGIKVNYLHSEIKTL---ERIEIIRDLRLGKYDVLVGI   87 (187)
T ss_dssp             HHHHHHHHHHHHHTTTCEEEEE----CSSHHHHHHHHHHHHHTTCCEEEECTTCCHH---HHHHHHHHHHHTSCSEEEES
T ss_pred             CHHHHHHHHHHHHHCCCEEEEE----ECCCHHHHHHHHHHHHCCCCCCCCCCCCCCC---CHHHHHHHHCCCCCEEEEEE
T ss_conf             2577899999999638737996----3452146887777774598400024433453---22356776414874079987


Q ss_pred             CCCCC
Q ss_conf             48876
Q gi|254780901|r  157 DCGST  161 (600)
Q Consensus       157 D~Gi~  161 (600)
                      |.+..
T Consensus        88 ~~~~~   92 (187)
T 2d7d_A           88 NLLRE   92 (187)
T ss_dssp             CCCST
T ss_pred             ECCHH
T ss_conf             22301


No 226
>>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase; 1.30A {Burkholderia SP} (A:143-274)
Probab=51.55  E-value=14  Score=16.11  Aligned_cols=76  Identities=13%  Similarity=0.181  Sum_probs=41.1

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH-HH
Q ss_conf             77997999940788615289999999997699479980787433668897898874202686899964887623455-55
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL-QY  168 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i-~~  168 (600)
                      +.+++|+|+|   +-|-.+.+ ....++.+|+++.....         +.+.++.+++.|++-++..+.. ...+++ +.
T Consensus         2 ~~G~~VlI~G---a~g~vG~~-~~qla~~~G~~vi~~~~---------~~~~~~~~~~~ga~~~~~~~~~-~~~~~~~~~   67 (132)
T 1wly_A            2 KPGDYVLIHA---AAGGMGHI-MVPWARHLGATVIGTVS---------TEEKAETARKLGCHHTINYSTQ-DFAEVVREI   67 (132)
T ss_dssp             CTTCEEEETT---TTSTTHHH-HHHHHHHTTCEEEEEES---------SHHHHHHHHHHTCSEEEETTTS-CHHHHHHHH
T ss_pred             CCCCEEEEEC---CCCHHHHH-HHHHHHHCCCEEEEECC---------CHHHHHHHHHCCCCEEEECCCC-CHHHHHHHH
T ss_conf             9999999989---96699999-99999875998999759---------8899999997599899979999-999999998


Q ss_pred             HHHCCCCEEEE
Q ss_conf             54179827996
Q gi|254780901|r  169 ATNQGIDVIVI  179 (600)
Q Consensus       169 a~~~GidvIVt  179 (600)
                      ....|.|+++.
T Consensus        68 ~~~~g~d~v~d   78 (132)
T 1wly_A           68 TGGKGVDVVYD   78 (132)
T ss_dssp             HTTCCEEEEEE
T ss_pred             HCCCCCEEEEE
T ss_conf             48999209998


No 227
>>1di6_A MOGA, molybdenum cofactor biosythetic enzyme; MOCO, MOCO biosynthesis, gephyrin; 1.45A {Escherichia coli} (A:)
Probab=51.43  E-value=14  Score=16.09  Aligned_cols=114  Identities=12%  Similarity=0.083  Sum_probs=57.4

Q ss_pred             EEEEECCCCCHH---HHHHHHHHHHHHCCCCEE--EE--ECCCCCCCCCCCHHHHHHHHHC-CCCEEEEECCCCC---CH
Q ss_conf             999940788615---289999999997699479--98--0787433668897898874202-6868999648876---23
Q gi|254780901|r   95 IMIFGDYDVDGA---ASVALMMRFLSHCSVNAN--MY--IPDRIVDGYGPNPSLMEKFINE-GAQLIITVDCGST---SY  163 (600)
Q Consensus        95 I~I~gDyD~DGi---tstail~~~L~~~g~~v~--~~--IP~R~~eGYGl~~~~i~~~~~~-g~~LiItvD~Gi~---~~  163 (600)
                      |.+.||==+=|-   |.+..|...|+..|+++.  ++  +|+....    -.+.+++..++ ++++|||.  |-+   ..
T Consensus         8 ii~tGdEl~~G~i~Dsn~~~l~~~l~~~G~~v~~~~~~~v~Dd~~~----i~~~l~~~~~~~~~DiVitt--GG~g~~~~   81 (195)
T 1di6_A            8 LVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETRLIPDEQAI----IEQTLCELVDEMSCHLVLTT--GGTGPARR   81 (195)
T ss_dssp             EEEEECC-------CCHHHHHHHHHHHHBCSCEEEEEEEEESCHHH----HHHHHHHHHHTSCCSEEEEE--SCCSSSTT
T ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEEECCCHHH----HHHHHHHHHHCCCCEEEEEC--CCCCCCCC
T ss_conf             9996778657977777099999999973998648788897986789----99999999732486199965--77566666


Q ss_pred             HHHHH-HHHCCCCEEE---------ECCCCCCC-CCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             45555-5417982799---------61544765-5567256523788886433443047889999999
Q gi|254780901|r  164 DALQY-ATNQGIDVIV---------IDHHQVKS-EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLV  220 (600)
Q Consensus       164 e~i~~-a~~~GidvIV---------tDHH~~~~-~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~  220 (600)
                      +-... +.+.|-..++         .-|+.+.. -.+.+....+-      -+.-.|.|.-++++.+.
T Consensus        82 D~t~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~------~~i~~lPG~p~~~~~~~  143 (195)
T 1di6_A           82 DVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQVGVIRKQ------ALILNLPGQPKSIKETL  143 (195)
T ss_dssp             CCHHHHHHHTCSEECHHHHHHHHHHHHTTCGGGGGCCCCEEEETT------EEEEEECSSHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCHHHHHHHHHCCCCCCCEEECCHHHHCCCC------EEEEECCCCHHHHHHHH
T ss_conf             779889886551120036999997104779816662544521788------89998799978999999


No 228
>>2pz0_A Glycerophosphoryl diester phosphodiesterase; glycerophosphodiester phosphodiesterase, T. tengcongensis, hydrolase; 1.91A {Thermoanaerobacter tengcongensis MB4} (A:)
Probab=51.01  E-value=14  Score=16.16  Aligned_cols=29  Identities=24%  Similarity=0.308  Sum_probs=20.5

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             62345555541798279961544765556
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      ++.++...|.+.|.++|=+|=|.-.+..|
T Consensus        27 NTl~a~~~A~~~Ga~~vE~DV~~TkDg~~   55 (252)
T 2pz0_A           27 NTIAAFKRAMELGADGIELDVQLTKDGHL   55 (252)
T ss_dssp             TSHHHHHHHHHHTCSEEEEEEEECTTCCE
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCCCE
T ss_conf             15999999998598989988888449988


No 229
>>2gx8_A NIF3-related protein; structural genomics, unknown function, PSI, protein structure initiative; HET: EPE; 2.20A {Bacillus cereus atcc 14579} (A:1-132,A:360-397)
Probab=50.97  E-value=12  Score=16.57  Aligned_cols=28  Identities=25%  Similarity=0.519  Sum_probs=21.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             6899964887623455555417982799615
Q gi|254780901|r  151 QLIITVDCGSTSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       151 ~LiItvD~Gi~~~e~i~~a~~~GidvIVtDH  181 (600)
                      ++.+|+|.   ..+-|+.|.+.|.++|||=|
T Consensus        66 ~V~valD~---T~~vI~~A~~~ganlIItHH   93 (170)
T 2gx8_A           66 HVLIALDV---TEEVVDEAIQLGANVIIAHH   93 (170)
T ss_dssp             EEEEESSC---CHHHHHHHHHHTCCEEEESS
T ss_pred             EEEEEECC---CHHHHHHHHHCCCCEEEECC
T ss_conf             79999749---99999999977998999788


No 230
>>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A (A:109-223)
Probab=50.74  E-value=15  Score=16.02  Aligned_cols=86  Identities=14%  Similarity=0.072  Sum_probs=57.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             99999999997799799994078861528999999999769947998078743366889789887420268689996488
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      -|...+..+.++++.-.|+.  --.|-++.|+-+-+ ..+|.++..++|....+   ..+..++.+...|.+++.+-+..
T Consensus         8 ~a~~~i~~a~~~g~~~~vv~--aSsGN~g~AlA~~a-~~~G~~~~vvvp~~~~~---~k~~~~~~~~~~Ga~V~~~~~~~   81 (115)
T 2o2e_A            8 NVLGQALLARRMGKTRVIAE--TGAGQHGVATATAC-ALLGLDCVIYMGGIDTA---RQALNVARMRLLGAEVVAVQTGS   81 (115)
T ss_dssp             HHHHHHHHHHHTTCCEEEEE--ESSSHHHHHHHHHH-HHHTCEEEEEEEHHHHH---HSHHHHHHHHHTTCEEEEECSTT
T ss_pred             HHHHHHHHHHHCCCCCCCCC--CCCCCCHHHHHHHH-HHCCCCEEEEEECCCHH---HHHHHHHHHHHCCCEEEEECCCC
T ss_conf             79999986775287420024--33474137999999-97599769985036666---62899999997699899964888


Q ss_pred             CCCHHHHHHHHH
Q ss_conf             762345555541
Q gi|254780901|r  160 STSYDALQYATN  171 (600)
Q Consensus       160 i~~~e~i~~a~~  171 (600)
                      ....+.++.+.+
T Consensus        82 ~~~~~~~~~~~~   93 (115)
T 2o2e_A           82 KTLKDAINEAFR   93 (115)
T ss_dssp             SCHHHHHHHHHH
T ss_pred             CCHHHHHHHHHH
T ss_conf             768999999999


No 231
>>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, cytoplasm, nucleus, phosphoprotein, RNA-binding, ATP-binding; 3.50A {Homo sapiens} (A:281-344)
Probab=50.73  E-value=15  Score=16.02  Aligned_cols=60  Identities=15%  Similarity=0.208  Sum_probs=41.9

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             7999940788615289999999997699479980787433668897898874202686899964887
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      ++.||    |.-...+-.+++.|+..|..+.++-.+.-.   .--...++++.+...+.+|+.|...
T Consensus         2 k~iIF----~~t~~~~~~l~~~L~~~g~~~~~~hg~~~~---~~R~~~~~~F~~~~~~vLvaTd~~~   61 (64)
T 3eiq_A            2 QAVIF----INTRRKVDWLTEKMHARDFTVSAMHGDMDQ---KERDVIMREFRSGSSRVLITTDLLA   61 (64)
T ss_dssp             SCEEE----CSCHHHHHHHHHHHHTTTCCCEEC---CHH---HHHHHHHHHHSCC---CEEECSSCC
T ss_pred             EEEEE----ECCHHHHHHHHHHHHHCCCCEEEEECCCCH---HHHHHHHHHHHCCCCEEEEECCCHH
T ss_conf             18999----375889999999998689979999389953---4568898876625975999858122


No 232
>>1s8n_A Putative antiterminator; structural genomics, transcriptional antiterminator, two component system, PSI; 1.48A {Mycobacterium tuberculosis H37RV} (A:1-143)
Probab=50.66  E-value=10  Score=17.26  Aligned_cols=76  Identities=16%  Similarity=0.079  Sum_probs=38.0

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC---CCHHHH
Q ss_conf             77997999940788615289999999997699479980787433668897898874202686899964887---623455
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS---TSYDAL  166 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi---~~~e~i  166 (600)
                      ..+.+|+|.-    |--+...++.+.|+..|.++.....+        ..++++.+.+..++++|. |...   ..++-+
T Consensus        11 ~~~~~VLIVD----D~~~~r~~l~~~L~~~g~~vv~~a~~--------~~eal~~l~~~~~Dliil-D~~lP~~dG~el~   77 (143)
T 1s8n_A           11 AVPRRVLIAE----DEALIRMDLAEMLREEGYEIVGEAGD--------GQEAVELAELHKPDLVIM-DVKMPRRDGIDAA   77 (143)
T ss_dssp             CCCCEEEEEC----SSHHHHHHHHHHHHHTTCEEEEEESS--------HHHHHHHHHHHCCSEEEE-ESSCSSSCHHHHH
T ss_pred             CCCCEEEEEC----CCHHHHHHHHHHHHHCCCEEEEEECC--------HHHHHHHHHHCCCCEEEE-ECCCCCCCHHHHH
T ss_conf             8788899982----98999999999999869979999899--------999999998379999999-6404586079999


Q ss_pred             HHHHHC-CCCEEE
Q ss_conf             555417-982799
Q gi|254780901|r  167 QYATNQ-GIDVIV  178 (600)
Q Consensus       167 ~~a~~~-GidvIV  178 (600)
                      +.+++. .+.+|+
T Consensus        78 ~~lr~~~~~pii~   90 (143)
T 1s8n_A           78 SEIASKRIAPIVV   90 (143)
T ss_dssp             HHHHHTTCSCEEE
T ss_pred             HHHHHCCCCCEEE
T ss_conf             9998569999899


No 233
>>3hz7_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Desulfitobacterium hafniense} (A:)
Probab=50.55  E-value=15  Score=16.00  Aligned_cols=44  Identities=11%  Similarity=0.206  Sum_probs=31.7

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             89887420268689996488762345555541798279961544
Q gi|254780901|r  140 SLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       140 ~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      .+++.+.+.|..|.|.+|+..+-.+--.++++.|..+..+....
T Consensus        20 kal~~l~~~g~~l~v~~dd~~a~~di~~~~~~~G~~~~~~~~~~   63 (87)
T 3hz7_A           20 KALAELGEAGGVVTVLVDNDISRQNLQKXAEGXGYQSEYLEKDN   63 (87)
T ss_dssp             HHHHTTGGGCCEEEEEESSHHHHHHHHHHHHHHTCEEEEEECGG
T ss_pred             HHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             99986167997999995897679999999998799999999549


No 234
>>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} (A:1-167)
Probab=50.38  E-value=15  Score=15.98  Aligned_cols=67  Identities=12%  Similarity=0.203  Sum_probs=29.3

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC---CCHHHHHHHHHCC--CCEEEEC
Q ss_conf             5289999999997699479980787433668897898874202686899964887---6234555554179--8279961
Q gi|254780901|r  106 AASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS---TSYDALQYATNQG--IDVIVID  180 (600)
Q Consensus       106 itstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi---~~~e~i~~a~~~G--idvIVtD  180 (600)
                      .+...++.+.|+..|.++...-     .    ..++++.+.+..++++| +|...   +..+-+..+++.+  +.||+.-
T Consensus        15 ~~~~~~l~~~L~~~g~~v~~a~-----~----~~eal~~~~~~~~dlii-lD~~mp~~~G~~l~~~ir~~~~~~pvI~lT   84 (167)
T 3eq2_A           15 EVVRESLAAYLEDSNFKVLQAL-----N----GLQGLQIFESEQPDLVI-CDLRXPQIDGLELIRRIRQTASETPIIVLS   84 (167)
T ss_dssp             HHHHHHHHHHHHHTTEEEEECS-----S----HHHHHHHHHHSCCSEEE-ECCCSSSSCTHHHHHHHHHTTCCCCEEEC-
T ss_pred             HHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHCCCCCEEE-EECCCCCCCHHHHHHHHHHCCCCCCEEEEE
T ss_conf             9999999999997899999989-----9----99999998618989999-968889999999999998369999689999


Q ss_pred             CC
Q ss_conf             54
Q gi|254780901|r  181 HH  182 (600)
Q Consensus       181 HH  182 (600)
                      .|
T Consensus        85 ~~   86 (167)
T 3eq2_A           85 GA   86 (167)
T ss_dssp             --
T ss_pred             EC
T ss_conf             22


No 235
>>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} (A:427-523,A:579-641)
Probab=50.15  E-value=15  Score=15.95  Aligned_cols=72  Identities=4%  Similarity=0.041  Sum_probs=50.6

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHC--CCCEEE
Q ss_conf             879999999999977997999940788615289999999997699479980787433668897898874202--686899
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE--GAQLII  154 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~--g~~LiI  154 (600)
                      .++..++.+.+..+++++++||    |..+..+-.+++.|+..|..+.++-..       ++..--+.+.+.  ..+++|
T Consensus        19 k~~~~~~~i~~~~~~~~kvlIf----~~~~~~~~~l~~~L~~~~~~~~~~~g~-------~~~~~r~~~~~~f~~~~vlv   87 (160)
T 1nkt_A           19 KYIAVVDDVAERYAKGQPVLIG----TTSVERSEYLSRQFTKRRIPHNVLNAK-------YHEQEATIIAVAGRRGGVTV   87 (160)
T ss_dssp             HHHHHHHHHHHHHHTTCCEEEE----ESCHHHHHHHHHHHHHTTCCCEEECSS-------CHHHHHHHHHTTTSTTCEEE
T ss_pred             HHHHHHHHHHHHHHCCCCEEEE----ECHHHHHHHHHHHHHHCCCCHHHHCCH-------HHHHHHHHHHHCCCCCEEEE
T ss_conf             9999999999999649977998----401988999999998769815321001-------04656767862789871899


Q ss_pred             EECCC
Q ss_conf             96488
Q gi|254780901|r  155 TVDCG  159 (600)
Q Consensus       155 tvD~G  159 (600)
                      +.+++
T Consensus        88 ~t~~~   92 (160)
T 1nkt_A           88 ATNMA   92 (160)
T ss_dssp             EETTC
T ss_pred             EECCC
T ss_conf             72233


No 236
>>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} (A:290-510)
Probab=50.11  E-value=15  Score=15.95  Aligned_cols=74  Identities=4%  Similarity=-0.028  Sum_probs=47.9

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCC-EEEEE
Q ss_conf             79999999999977997999940788615289999999997699479980787433668897898874202686-89996
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ-LIITV  156 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~-LiItv  156 (600)
                      .+..+..+.....++++++||.    .-...+-.+++.|+..|.++.++...--.+   -...........+.. +++++
T Consensus        44 ~~~l~~~i~~~~~~~~k~iVF~----~~~~~~~~l~~~L~~~~~~~~~~~g~~~~~---~~~~~~~~~~~~~~~~~l~~~  116 (221)
T 2oca_A           44 NKWIAKLAIKLAQKDENAFVMF----KHVSHGKAIFDLIKNEYDKVYYVSGEVDTE---TRNIMKTLAENGKGIIIVASY  116 (221)
T ss_dssp             HHHHHHHHHHHHTTTCEEEEEE----SSHHHHHHHHHHHHTTCSSEEEESSSTTHH---HHHHHHHHHHHCCSCEEEEEH
T ss_pred             HHHHHHHHHHHHHCCCCEEEEE----EEEEECHHHCCCCCCCCCEEEEEECCCCHH---HHHHHHHHHHCCCCCEEEEEE
T ss_conf             4677776533331366389998----445300010022334443189996788678---899999998648887699990


Q ss_pred             CC
Q ss_conf             48
Q gi|254780901|r  157 DC  158 (600)
Q Consensus       157 D~  158 (600)
                      +.
T Consensus       117 ~~  118 (221)
T 2oca_A          117 GV  118 (221)
T ss_dssp             HH
T ss_pred             CH
T ss_conf             53


No 237
>>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} (A:183-361,A:548-590)
Probab=50.03  E-value=15  Score=15.94  Aligned_cols=132  Identities=11%  Similarity=0.029  Sum_probs=69.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCC-------CC--CHHHHHHHHHC
Q ss_conf             999999999977997999940788615289999999997699479980787--43366-------88--97898874202
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVDGY-------GP--NPSLMEKFINE  148 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~eGY-------Gl--~~~~i~~~~~~  148 (600)
                      .+++.+.+.|.+-++.+|+.+.-  +..+.+-+.++.+.+|+-|......+  +.+.+       |.  +.. ..++.++
T Consensus        11 ~~i~~a~~~L~~AkrPvIivG~g--~~~a~~~l~~la~~~g~PV~~t~~~kg~~~e~hp~~~G~~G~~~~~~-~~~~l~~   87 (222)
T 1v5e_A           11 QDIDAAVELLNNSKRPVIYAGIG--TMGHGPAVQELARKIKAPVITTGKNFETFEWDFEALTGSTYRVGWKP-ANETILE   87 (222)
T ss_dssp             HHHHHHHHHHHHCSSEEEEECGG--GTTCHHHHHHHHHHHTCCEEECTTCGGGSCTTCTTEEEESSSSSCHH-HHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCEEEEECC--CCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCH-HHHHHHH
T ss_conf             99999999997578988998400--10037999987653023222222233433233210000223467611-2334322


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             68689996488762345555541798279961544765556725652378888643344304788999999999997021
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ  228 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~  228 (600)
                       +++||.+.+.......-.. ....-.+|.+              -+||...+..|+ .+++=.|-+--++.+|.+.+..
T Consensus        88 -aDlVL~vG~~l~~~~~~~~-~~~~~~~i~I--------------d~dp~~i~~~~~-~~~~i~aD~~~~L~~L~~~l~~  150 (222)
T 1v5e_A           88 -ADTVLFAGSNFPFSEVEGT-FRNVDNFIQI--------------DIDPAMLGKRHH-ADVAILGDAALAIDEILNKVDA  150 (222)
T ss_dssp             -CSEEEEESCCCTTTTTTTT-TTTCSEEEEE--------------ESCGGGTTSSSC-CSEEEESCHHHHHHHHHHHSCC
T ss_pred             -CCCHHCCCCCCCCCCCCCC-CCCCCCEEEE--------------EECCCEEEEEEC-CEEEEECCHHHHHHHHHHHHHH
T ss_conf             -0100002345666554453-2478868999--------------703120100003-2156605378899999986541


Q ss_pred             CCC
Q ss_conf             488
Q gi|254780901|r  229 DNK  231 (600)
Q Consensus       229 ~~~  231 (600)
                      ...
T Consensus       151 ~~~  153 (222)
T 1v5e_A          151 VEE  153 (222)
T ss_dssp             CCC
T ss_pred             CCC
T ss_conf             023


No 238
>>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase, transferase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A (A:157-314)
Probab=49.84  E-value=15  Score=15.92  Aligned_cols=64  Identities=11%  Similarity=-0.023  Sum_probs=52.5

Q ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             999997799799994078861528999999999769947998078743366889789887420268689996488
Q gi|254780901|r   85 IVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        85 i~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      +....+.+.+++||    |.....+--|++.|...|.++.++-..       +....++...+...+.+|+.|.-
T Consensus        25 l~~l~~~~~~~lVF----~~t~~~~~~l~~~L~~~g~~~~~lh~~-------~~~~~~~~f~~g~~~ilvaT~v~   88 (158)
T 2jlq_A           25 FDWITDYQGKTVWF----VPSIKAGNDIANCLRKSGKRVIQLSRK-------TFDTEYPKTKLTDWDFVVTTDIS   88 (158)
T ss_dssp             CHHHHHCCSCEEEE----CSSHHHHHHHHHHHHTTTCCEEEECTT-------THHHHGGGGGSSCCSEEEECGGG
T ss_pred             HHHHHHCCCCEEEE----ECCHHHHHHHHHHHHHCCCEEEEECCC-------CCHHHHHHCCCCCCEEEEECHHH
T ss_conf             99998469999999----598899999999997489839993899-------97999854548994299983167


No 239
>>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodanese, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* (A:488-573)
Probab=49.54  E-value=15  Score=15.88  Aligned_cols=32  Identities=25%  Similarity=0.392  Sum_probs=25.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             68689996488762345555541798279961
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtD  180 (600)
                      +..+++.|..|..|..+...+.++|.+|-+.+
T Consensus        54 ~~~iv~~C~~g~rS~~aa~~L~~~G~~v~~l~   85 (86)
T 3ics_A           54 DKDIYITCQLGXRGYVAARXLXEKGYKVKNVD   85 (86)
T ss_dssp             SSCEEEECSSSHHHHHHHHHHHHTTCCEEEET
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             88299992887239999999987899689960


No 240
>>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} (A:)
Probab=49.46  E-value=11  Score=16.93  Aligned_cols=69  Identities=19%  Similarity=0.164  Sum_probs=42.5

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             77997999940788615289999999997699479980787433668897898874202686899964887623455555
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA  169 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a  169 (600)
                      .++-+|+|.-    |--+...++...|+.+|.......    ..    ..++++.+.+..++++| +|......+..+.+
T Consensus         4 ~~~~riLiVd----d~~~~~~~l~~~L~~~g~~~v~~a----~~----~~~a~~~l~~~~~dlvi-lD~~lp~~dG~el~   70 (129)
T 1p6q_A            4 AEKIKVLIVD----DQVTSRLLLGDALQQLGFKQITAA----GD----GEQGMKIMAQNPHHLVI-SDFNMPKMDGLGLL   70 (129)
T ss_dssp             SSCCCEEEEC----SSHHHHHHHHHHHHTTTCSCEECC----SS----HHHHHHHHHTSCCSEEE-ECSSSCSSCHHHHH
T ss_pred             CCCCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEEE----CC----HHHHHHHHHHCCCCEEE-EECCCCCCCHHHHH
T ss_conf             7788899994----999999999999998799399998----99----99999999728998999-94588999879999


Q ss_pred             HH
Q ss_conf             41
Q gi|254780901|r  170 TN  171 (600)
Q Consensus       170 ~~  171 (600)
                      ..
T Consensus        71 ~~   72 (129)
T 1p6q_A           71 QA   72 (129)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             99


No 241
>>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} (A:)
Probab=49.45  E-value=15  Score=15.87  Aligned_cols=79  Identities=9%  Similarity=0.162  Sum_probs=49.9

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC---HHHHH
Q ss_conf             799799994078861528999999999769947998078743366889789887420268689996488762---34555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS---YDALQ  167 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~---~e~i~  167 (600)
                      ++.+|+|.-    |--+...++.+.|+.+|.++...-     .    ..++++.+.+..++++| +|.....   .+-++
T Consensus         2 ~~~rvLiVd----D~~~~~~~l~~~L~~~G~~v~~a~-----~----~~eAl~~l~~~~~dlii-lD~~lP~~dG~~l~~   67 (127)
T 3i42_A            2 SLQQALIVE----DYQAAAETFKELLEMLGFQADYVM-----S----GTDALHAMSTRGYDAVF-IDLNLPDTSGLALVK   67 (127)
T ss_dssp             CCEEEEEEC----SCHHHHHHHHHHHHHTTEEEEEES-----S----HHHHHHHHHHSCCSEEE-EESBCSSSBHHHHHH
T ss_pred             CCCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHCCCCCEEE-ECCCCCCCCHHHHHH
T ss_conf             988899995----789999999999998799999989-----9----99999999808999998-627899984599999


Q ss_pred             HHHHC----CCCEEEECCCC
Q ss_conf             55417----98279961544
Q gi|254780901|r  168 YATNQ----GIDVIVIDHHQ  183 (600)
Q Consensus       168 ~a~~~----GidvIVtDHH~  183 (600)
                      .+++.    .+-+|++-.+.
T Consensus        68 ~ir~~~~~~~~pii~~t~~~   87 (127)
T 3i42_A           68 QLRALPMEKTSKFVAVSGFA   87 (127)
T ss_dssp             HHHHSCCSSCCEEEEEECC-
T ss_pred             HHHHCCCCCCCEEEEEECCC
T ss_conf             99847678999499997888


No 242
>>1vho_A Endoglucanase; structural genomics, unknown function; HET: MSE; 1.86A {Thermotoga maritima} (A:1-70,A:158-346)
Probab=49.40  E-value=15  Score=15.97  Aligned_cols=31  Identities=23%  Similarity=0.355  Sum_probs=25.4

Q ss_pred             HCCCCEEEEECCCC--------------CHHHHHHHHHHHHHHCC
Q ss_conf             77997999940788--------------61528999999999769
Q gi|254780901|r   90 YNSEKIMIFGDYDV--------------DGAASVALMMRFLSHCS  120 (600)
Q Consensus        90 ~~~ekI~I~gDyD~--------------DGitstail~~~L~~~g  120 (600)
                      ...+.|++.|++|+              |.-++++++.+.++.+.
T Consensus        57 ~~~~~i~~~~H~D~~~~~~~~~~~~Ga~Dn~sGva~lLelar~l~  101 (259)
T 1vho_A           57 KGIGKLAFFAHVDETAFETNGKVVGKALDNRASCGVLVKVLEFLK  101 (259)
T ss_dssp             SSSCEEEEEEECCBCCEEETTEEEETTHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCEEEEECCCCEEEEECCEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             899738999715778997037488623214234788999999987


No 243
>>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} (A:1-115,A:228-286)
Probab=49.25  E-value=15  Score=15.85  Aligned_cols=78  Identities=17%  Similarity=0.356  Sum_probs=47.7

Q ss_pred             HHHCCCCEEEE-ECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHH---------HHHHHHHCCCCEEEEEC
Q ss_conf             99779979999-407886152899999999976994799807874336688978---------98874202686899964
Q gi|254780901|r   88 AIYNSEKIMIF-GDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPS---------LMEKFINEGAQLIITVD  157 (600)
Q Consensus        88 ai~~~ekI~I~-gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~---------~i~~~~~~g~~LiItvD  157 (600)
                      ....+.+|.|+ |     |+-+.+++-...+.+..+-..|+.+.-.=-||....         .++.+.+.|+++|+. =
T Consensus        18 ~~~~~~~Igifds-----G~Ggltv~~~i~~~lp~~~~iy~~D~~~~Pyg~~s~~~i~~~~~~~~~~L~~~g~~~ivi-a   91 (174)
T 2jfq_A           18 GSHMNKPIGVIDS-----GVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKLMEFDIKMLVI-A   91 (174)
T ss_dssp             ---CCSCEEEEES-----SSTTHHHHHHHHHHCTTCCEEEEECTTTCCCTTSCHHHHHHHHHHHHHHHTTSCCSEEEE-C
T ss_pred             CCCCCCCEEEEEC-----CCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE-E
T ss_conf             5357998899968-----977799999999978999989994488898888999999999999999998548877998-1


Q ss_pred             CCCCCHHHHHHHHH
Q ss_conf             88762345555541
Q gi|254780901|r  158 CGSTSYDALQYATN  171 (600)
Q Consensus       158 ~Gi~~~e~i~~a~~  171 (600)
                      |-+.+.-.++.+++
T Consensus        92 CNTa~a~~l~~l~~  105 (174)
T 2jfq_A           92 CNTATAVALEYLQK  105 (174)
T ss_dssp             CHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             46489999999985


No 244
>>2hnh_A DNA polymerase III alpha subunit; DNA replication, nucleotidyltransferase, POL beta, PHP; HET: DNA; 2.30A {Escherichia coli} PDB: 2hqa_A* (A:1-277)
Probab=49.21  E-value=15  Score=15.85  Aligned_cols=55  Identities=16%  Similarity=0.211  Sum_probs=36.3

Q ss_pred             EEEEECCCCC--CCCCCCHHHHHHHHHCCCCEEEEEC-CCCCCHHH-HHHHHHCCCCEE
Q ss_conf             7998078743--3668897898874202686899964-88762345-555541798279
Q gi|254780901|r  123 ANMYIPDRIV--DGYGPNPSLMEKFINEGAQLIITVD-CGSTSYDA-LQYATNQGIDVI  177 (600)
Q Consensus       123 v~~~IP~R~~--eGYGl~~~~i~~~~~~g~~LiItvD-~Gi~~~e~-i~~a~~~GidvI  177 (600)
                      +..|+-.-++  ||..--.+.++.+++.|.+.|-..| +.+.+..+ .+.+++.|+.+|
T Consensus         7 vDLH~HT~~S~~Dg~~~~eelv~~A~~~G~~~iaITDH~~~~g~~~~~~~~~~~gi~~i   65 (277)
T 2hnh_A            7 VHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGIKPI   65 (277)
T ss_dssp             CCCCBCCGGGSSSCCSCHHHHHHHHHHTTCSEEEECCBTCCTTHHHHHHHHHHHTCEEE
T ss_pred             CCEECCCCCCHHCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             21008876803153359999999999859999999527839789999999997599806


No 245
>>3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase, translation termination, ATP-binding, cytoplasm, hydrolase, membrane; 2.80A {Schizosaccharomyces pombe} (A:327-508)
Probab=49.20  E-value=11  Score=17.02  Aligned_cols=72  Identities=10%  Similarity=0.101  Sum_probs=49.1

Q ss_pred             HHHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECC
Q ss_conf             9999999997--79979999407886152899999999976994799807874336688978988742026868999648
Q gi|254780901|r   81 AARRIVQAIY--NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        81 A~~ri~~ai~--~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~  158 (600)
                      -.+.|.+-++  ..+++.||    |.-..++.-|++.|+..|..+.++-.+--.   ---..+++.+.+...+++|+.|+
T Consensus        18 k~~~l~~ll~~~~~~k~iIF----~~s~~~~~~l~~~L~~~g~~~~~~hg~~~~---~~R~~~~~~f~~~~~~vlv~T~~   90 (182)
T 3fho_A           18 KYNVLVELYGLLTIGQSIIF----CKKKDTAEEIARRMTADGHTVACLTGNLEG---AQRDAIMDSFRVGTSKVLVTTNV   90 (182)
T ss_dssp             HHHHHHHHHC---CCCEEEB----CSSTTTTTHHHHHHTTTTCCCCEEC--------CTTGGGTHHHHSSSCCCCEECC-
T ss_pred             HHHHHHHHHHHHHCCCEEEE----EECCCHHHHHHHHHCCCCCEEEEECCCCCC---HHHHHHHHHEECCCCEEEEECCE
T ss_conf             33308987646532857899----825772999999745699578885178420---34666676512465249998121


Q ss_pred             C
Q ss_conf             8
Q gi|254780901|r  159 G  159 (600)
Q Consensus       159 G  159 (600)
                      .
T Consensus        91 ~   91 (182)
T 3fho_A           91 I   91 (182)
T ss_dssp             -
T ss_pred             E
T ss_conf             4


No 246
>>1a53_A IGPS, indole-3-glycerolphosphate synthase; thermostable, TIM-barrel; HET: IGP; 2.00A {Sulfolobus solfataricus} (A:25-247)
Probab=48.98  E-value=15  Score=15.82  Aligned_cols=95  Identities=14%  Similarity=0.007  Sum_probs=56.4

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             99999999977997999940788615289999999997699479980787433668897898874202686899964887
Q gi|254780901|r   81 AARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        81 A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      ..+.+.++++.+-......+-+.........+.+..+.....+.....       -.....++.+.+.|++.+..-....
T Consensus        40 ~~~~~~~~~~~g~~~i~~~~~~~~~~~~~~~i~~i~~~~~~p~~~~~~-------i~~~~~~~~~~~~g~~~~~~~~~~~  112 (223)
T 1a53_A           40 DPIEYSKFMERYAVGLSILTEEKYFNGSYETLRKIASSVSIPILMKDF-------IVKESQIDDAYNLGADTVLLIVKIL  112 (223)
T ss_dssp             CHHHHHHHHTTTCSEEEEECCCTTTCCCHHHHHHHHHHCCSCEEEESC-------CCSHHHHHHHHHHTCSEEEEEGGGS
T ss_pred             CHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCCEEECCC-------CCCHHHHHHHHHCCCCHHHHHHHHC
T ss_conf             879999999719857898516653113315788885036776020010-------0676799999861545556768630


Q ss_pred             C---CHHHHHHHHHCCCCEEEECCC
Q ss_conf             6---234555554179827996154
Q gi|254780901|r  161 T---SYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       161 ~---~~e~i~~a~~~GidvIVtDHH  182 (600)
                      .   ..+.++.+++.|.++++.=|.
T Consensus       113 ~~~~~~~~~~~~~~~g~~v~~~~~~  137 (223)
T 1a53_A          113 TERELESLLEYARSYGMEPLIEIND  137 (223)
T ss_dssp             CHHHHHHHHHHHHTTTCCCEEEECS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             0788899999999986467772589


No 247
>>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} (A:)
Probab=48.77  E-value=15  Score=15.86  Aligned_cols=79  Identities=11%  Similarity=0.145  Sum_probs=44.5

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECC---CCCCHHHH
Q ss_conf             779979999407886152899999999976994799807874336688978988742026868999648---87623455
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDC---GSTSYDAL  166 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~---Gi~~~e~i  166 (600)
                      .++.+|+|.-    |--+...++...|+..|.+|...-     .    ..++++.+.+..++++| +|-   |.+..+-+
T Consensus        12 ~~~~~iLiVD----D~~~~~~~i~~~L~~~g~~v~~a~-----~----~~~al~~l~~~~~dlvi-lD~~lp~~dG~~~~   77 (153)
T 3hv2_A           12 TRRPEILLVD----SQEVILQRLQQLLSPLPYTLHFAR-----D----ATQALQLLASREVDLVI-SAAHLPQMDGPTLL   77 (153)
T ss_dssp             CSCCEEEEEC----SCHHHHHHHHHHHTTSSCEEEEES-----S----HHHHHHHHHHSCCSEEE-EESCCSSSCHHHHH
T ss_pred             CCCCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHHCCCCEEE-ECCCCCCCCHHHHH
T ss_conf             8999799996----999999999999998799999989-----9----99999999827999898-60558999889999


Q ss_pred             HHHHHC--CCCEEEECCC
Q ss_conf             555417--9827996154
Q gi|254780901|r  167 QYATNQ--GIDVIVIDHH  182 (600)
Q Consensus       167 ~~a~~~--GidvIVtDHH  182 (600)
                      +.+++.  .+.||+.-.|
T Consensus        78 ~~ir~~~~~~pvI~lt~~   95 (153)
T 3hv2_A           78 ARIHQQYPSTTRILLTGD   95 (153)
T ss_dssp             HHHHHHCTTSEEEEECCC
T ss_pred             HHHHHHCCCCCEEEEECC
T ss_conf             999986899928999788


No 248
>>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombination, hydrolase; 2.90A {Pyrococcus furiosus dsm 3638} (A:197-211,A:342-494)
Probab=48.77  E-value=16  Score=15.80  Aligned_cols=79  Identities=13%  Similarity=0.256  Sum_probs=55.3

Q ss_pred             CHHHHHHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-CC----HHHHHHHHHCC
Q ss_conf             87999999999997--7997999940788615289999999997699479980787433668-89----78988742026
Q gi|254780901|r   77 DCDKAARRIVQAIY--NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYG-PN----PSLMEKFINEG  149 (600)
Q Consensus        77 dm~~A~~ri~~ai~--~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYG-l~----~~~i~~~~~~g  149 (600)
                      -+++-.+.+.+.+.  .+.+++||    |+....+-.++..|+.-+....++.++.....++ ++    ...++.+.+..
T Consensus        18 k~~~l~~~i~~~~~~~~~~k~lvf----~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~l~~f~~g~   93 (168)
T 1wp9_A           18 KMDKLKEIIREQLQRKQNSKIIVF----TNYRETAKKIVNELVKDGIKAKRFVGQASKENDRGLSQREQKLILDEFARGE   93 (168)
T ss_dssp             HHHHHHHHHHHHHHHCTTCCEEEE----CSCHHHHHHHHHHHHHTTCCEEEECCSSCC-------CCHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCC----CCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             899999998888740677531110----1028889999999864697437861355454677889999999999997799


Q ss_pred             CCEEEEECCC
Q ss_conf             8689996488
Q gi|254780901|r  150 AQLIITVDCG  159 (600)
Q Consensus       150 ~~LiItvD~G  159 (600)
                      .+++|+.|..
T Consensus        94 ~~iLi~T~~l  103 (168)
T 1wp9_A           94 FNVLVATSVG  103 (168)
T ss_dssp             CSEEEECGGG
T ss_pred             CCEEEECCCC
T ss_conf             9899884402


No 249
>>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} (A:1-202)
Probab=48.69  E-value=16  Score=15.79  Aligned_cols=56  Identities=13%  Similarity=0.154  Sum_probs=48.3

Q ss_pred             CCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             99556148799999999999779979999407886152899999999976994799807
Q gi|254780901|r   70 PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP  128 (600)
Q Consensus        70 ~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP  128 (600)
                      ..|..|-+-++..++|.++++++..++|+|   .=|+-=|+++..++........+.+.
T Consensus         9 ~~~~~fvGRe~el~~l~~~l~~~~~v~i~G---~~G~GKTsL~~~~~~~~~~~~~~~~~   64 (202)
T 2qen_A            9 TRREDIFDREEESRKLEESLENYPLTLLLG---IRRVGKSSLLRAFLNERPGILIDCRE   64 (202)
T ss_dssp             CSGGGSCSCHHHHHHHHHHHHHCSEEEEEC---CTTSSHHHHHHHHHHHSSEEEEEHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCEEEEEC---CCCCCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             984557698999999999985399799981---99998999999999964454415899


No 250
>>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} (A:)
Probab=48.45  E-value=12  Score=16.79  Aligned_cols=57  Identities=16%  Similarity=0.211  Sum_probs=26.7

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             9979999407886152899999999976994-7998078743366889789887420268689996488762
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS  162 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~g~~-v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~  162 (600)
                      +-+|+|.-|    --+...++...|+..|.+ |...     ..    -.++++.+.+..+++|| +|.-...
T Consensus         4 ~~~iLiVdD----~~~~~~~l~~~L~~~g~~~v~~a-----~~----~~~al~~~~~~~~dlil-lD~~lp~   61 (128)
T 1jbe_A            4 ELKFLVVDD----FSTMRRIVRNLLKELGFNNVEEA-----ED----GVDALNKLQAGGYGFVI-SDWNMPN   61 (128)
T ss_dssp             TCCEEEECS----CHHHHHHHHHHHHHTTCCCEEEE-----SS----HHHHHHHHTTCCCCEEE-EESCCSS
T ss_pred             CCEEEEEEC----CHHHHHHHHHHHHHCCCCEEEEE-----CC----HHHHHHHHHCCCCCEEE-EECCCCC
T ss_conf             999999969----89999999999998699569997-----99----99999997628999999-9699999


No 251
>>1jlj_A Gephyrin; globular alpha/beta fold, structural protein; 1.60A {Homo sapiens} (A:)
Probab=48.37  E-value=16  Score=15.75  Aligned_cols=58  Identities=16%  Similarity=0.224  Sum_probs=38.3

Q ss_pred             EEEEECCCCCH---HHHHHHHHHHHHH---CCCCEEEE--ECCCCCCCCCCCHHHHHHHH-HCCCCEEEEE
Q ss_conf             99994078861---5289999999997---69947998--07874336688978988742-0268689996
Q gi|254780901|r   95 IMIFGDYDVDG---AASVALMMRFLSH---CSVNANMY--IPDRIVDGYGPNPSLMEKFI-NEGAQLIITV  156 (600)
Q Consensus        95 I~I~gDyD~DG---itstail~~~L~~---~g~~v~~~--IP~R~~eGYGl~~~~i~~~~-~~g~~LiItv  156 (600)
                      |...||=-+.|   =|++..|...|++   .|.++.++  +|+...    .-.+.++++. +.++++|||.
T Consensus        19 ii~~GdEl~~g~i~d~n~~~l~~~l~~~~~~G~~v~~~~iv~Dd~~----~i~~~l~~~~~~~~~DlIitt   85 (189)
T 1jlj_A           19 VLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVPDEIE----EIKETLIDWCDEKELNLILTT   85 (189)
T ss_dssp             EEEECHHHHTTSSCCHHHHHHHHHHHCTTTTCCEEEEEEEECSCHH----HHHHHHHHHHHTSCCSEEEEE
T ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEEECCCHH----HHHHHHHHHHHCCCCCEEEEC
T ss_conf             9996878747863777599999999852548937999999789789----999999998553588789978


No 252
>>1tmo_A TMAO reductase, trimethylamine N-oxide reductase; oxidoreductase, oxotransferase, molybdoenzyme, MO-cofactor, molybdenum; HET: 2MD; 2.50A {Shewanella massilia} (A:190-278,A:350-414)
Probab=48.35  E-value=16  Score=15.75  Aligned_cols=63  Identities=21%  Similarity=0.184  Sum_probs=40.0

Q ss_pred             CCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHH-------------------HHHHHHHCCCCEEEECCCCCCCC--CCC
Q ss_conf             336688978988742026868999648876234-------------------55555417982799615447655--567
Q gi|254780901|r  132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYD-------------------ALQYATNQGIDVIVIDHHQVKSE--EIP  190 (600)
Q Consensus       132 ~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e-------------------~i~~a~~~GidvIVtDHH~~~~~--~p~  190 (600)
                      ..|||-.....+++..  +++||..  |.+..+                   .+..++++|..+||+|=..-+.-  .-.
T Consensus         6 ~~g~g~~t~~~~D~~~--ad~iv~w--G~Np~~t~~~~~~~~~~~~~~~~~~~~~~~k~~G~kiIvIDPr~t~ta~~~Ad   81 (154)
T 1tmo_A            6 TEVYAQGTSWPLILEH--SDTIVLW--SNDPYKNLQVGWNAETHESFAYLAQLKEKVKQGKIRVISIDPVVTKTQAYLGC   81 (154)
T ss_dssp             CCTTSCCCCHHHHHHH--CSEEEEE--SCCHHHHTSCCSSBCCCTHHHHHHHHHHHHHHTSSEEEEECSSCCHHHHHHTC
T ss_pred             CCCCCCCCCCHHHHHH--CCEEEEE--CCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHCC
T ss_conf             5455578888788741--3425540--67877713355665533320689999999872994799805753320123114


Q ss_pred             CEEEECCC
Q ss_conf             25652378
Q gi|254780901|r  191 AYALVNPN  198 (600)
Q Consensus       191 a~aivNP~  198 (600)
                      -..-|.|.
T Consensus        82 ~wl~irPG   89 (154)
T 1tmo_A           82 EQLYVNPQ   89 (154)
T ss_dssp             EEECCCTT
T ss_pred             CEEEECCC
T ss_conf             10420433


No 253
>>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} (A:)
Probab=47.92  E-value=13  Score=16.40  Aligned_cols=27  Identities=19%  Similarity=0.267  Sum_probs=17.5

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             623455555417982799615447655
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSE  187 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~  187 (600)
                      +..++++.+.+...|+||+|.+.|...
T Consensus        33 ~~~~al~~l~~~~~dliilD~~lP~~~   59 (120)
T 2a9o_A           33 NGREALEQFEAEQPDIIILDLMLPEID   59 (120)
T ss_dssp             SHHHHHHHHHHHCCSEEEECSSCSSSC
T ss_pred             CHHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             879999999836997898425667988


No 254
>>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} (A:61-174,A:321-366)
Probab=47.36  E-value=16  Score=15.64  Aligned_cols=93  Identities=9%  Similarity=0.063  Sum_probs=53.1

Q ss_pred             CCCCEEEEECCCCCH-HHHH--HHHHHHHHH-C---CCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             799799994078861-5289--999999997-6---99479980787433668897898874202686899964887623
Q gi|254780901|r   91 NSEKIMIFGDYDVDG-AASV--ALMMRFLSH-C---SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        91 ~~ekI~I~gDyD~DG-itst--ail~~~L~~-~---g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      +...|+++--....+ ++..  +-+...+.. +   |..+.++......    =..+.++.+.+.+++=+|.+.. ..+.
T Consensus         7 kS~tIgvIip~~~~~~~~npff~~ii~gI~~~a~~~gy~lli~~~~~~~----~~~~~i~~l~~~~vDGiIl~~~-~~~~   81 (160)
T 3h5t_A            7 RAGAIGVLLTEDLTYAFEDMASVDFLAGVAQAAGDTQLTLIPASPASSV----DHVSAQQLVNNAAVDGVVIYSV-AKGD   81 (160)
T ss_dssp             -CCEEEEEESSCTTHHHHSHHHHHHHHHHHHHSSSCEEEEEECCCCTTC----CHHHHHHHHHTCCCSCEEEESC-CTTC
T ss_pred             CCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCH----HHHHHHHHHHHCCCCCCCCCCC-CCCC
T ss_conf             9985999976654333221267889999999986358558752133204----7899999886414565421133-3220


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             4555554179827996154476555
Q gi|254780901|r  164 DALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       164 e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      +.++.+.+.|+.+++.|...+....
T Consensus        82 ~~i~~L~~~~iPvV~id~~~~~~~~  106 (160)
T 3h5t_A           82 PHIDAIRARGLPAVIADQPAREEGM  106 (160)
T ss_dssp             HHHHHHHHHTCCEEEESSCCSCTTC
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             3566665127874234543346777


No 255
>>3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCSG, PSI-2, midwest center for structural genomics; 2.00A {Thermoplasma acidophilum} (A:)
Probab=46.96  E-value=17  Score=15.60  Aligned_cols=57  Identities=14%  Similarity=0.222  Sum_probs=35.1

Q ss_pred             EEEEECCCCCH---HHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             99994078861---528999999999769947998--078743366889789887420268689996
Q gi|254780901|r   95 IMIFGDYDVDG---AASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        95 I~I~gDyD~DG---itstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      |.+.||-=+-|   =++...|...|+..|.++.++  +|+...+    =...++++. +.+++|||.
T Consensus         8 ii~~GdEl~~G~~~D~n~~~l~~~l~~~G~~v~~~~~v~D~~~~----i~~~l~~~~-~~~Dliitt   69 (172)
T 3kbq_A            8 VITVGNEILKGRTVNTNAAFIGNFLTYHGYQVRRGFVVMDDLDE----IGWAFRVAL-EVSDLVVSS   69 (172)
T ss_dssp             EEEECHHHHTTSSCCHHHHHHHHHHHHTTCEEEEEEEECSCHHH----HHHHHHHHH-HHCSEEEEE
T ss_pred             EEEECCCCCCCEEEEHHHHHHHHHHHHCCCCEEEEEEECCCHHH----HHHHHHHHH-HCCCEEEEC
T ss_conf             99975115177046619999999999879917799998984999----999999987-348899981


No 256
>>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, enzyme kinetics, X-RAY diffraction; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* (A:38-146)
Probab=46.95  E-value=17  Score=15.60  Aligned_cols=81  Identities=23%  Similarity=0.234  Sum_probs=56.2

Q ss_pred             HHHHHHHHHHCCC----CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             9999999997799----799994078861528999999999769947998078743366889789887420268689996
Q gi|254780901|r   81 AARRIVQAIYNSE----KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        81 A~~ri~~ai~~~e----kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      |...|.++++++.    ..+|..   -.|-++.++-+-+ +.+|.++..++|..      .+..-++.+...|.++++ |
T Consensus         8 a~~~i~~~~~~g~~~~~~~vv~a---SsGN~g~alA~~a-~~~g~~~~iv~p~~------~~~~k~~~l~~~Ga~V~~-v   76 (109)
T 2v03_A            8 ALSMIVEAEKRGEIKPGDVLIEA---TSGNTGIALAMIA-ALKGYRMKLLMPDN------MSQERRAAMRAYGAELIL-V   76 (109)
T ss_dssp             HHHHHHHHHHTTCCCTTCEEEEE---CSSHHHHHHHHHH-HHHTCEEEEEEETT------SCHHHHHHHHHTTCEEEE-E
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEE---CCCCHHHHHHHHH-HHCCCCEEEEECCC------CHHHHHHHHHHHCCCCCC-C
T ss_conf             99999999972998898047752---3410688999999-97698704521255------126766999985897630-0


Q ss_pred             CCCCCCHHHHHHHHHC
Q ss_conf             4887623455555417
Q gi|254780901|r  157 DCGSTSYDALQYATNQ  172 (600)
Q Consensus       157 D~Gi~~~e~i~~a~~~  172 (600)
                      +-|..--+.+..++++
T Consensus        77 ~~~~~~~~~~~~a~~l   92 (109)
T 2v03_A           77 TKEQGMEGARDLALEM   92 (109)
T ss_dssp             CTTTHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHH
T ss_conf             0353214678876420


No 257
>>2g4r_A MOGA, molybdopterin biosynthesis MOG protein; anomalous substructure of MOGA, biosynthetic protein; 1.92A {Mycobacterium tuberculosis} (A:)
Probab=46.67  E-value=17  Score=15.57  Aligned_cols=54  Identities=19%  Similarity=0.259  Sum_probs=33.2

Q ss_pred             EEEEEC---CCCCHHHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHH---HCCCCEEEEE
Q ss_conf             999940---78861528999999999769947998--07874336688978988742---0268689996
Q gi|254780901|r   95 IMIFGD---YDVDGAASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFI---NEGAQLIITV  156 (600)
Q Consensus        95 I~I~gD---yD~DGitstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~---~~g~~LiItv  156 (600)
                      |...||   ..--==+++.+|...|.+.|.++.++  +|+.        .+.|.+..   .+++++|||.
T Consensus         8 ii~~GdEi~~g~~~d~n~~~l~~~l~~~G~~v~~~~~v~Dd--------~~~I~~~i~~~~~~~Dliit~   69 (160)
T 2g4r_A            8 IVVVSSRAAAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADG--------NPVGEALHDAVNAGVDVIITS   69 (160)
T ss_dssp             EEEECHHHHTTSSCCCHHHHHHHHHHHTTCCCCCCEEECSS--------HHHHHHHHHHHHTTCSEEEEE
T ss_pred             EEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEECHH--------HHHHHHHHHHHHCCCCEEEEC
T ss_conf             99946833048848846999999998779810255750417--------678999999997699999974


No 258
>>1uz5_A MOEA protein, 402AA long hypothetical molybdopterin biosynthesis MOEA protein; MOEA molybdopterin, MOCF biosynthesis; 2.05A {Pyrococcus horikoshii} (A:1-21,A:180-326)
Probab=46.42  E-value=17  Score=15.54  Aligned_cols=128  Identities=15%  Similarity=0.067  Sum_probs=65.3

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEE--ECCCCC-------H---HHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHH
Q ss_conf             8799999999999779979999--407886-------1---528999999999769947998--0787433668897898
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIF--GDYDVD-------G---AASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLM  142 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~--gDyD~D-------G---itstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i  142 (600)
                      -++||.+. .+..+-+-+|.|+  ||=-++       |   =+...++...|+.+|.++.++  +|+....    -.+.+
T Consensus         8 ~~~~~~~~-~~~~~~rprV~IistGdElv~~~~~~~~G~i~dsn~~~l~~~L~~~G~~v~~~~~v~Dd~~~----I~~~l   82 (168)
T 1uz5_A            8 PLEKALEV-VQSFKIKPKVAVISTGNEIVPPGNELKPGQIYDINGRALCDAINELGGEGIFMGVARDDKES----LKALI   82 (168)
T ss_dssp             CHHHHHHH-HHHCCCCCEEEEEEECTTEECTTSCCCTTCEECCHHHHHHHHHHHHTSEEEEEEEECSSHHH----HHHHH
T ss_pred             CHHHHHHH-HHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCHHHH----HHHHH
T ss_conf             89999999-98569955189995045656889888877414532255566676459611431003306777----66654


Q ss_pred             HHHHHCCCCEEEEECCCCCCHHH---HHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             87420268689996488762345---555541798279961544765556725652378888643344304788999999
Q gi|254780901|r  143 EKFINEGAQLIITVDCGSTSYDA---LQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVL  219 (600)
Q Consensus       143 ~~~~~~g~~LiItvD~Gi~~~e~---i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~  219 (600)
                      +++.+ .+++|||.  |-++...   +..+-+.-.++++--=..- .-.|-..++++-+      |.-.|.|.-++.+.+
T Consensus        83 ~~~~~-~~DlVItt--GG~g~g~~D~t~~al~~~~~~~~~gi~~~-PG~~~~~g~~~~~------~v~~LPG~P~aa~~~  152 (168)
T 1uz5_A           83 EKAVN-VGDVVVIS--GGASGGTKDLTASVIEELGEVKVHGIAIQ-PGKPTIIGVIKGK------PVFGLPGYPTSCLTN  152 (168)
T ss_dssp             HHHHH-HCSEEEEE--CCC-----CHHHHHHHHHSEEEEECBSEE-SCTTCEEEEETTE------EEEEECSSHHHHHHH
T ss_pred             HCCCC-CCCEEEEE--CCCCCCHHHHHHHHHHHCCCEEEEEEEEE-ECCCEEEEECCCC------EEEECCCCCHHHHHH
T ss_conf             20332-34247972--57343123779999986496699888788-3132378521365------389536564005465


No 259
>>1byr_A Protein (endonuclease); phosphodiesterase,; 2.00A {Salmonella typhimurium} (A:)
Probab=46.18  E-value=17  Score=15.51  Aligned_cols=51  Identities=10%  Similarity=0.053  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             999999999977997999940788615289999999997699479980787
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR  130 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R  130 (600)
                      .-.+.|.+|.+++-+|.|+-|--..--..+.-.+..|+..|.++.++-+++
T Consensus        41 ~i~~~L~~a~~rGv~V~ii~~~~~~~~~~~~~~~~~l~~~~v~~~~~~~~~   91 (155)
T 1byr_A           41 DIMKALVAAKKRGVDVKIVIDERGNTGRASIAAMNYIANSGIPLRTDSNFP   91 (155)
T ss_dssp             HHHHHHHHHHHTTCEEEEEEESTTCCSHHHHHHHHHHHHTTCCEEEECSSS
T ss_pred             HHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             999999999864985999998503455004788888775023323457775


No 260
>>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} (A:1-19,A:92-232)
Probab=46.08  E-value=17  Score=15.50  Aligned_cols=99  Identities=16%  Similarity=0.164  Sum_probs=60.4

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC--EEEEECCCCCCCCCCCHHHHHHHHHC-C
Q ss_conf             56148799999999999779979999407886152899999999976994--79980787433668897898874202-6
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN--ANMYIPDRIVDGYGPNPSLMEKFINE-G  149 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~--v~~~IP~R~~eGYGl~~~~i~~~~~~-g  149 (600)
                      ..++++.++.+.+   -+++-+|.|+.+-      +...+...|..+|..  +...+-......+-.++..++.+.+. +
T Consensus        23 ~~~pg~~e~L~~L---~~~gi~i~IiTn~------~~~~~~~~l~~~gl~~~f~~~~~~~~~~~~kp~~~~~~~~~~~~~   93 (160)
T 1zrn_A           23 APFSEVPDSLREL---KRRGLKLAILSNG------SPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALG   93 (160)
T ss_dssp             EECTTHHHHHHHH---HHTTCEEEEEESS------CHHHHHHHHHHTTCGGGCSEEEESGGGTCCTTSHHHHHHHHHHHT
T ss_pred             CCCCCCHHHHHHH---HHCCCEEEEECCC------HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             5432027899999---8549848873333------789999999835766111255113200000057888999999860


Q ss_pred             --CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             --8689996488762345555541798279961544
Q gi|254780901|r  150 --AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       150 --~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                        ++-+|.|+-+.++   +..|+..|+.+|......
T Consensus        94 ~~~~~~i~VGD~~~D---i~~A~~aGi~~i~v~~~~  126 (160)
T 1zrn_A           94 LDRSAILFVASNAWD---ATGARYFGFPTCWINRTG  126 (160)
T ss_dssp             SCGGGEEEEESCHHH---HHHHHHHTCCEEEECTTC
T ss_pred             CCCCEEEEEECCHHH---HHHHHHCCCEEEEEECCC
T ss_conf             255248998247877---999998699699980799


No 261
>>3bic_A Methylmalonyl-COA mutase, mitochondrial precursor; organic aciduria, methylmalonyl COA mutase deficiency, metabolic disease, structural genomics; 2.60A {Homo sapiens} (A:584-762)
Probab=45.95  E-value=17  Score=15.49  Aligned_cols=98  Identities=4%  Similarity=0.017  Sum_probs=63.4

Q ss_pred             CHHHHHHHHHHHH---HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC-HHHHHHHHHCCCCE
Q ss_conf             8799999999999---7799799994078861528999999999769947998078743366889-78988742026868
Q gi|254780901|r   77 DCDKAARRIVQAI---YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN-PSLMEKFINEGAQL  152 (600)
Q Consensus        77 dm~~A~~ri~~ai---~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~-~~~i~~~~~~g~~L  152 (600)
                      .|++...++....   ..+-+|++...-+-|=.-...++..+|+..|.+|.+.       |-+.+ .++++.+.+.++++
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~vll~~~~~d~H~~g~~~~~~~l~~~G~~v~~l-------g~~~~~~~~~~~~~~~~~d~   75 (179)
T 3bic_A            3 EITSAIKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIG-------PLFQTPREVAQQAVDADVHA   75 (179)
T ss_dssp             HHHHHHHHHHHHHHHHSSCCEEEEEEBSSCCCCHHHHHHHHHHHHTTCEEEEC-------CTTBCHHHHHHHHHHHTCSE
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCEEEECC-------CCCCCHHHHHHHHHHCCCCE
T ss_conf             89999999999999809997699965787745102999999998578007508-------87789999999999759899


Q ss_pred             EEEE-CCCC---CCHHHHHHHHHCCCC---EEEECC
Q ss_conf             9996-4887---623455555417982---799615
Q gi|254780901|r  153 IITV-DCGS---TSYDALQYATNQGID---VIVIDH  181 (600)
Q Consensus       153 iItv-D~Gi---~~~e~i~~a~~~Gid---vIVtDH  181 (600)
                      |+.. =++.   ...+-++.+++.|.+   |+|.=.
T Consensus        76 V~ls~~~~~~~~~~~~~~~~lr~~g~~~~~vivgG~  111 (179)
T 3bic_A           76 VGVSTLAAGHKTLVPELIKELNSLGRPDILVMCGGV  111 (179)
T ss_dssp             EEEEECSSHHHHHHHHHHHHHHHHTCTTSEEEEEES
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             999368734798999999999967998867998076


No 262
>>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} (A:122-261,A:351-391)
Probab=45.83  E-value=17  Score=15.47  Aligned_cols=83  Identities=7%  Similarity=-0.007  Sum_probs=53.7

Q ss_pred             CCCEEEEECCCCC-HHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC--HHHHHHH--HHCCCCEEEEECCCCCCHHHH
Q ss_conf             9979999407886-1528999999999769947998078743366889--7898874--202686899964887623455
Q gi|254780901|r   92 SEKIMIFGDYDVD-GAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN--PSLMEKF--INEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        92 ~ekI~I~gDyD~D-Gitstail~~~L~~~g~~v~~~IP~R~~eGYGl~--~~~i~~~--~~~g~~LiItvD~Gi~~~e~i  166 (600)
                      .+++.|+.+-|-+ |-....-+.+.++..|.+|....+--.    |-+  ...+..+  ...+++.|+..-.+.....-+
T Consensus        20 ~kkvavi~~dd~~yG~~~~~~~~~~l~~~G~~Vv~~~~~~~----~~~d~~~~v~~lk~~~a~pdaVil~~~~~~~~~~i   95 (181)
T 3eaf_A           20 QGKLALAYDSKVAYSRSPIGAIKKAAPSLGLQVVGDYDLPL----RATEADAERIAREXLAADPDYVWCGNTISSCSLLG   95 (181)
T ss_dssp             SEEEEEEECTTCHHHHTTHHHHHHHTGGGTEEEEEEEECCT----TCCHHHHHHHHHHHHTTCCSEEEECSCHHHHHHHH
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCC----CCCCCCHHHHHHHHHCCCCCEEEEECCCHHHHHHH
T ss_conf             67389998147830478999999999753675004662143----11222202444444325642699952552678999


Q ss_pred             HHHHHCCCCEEE
Q ss_conf             555417982799
Q gi|254780901|r  167 QYATNQGIDVIV  178 (600)
Q Consensus       167 ~~a~~~GidvIV  178 (600)
                      ..+++.|++.-+
T Consensus        96 kq~~~~g~~~~i  107 (181)
T 3eaf_A           96 RAXAKVGLDAFL  107 (181)
T ss_dssp             HHHHHHTCCCEE
T ss_pred             HHHHHCCCCCEE
T ss_conf             999973998527


No 263
>>1p5d_X PMM, phosphomannomutase; alpha/beta protein, phosphohexomutase, phosphoserine, enzyme-ligand complex, enzyme-metal complex, isomerase; HET: SEP G1P; 1.60A {Pseudomonas aeruginosa} (X:155-257,X:342-368)
Probab=45.73  E-value=11  Score=16.88  Aligned_cols=25  Identities=24%  Similarity=0.470  Sum_probs=12.0

Q ss_pred             CHHHHHHHHHHHHHHHHCEEEEEEE
Q ss_conf             8122222278998842010799886
Q gi|254780901|r  379 HPGIVGLLAARLKEKFGRPSFAISF  403 (600)
Q Consensus       379 h~GViGIVAsrL~e~y~kP~iv~s~  403 (600)
                      ..|+.|.++.++.++++..++++..
T Consensus        26 ~~Ga~~~~~~~il~~lG~~v~~in~   50 (130)
T 1p5d_X           26 GNGVAGVIAPQLIEALGCSVIPLYC   50 (130)
T ss_dssp             TTSGGGGTHHHHHHHHHEEEEEESC
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             9870899999999976997999827


No 264
>>3e38_A Two-domain protein containing predicted PHP-like metal-dependent phosphoesterase; YP_001300751.1, structural genomics; 2.20A {Bacteroides vulgatus atcc 8482} (A:1-240)
Probab=45.70  E-value=14  Score=16.16  Aligned_cols=28  Identities=21%  Similarity=0.171  Sum_probs=18.2

Q ss_pred             CCCCCCHHHHHHHHHCCCCEEE-ECCCCC
Q ss_conf             4887623455555417982799-615447
Q gi|254780901|r  157 DCGSTSYDALQYATNQGIDVIV-IDHHQV  184 (600)
Q Consensus       157 D~Gi~~~e~i~~a~~~GidvIV-tDHH~~  184 (600)
                      |.-.+-.+-++.|+++|+++|. |||...
T Consensus        31 DG~~~p~e~i~~A~~~Gl~~iaiTDH~~~   59 (240)
T 3e38_A           31 DGLVWPTVRVDEAYRDGLDAISLTEHIEY   59 (240)
T ss_dssp             TCSBCHHHHHHHHHHTTCSEECCEEESSC
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             69888999999999829999998999875


No 265
>>3l12_A Putative glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Silicibacter pomeroyi} (A:1-65,A:123-313)
Probab=45.63  E-value=17  Score=15.45  Aligned_cols=27  Identities=7%  Similarity=0.247  Sum_probs=17.1

Q ss_pred             CHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             234555554179827996154476555
Q gi|254780901|r  162 SYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      +.+++..|.+.|.|.+=+|=+.-.+..
T Consensus        34 t~~~~~~~~~~g~~~~e~d~~~t~dg~   60 (256)
T 3l12_A           34 TLEGFAFTLAAGVRALEFDVVXTADGV   60 (256)
T ss_dssp             CHHHHHHHHHTTCCEEEEEEEECTTSC
T ss_pred             HHHHHHHHHHCCCCEEEEEEEEECCCC
T ss_conf             699999999869898998779923999


No 266
>>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A (A:)
Probab=45.61  E-value=17  Score=15.45  Aligned_cols=47  Identities=11%  Similarity=0.193  Sum_probs=34.0

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             879999999999977997999940788615289999999997699479980
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI  127 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~I  127 (600)
                      ..+...+++.+.+.+...|.+|    |++-..++.....|+.+|.+-.|++
T Consensus        37 p~~~l~~~~~~~~~~~~~iv~~----c~~g~~a~~aa~~l~~~G~~nv~~l   83 (106)
T 3hix_A           37 PIEDLVDRASSSLEKSRDIYVY----GAGDEQTSQAVNLLRSAGFEHVSEL   83 (106)
T ss_dssp             CGGGHHHHHHHHSCTTSCEEEE----CSSHHHHHHHHHHHHHTTCSCEEEC
T ss_pred             CCCCCHHHHHHHHCCCCEECCC----CCCCHHHHHHHHHHHHCCCCCEEEC
T ss_conf             2223000104541333201025----6642279999999997099878991


No 267
>>3k9f_C DNA topoisomerase 4 subunit B; quinolone, topoisomerase, protein-DNA cleavage complex; HET: DNA LFX; 2.90A {Streptococcus pneumoniae} PDB: 3fof_C* 3foe_C* (C:1-161,C:205-230)
Probab=45.51  E-value=15  Score=15.87  Aligned_cols=28  Identities=36%  Similarity=0.584  Sum_probs=19.1

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             9979999407886152899999999976
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHC  119 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~  119 (600)
                      =.+|+|..|-|+||.-=..+|..|+-.+
T Consensus       119 YgkIiImtDaD~DG~HI~~Llltff~~~  146 (187)
T 3k9f_C          119 YDKIIIMTDADTDGAHIQTLLLTFFYRY  146 (187)
T ss_dssp             CSEEEEECCSSHHHHHHHHHHHHHHHHT
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             6707998579876221577999999987


No 268
>>3ct6_A PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DHAM; mixed alpha beta structure, glycerol metabolism; 1.10A {Lactococcus lactis} (A:)
Probab=45.38  E-value=17  Score=15.42  Aligned_cols=58  Identities=16%  Similarity=0.237  Sum_probs=33.7

Q ss_pred             HHHHHHCCCCEEEEECCCC-CCCCCCCHHHHHHHHHC--CCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             9999976994799807874-33668897898874202--68689996488762345555541
Q gi|254780901|r  113 MRFLSHCSVNANMYIPDRI-VDGYGPNPSLMEKFINE--GAQLIITVDCGSTSYDALQYATN  171 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~R~-~eGYGl~~~~i~~~~~~--g~~LiItvD~Gi~~~e~i~~a~~  171 (600)
                      .+..+++..++....---. ..++|-+...|..+.++  +-.++|.+|.||+-.. .+.|-+
T Consensus        19 ~el~~qma~dv~i~~aGG~~dg~iGTs~~~I~~ai~~~~~dgvlvl~DLGSA~mn-ae~A~e   79 (131)
T 3ct6_A           19 KKLIREVAKNISLTAIGGLENGEIGTSFDRVMNAIEENEADNLLTFFDLGSARMN-LDLVSE   79 (131)
T ss_dssp             HHHHHTTCSSSCEEEEESCTTSCSSCCHHHHHHHHHHSSCSEEEEEESSGGGHHH-HHHHHH
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCHHHHH-HHHHHH
T ss_conf             9999985489819985388999877799999999985489988999818579999-999998


No 269
>>1vky_A S-adenosylmethionine:tRNA ribosyltransferase- isomerase; TM0574, structural genomics, JCSG, protein structure initiative, PSI; 2.00A {Thermotoga maritima} (A:1-76,A:174-347)
Probab=45.00  E-value=18  Score=15.38  Aligned_cols=112  Identities=15%  Similarity=0.149  Sum_probs=57.9

Q ss_pred             HHCCCCEEEEECCCC------CHHHHHHHHHHHHHHCCCCEEE---EE------CCCC---------CCCCCCCHHHHH-
Q ss_conf             977997999940788------6152899999999976994799---80------7874---------336688978988-
Q gi|254780901|r   89 IYNSEKIMIFGDYDV------DGAASVALMMRFLSHCSVNANM---YI------PDRI---------VDGYGPNPSLME-  143 (600)
Q Consensus        89 i~~~ekI~I~gDyD~------DGitstail~~~L~~~g~~v~~---~I------P~R~---------~eGYGl~~~~i~-  143 (600)
                      +-|+-|+.||..+.-      -|.-=|--|.+.|+.-|.++.+   |+      |-|.         .|-|-++.+..+ 
T Consensus        69 V~NdTkViVyAk~~GsvAAPTAGLHFt~~ll~~l~~kGv~~~~iTLHvG~gTF~pv~~e~i~~H~mh~E~~~I~~~ta~~  148 (250)
T 1vky_A           69 VLNVSKVIVYAKEEGSVAAPTAGLHFTPELIEKLKKKGVQFAEVVLHVGIGTFRPVKVEEVEKHKMHEEFYQVPKETVRK  148 (250)
T ss_dssp             EEEEEECC------------CGGGGCCHHHHHHHHHHTCEEEEEEEEC------------------CCCEEEECHHHHHH
T ss_pred             EEECCEEEHHHHHCCCEECCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCEEEEECHHHHHH
T ss_conf             99799998976425854367688677899999999849926889999735556576554235678777299982999999


Q ss_pred             --HHHHCCCCEEEEECCCCCCHHHHHHHHHCCCC---EEEECCCCCCCCCCC-CE-EEECCCCCCCC
Q ss_conf             --74202686899964887623455555417982---799615447655567-25-65237888864
Q gi|254780901|r  144 --KFINEGAQLIITVDCGSTSYDALQYATNQGID---VIVIDHHQVKSEEIP-AY-ALVNPNRLDDL  203 (600)
Q Consensus       144 --~~~~~g~~LiItvD~Gi~~~e~i~~a~~~Gid---vIVtDHH~~~~~~p~-a~-aivNP~~~~~~  203 (600)
                        ++++.| .-||.|  |++...+++-+.+.|.-   .=-||.-.-|+-... .+ .+-|-|+|...
T Consensus       149 i~~ak~~g-~riiAV--GTT~~RaLEsa~~~g~~~~~~G~T~lfI~Pgy~fkvvd~LiTNFH~P~ST  212 (250)
T 1vky_A          149 LRETRERG-NRIVAV--GTTTVRTLETIARLPEQEEYVGKTDLFIYPPFEFKLVDALVTNFHLPRST  212 (250)
T ss_dssp             HHHHHHHT-CCEEEE--SHHHHHHHHHHTTSCCCSSEEECCCCCCCSSCCCSSCSEEEEECCCTTCH
T ss_pred             HHHHHHCC-CCEEEE--EHHHHHHHHHHHHHCCCCCCCCCCCEEECCCCCCCEECCCEECCCCCCCH
T ss_conf             99999719-958998--45899999999874257776775246989999871818655468377039


No 270
>>1dxl_A Dihydrolipoamide dehydrogenase; multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex, flavoprotein; HET: FAD; 3.15A {Pisum sativum} (A:158-275)
Probab=44.97  E-value=16  Score=15.81  Aligned_cols=94  Identities=12%  Similarity=0.106  Sum_probs=48.3

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC-CCCCCCCCCHHH----HHHHHHCCCCEEEEECCCCCCH
Q ss_conf             97799799994078861528999999999769947998078-743366889789----8874202686899964887623
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD-RIVDGYGPNPSL----MEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~-R~~eGYGl~~~~----i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      -+..++++|+|-    |. ...-+..+|..+|.+|..+... |+  .-++.++.    .+.+.+.|+++.  .++.++..
T Consensus        17 ~~~~~~v~IiGg----G~-ig~e~A~~l~~~g~~Vtli~~~~~~--l~~~d~~~~~~~~~~l~~~gI~v~--~~~~v~~i   87 (118)
T 1dxl_A           17 SEIPKKLVVIGA----GY-IGLEMGSVWGRIGSEVTVVEFASEI--VPTMDAEIRKQFQRSLEKQGMKFK--LKTKVVGV   87 (118)
T ss_dssp             SSCCSEEEESCC----SH-HHHHHHHHHHHHTCEEEEECSSSSS--STTSCHHHHHHHHHHHHHSSCCEE--CSEEEEEE
T ss_pred             CCCCCEEEEECC----CH-HHHHHHHHHHHHCCEEEEEEECCCC--CCCCCHHHHHHHHHHHHHHCCCEE--ECCCEEEE
T ss_conf             107983999996----89-9999999999709979999846856--865598999999999997197267--31210679


Q ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCCCCEEEE
Q ss_conf             45555541798279961544765556725652
Q gi|254780901|r  164 DALQYATNQGIDVIVIDHHQVKSEEIPAYALV  195 (600)
Q Consensus       164 e~i~~a~~~GidvIVtDHH~~~~~~p~a~aiv  195 (600)
                      +.    .+.+..+-+...+.-..+..+++.+|
T Consensus        88 ~~----~~~~~~v~~~~~~~~~~~~i~~D~vi  115 (118)
T 1dxl_A           88 DT----SGDGVKLTVEPSAGGEQTIIEADVVL  115 (118)
T ss_dssp             EC----SSSSEEEEEEESSSCCCEEEEESEEE
T ss_pred             EE----ECCCEEEEEECCCCCCCEEECCCEEE
T ss_conf             98----31760454212677522032266789


No 271
>>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A (A:1-184)
Probab=44.71  E-value=18  Score=15.35  Aligned_cols=64  Identities=13%  Similarity=0.174  Sum_probs=46.7

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             77997999940788615289999999997699479980787433668897898874202686899964887
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      ..+++++||    |...-.+-.+++.|+..|..+.++-...-.+   --...++.+.+..+.++|+.|.+.
T Consensus        29 ~~~~k~lIf----~~~~~~~~~l~~~L~~~~~~~~~~~g~~~~~---~r~~~~~~F~~~~~~vli~t~~~~   92 (184)
T 3eaq_A           29 ASPDRAMVF----TRTKAETEEIAQGLLRLGHPAQALHGDLSQG---ERERVLGAFRQGEVRVLVATDVAA   92 (184)
T ss_dssp             HCCSCEEEE----CSSHHHHHHHHHHHHHHTCCEEEECSSSCHH---HHHHHHHHHHSSSCCEEEECTTTT
T ss_pred             CCCCEEEEE----ECCHHHHHHHHHHHHHCCCCEEEEECCCCHH---HHHHHHHHHHCCCEEEEEECHHHH
T ss_conf             898979999----7958999999999986899789997999999---999999988528734897211443


No 272
>>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} (A:190-335)
Probab=44.70  E-value=18  Score=15.35  Aligned_cols=103  Identities=16%  Similarity=0.239  Sum_probs=66.3

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHH-HHHHHHHCCCC
Q ss_conf             56148799999999999779979999407886152899999999976994799807874336688978-98874202686
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPS-LMEKFINEGAQ  151 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~-~i~~~~~~g~~  151 (600)
                      ..+..++.-+-.+..+.+++.+.+|+.| |+||-.-+.++.+-++..---+-...|     |||-+.. .+++++----.
T Consensus        34 ~ki~~~~~ilp~Le~~~~~~~pLlIiAe-dv~~eaL~tLv~N~~~g~~~v~aVkaP-----gfG~~rk~~L~DiAi~tG~  107 (146)
T 1we3_A           34 KKVSNVRELLPILEQVAQTGKPLLIIAE-DVEGEALATLVVNKLRGTLSVAAVKAP-----GFGDRRKEMLKDIAAVTGG  107 (146)
T ss_dssp             SCBCCHHHHHHHHHHHHTTTCCEEEEES-CBCHHHHHHHHHHHHHTSCCEEEEECS-----SSHHHHHHHHHHHHHHHCC
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEEC-CCHHHHHHHHHHHHHHHHHCEEEEECC-----CCCHHHHHHHHHHHHHHCC
T ss_conf             2546699999999999976997899966-761889999999877604236678566-----4227899999999998299


Q ss_pred             EEEEECCCCCCHHHHHHHHHCCC--CEEEECCCC
Q ss_conf             89996488762345555541798--279961544
Q gi|254780901|r  152 LIITVDCGSTSYDALQYATNQGI--DVIVIDHHQ  183 (600)
Q Consensus       152 LiItvD~Gi~~~e~i~~a~~~Gi--dvIVtDHH~  183 (600)
                      -+|.-|.|.+-.+ +. ...+|-  .|+||-++.
T Consensus       108 ~vi~~~~g~~l~~-~~-~~~LG~a~~v~vtkd~T  139 (146)
T 1we3_A          108 TVISEELGFKLEN-AT-LSMLGRAERVRITKDET  139 (146)
T ss_dssp             CCBCTTTTCCGGG-CC-GGGCEEEEEEEECSSCE
T ss_pred             EEECCCCCCCHHH-CC-HHHCCCEEEEEECCCCE
T ss_conf             9833324575554-79-99869736999826741


No 273
>>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} (A:)
Probab=44.68  E-value=17  Score=15.57  Aligned_cols=82  Identities=11%  Similarity=0.188  Sum_probs=53.3

Q ss_pred             HHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH---H
Q ss_conf             9977997999940788615289999999997699479980787433668897898874202686899964887623---4
Q gi|254780901|r   88 AIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY---D  164 (600)
Q Consensus        88 ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~---e  164 (600)
                      .+..+.+|+|.=    |-.+...++...|+..|.++...-     .    ..++++.+.+..++++| +|......   +
T Consensus         2 s~~~~~rILiVD----D~~~~~~~l~~~L~~~g~~v~~a~-----s----~~eAl~~l~~~~~dlii-lD~~mP~~dG~e   67 (140)
T 3grc_A            2 SLAPRPRILICE----DDPDIARLLNLXLEKGGFDSDXVH-----S----AAQALEQVARRPYAAXT-VDLNLPDQDGVS   67 (140)
T ss_dssp             ---CCSEEEEEC----SCHHHHHHHHHHHHHTTCEEEEEC-----S----HHHHHHHHHHSCCSEEE-ECSCCSSSCHHH
T ss_pred             CCCCCCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHHCCCCEEC-CCCCCCCCCHHH
T ss_conf             999987799996----999999999999998799999989-----9----99999998850444210-457889998999


Q ss_pred             HHHHHHHC----CCCEEEE-CCCC
Q ss_conf             55555417----9827996-1544
Q gi|254780901|r  165 ALQYATNQ----GIDVIVI-DHHQ  183 (600)
Q Consensus       165 ~i~~a~~~----GidvIVt-DHH~  183 (600)
                      -++..++.    .+.||+. -|..
T Consensus        68 l~~~ir~~~~~~~~pii~lt~~~~   91 (140)
T 3grc_A           68 LIRALRRDSRTRDLAIVVVSANAR   91 (140)
T ss_dssp             HHHHHHTSGGGTTCEEEEECTTHH
T ss_pred             HHHHHHHCCCCCCCCEEEEECCCC
T ss_conf             999998472579997899956798


No 274
>>3g1w_A Sugar ABC transporter; sugar-binding protein, target 11229F, transport protein, structural genomics, PSI-2; 2.02A {Bacillus halodurans c-125} (A:109-242)
Probab=44.59  E-value=18  Score=15.34  Aligned_cols=105  Identities=6%  Similarity=-0.034  Sum_probs=54.6

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCE-EEE
Q ss_conf             7999999999997799799994078861-52899999999976994799807874336688978988742026868-999
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYDVDG-AASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQL-IIT  155 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD~DG-itstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~L-iIt  155 (600)
                      -..+++.+.+....+.+|++++.-...- .-=..=..++++..+..+......-......-....++.+...+.++ .|.
T Consensus         5 g~~~~~~l~~~~~g~~~i~~i~~~~~~~~~~R~~Gf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ai~   84 (134)
T 3g1w_A            5 GXNAAYKXAELLDGEGEVAVITLPNQLNHQERTTGFKETLEAEFPAIEVIAVEDGRGDSLHSRRVAHQLLEDYPNLAGIF   84 (134)
T ss_dssp             HHHHHHHHHHHTTTCEEEEEEECTTCHHHHHHHHHHHHHHHHHCTTEEEEEEEECTTCHHHHHHHHHHHHHHCTTEEEEE
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             89999999997145761999931243128999999999998757766314575166535889999998740389988899


Q ss_pred             ECCCCCCHHHHHHHHHCCC--CEEE--ECCC
Q ss_conf             6488762345555541798--2799--6154
Q gi|254780901|r  156 VDCGSTSYDALQYATNQGI--DVIV--IDHH  182 (600)
Q Consensus       156 vD~Gi~~~e~i~~a~~~Gi--dvIV--tDHH  182 (600)
                      +-+...+.-.+..++++|+  ||.|  .|-+
T Consensus        85 ~~~~~~a~g~~~al~~~g~~~di~i~g~d~~  115 (134)
T 3g1w_A           85 ATEANGGVGVGDAVRLESRAGEIQIISFDTD  115 (134)
T ss_dssp             ESSHHHHHHHHHHHHHTTCTTTSEEEEESCC
T ss_pred             ECCCHHHHHHHHHHHHCCCCCCEEEEEECCC
T ss_conf             7774899999999997699998399997896


No 275
>>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} (A:1-113,A:249-288)
Probab=44.58  E-value=18  Score=15.34  Aligned_cols=73  Identities=14%  Similarity=0.057  Sum_probs=49.1

Q ss_pred             HHHHHHCCCCEEEEECC-CCCCCCCCCHHHHHHHHHCCCCEEEEECCCCC-CHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             99999769947998078-74336688978988742026868999648876-23455555417982799615447655
Q gi|254780901|r  113 MRFLSHCSVNANMYIPD-RIVDGYGPNPSLMEKFINEGAQLIITVDCGST-SYDALQYATNQGIDVIVIDHHQVKSE  187 (600)
Q Consensus       113 ~~~L~~~g~~v~~~IP~-R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~-~~e~i~~a~~~GidvIVtDHH~~~~~  187 (600)
                      .+.++..|.++.++..+ +.+.  ---.+.++.+...+++-+|.+-...+ ..+.++++++.||-|+++|...+...
T Consensus        24 ~~aa~~~Gy~l~i~~~~s~~d~--~~~~~~i~~li~~~vDGIIi~~~~~~~~~~~i~~l~~~gIPvV~id~~~~~~~   98 (153)
T 1gud_A           24 EDEAKTLGVSVDIFASPSEGDF--QSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVARAWKKGIYLVNLDEKIDMDN   98 (153)
T ss_dssp             HHHHHHHTCCEEEEECSSTTCH--HHHHHHHHHHHTSSEEEEEECCSSSSTTHHHHHHHHHTTCEEEEESSCCCHHH
T ss_pred             HHHHHHCCCEEEEEECCCCCCH--HHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHCCCCEEECCCCCCCCC
T ss_conf             9999974998999967898999--99999999999759985764254332114899999971991762377765444


No 276
>>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAP; 2.79A {Bacillus subtilis} (A:1-127,A:272-300)
Probab=44.48  E-value=18  Score=15.32  Aligned_cols=63  Identities=21%  Similarity=0.161  Sum_probs=40.6

Q ss_pred             CCCCEEEE-ECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC---CCCHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             79979999-4078861528999999999769947998078743366---88978988742026868999648876
Q gi|254780901|r   91 NSEKIMIF-GDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY---GPNPSLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        91 ~~ekI~I~-gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGY---Gl~~~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      ++.+|+|+ ||      ---+.+.+.|..+|++|..+=|..+..++   -.... ++++.+ +++.||+-=-+..
T Consensus         6 ~G~kIaviGGD------~r~~rva~sL~~~G~~V~~~gp~~~~~~~~~v~~~~~-l~eai~-~aDvIilpvq~er   72 (156)
T 2rir_A            6 TGLKIAVIGGD------ARQLEIIRKLTEQQADIYLVGFDQLDHGFTGAVKCNI-DEIPFQ-QIDSIILPVSATT   72 (156)
T ss_dssp             CSCEEEEESBC------HHHHHHHHHHHHTTCEEEEESCTTSSCCCTTEEECCG-GGSCGG-GCSEEECCSSCEE
T ss_pred             CCCEEEEECCC------HHHHHHHHHHHHCCCEEEEEECCCHHHHHCCCEECCC-HHHHHH-HCCEEECCCCCCC
T ss_conf             68879997787------7599999999978997999964706635066277067-789861-0888852565558


No 277
>>3ch0_A Glycerophosphodiester phosphodiesterase; YP_677622.1, glycerophosphoryl diester phosphodiesterase, structural genomics; HET: MSE CIT GOL; 1.50A {Cytophaga hutchinsonii atcc 33406} (A:)
Probab=44.42  E-value=18  Score=15.32  Aligned_cols=28  Identities=18%  Similarity=0.172  Sum_probs=18.9

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             6234555554179827996154476555
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      ++..+++.|.+.|.|.|=+|=|.-.+..
T Consensus        24 NTl~a~~~A~~~Gad~iE~DV~lTkDg~   51 (272)
T 3ch0_A           24 NTIAAFTKALLLGVTTLEFDLVISKDNR   51 (272)
T ss_dssp             TSHHHHHHHHHHTCSEEEEEEEECTTCC
T ss_pred             CHHHHHHHHHHCCCCEEEEEEEEECCCC
T ss_conf             3799999999849898999889901898


No 278
>>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} (A:1-122)
Probab=44.41  E-value=18  Score=15.32  Aligned_cols=86  Identities=15%  Similarity=0.175  Sum_probs=54.0

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-CCCCCCH-HHHHHHHH-CCCCEEEEECCCCCCHHHHH
Q ss_conf             799799994078861528999999999769947998078743-3668897-89887420-26868999648876234555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV-DGYGPNP-SLMEKFIN-EGAQLIITVDCGSTSYDALQ  167 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~-eGYGl~~-~~i~~~~~-~g~~LiItvD~Gi~~~e~i~  167 (600)
                      ++-+|.|.|   +.|..+...+......-+.++....+.+.. +-||... ..++++.+ ..+++++.+--..+..+.+.
T Consensus         6 k~iri~iiG---~gg~~g~~~~~~~~~~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~~~~~~vD~v~i~t~~~~h~~~~~   82 (122)
T 1oi7_A            6 RETRVLVQG---ITGREGQFHTKQMLTYGTKIVAGVTPGKGGMEVLGVPVYDTVKEAVAHHEVDASIIFVPAPAAADAAL   82 (122)
T ss_dssp             TTCEEEEET---TTSHHHHHHHHHHHHHTCEEEEEECTTCTTCEETTEEEESSHHHHHHHSCCSEEEECCCHHHHHHHHH
T ss_pred             CCCEEEEEC---CCCCHHHHHHHHHHHHCCCEEEEECCCCCCCEEECCCCCCCHHHHHCCCCCCEEEEECCHHHHHHHHH
T ss_conf             998499989---98858789999999809957998648988637879203474677434678767999627899999999


Q ss_pred             HHHHCCCCEEEE
Q ss_conf             554179827996
Q gi|254780901|r  168 YATNQGIDVIVI  179 (600)
Q Consensus       168 ~a~~~GidvIVt  179 (600)
                      .+.+.|+.|++.
T Consensus        83 ~~~~~g~~v~~e   94 (122)
T 1oi7_A           83 EAAHAGIPLIVL   94 (122)
T ss_dssp             HHHHTTCSEEEE
T ss_pred             HHHHCCCCEEEE
T ss_conf             998679988999


No 279
>>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate- loop, pyridoxal phosphate, selenocysteine synthase (SECS; HET: LLP; 1.65A {Mus musculus} (A:115-294)
Probab=44.17  E-value=18  Score=15.29  Aligned_cols=99  Identities=11%  Similarity=0.043  Sum_probs=62.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCC---EEEEE
Q ss_conf             999999999977997999940788615289999999997699479980787433668897898874202686---89996
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ---LIITV  156 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~---LiItv  156 (600)
                      .+......+..+...-.|+.++.=.+      ....++..|.+.....+.+-.+++++..+.+++..++...   .++.+
T Consensus        17 a~~~~~~~~~~~~gd~Vl~~~~~~~~------~~~~~~~~g~~~~~v~~~~~~~~~~~d~~~l~~~~~~~~~~~~~~~~~   90 (180)
T 3bc8_A           17 TLCFLTLRHKRPKAKYIIWPRIDQKS------CFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCLHS   90 (180)
T ss_dssp             HHHHHHHHHHCTTCCEEEEECCCCHH------HHHHHHHTTCEEEEECCEEETTEEECCHHHHHHHHHHHCGGGEEEEEE
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCHHH------HHHHHHHCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             99999999735799989973874188------899999849827999621133136759999999986524566289998


Q ss_pred             CCCCCC------HHH-HHHHHHCCCCEEEECCCCC
Q ss_conf             488762------345-5555417982799615447
Q gi|254780901|r  157 DCGSTS------YDA-LQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       157 D~Gi~~------~e~-i~~a~~~GidvIVtDHH~~  184 (600)
                      .+.++.      .++ .+.+++.|+-+++=.=|..
T Consensus        91 ~~~~~~~g~~~~~~~i~~~~~~~~~~i~~D~a~~~  125 (180)
T 3bc8_A           91 TTACFAPRVPDRLEELAVICANYDIPHVVNNAYGL  125 (180)
T ss_dssp             ESSCCTTBCCCCHHHHHHHHHHHTCCEEEECTTTT
T ss_pred             ECCCCCCEEEHHHHHHHHHHHHHCCEEEEECCCHH
T ss_conf             26988974760299999999995995999726423


No 280
>>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} (A:)
Probab=44.01  E-value=18  Score=15.27  Aligned_cols=32  Identities=13%  Similarity=0.412  Sum_probs=19.6

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             68689996488762345555541798279961
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtD  180 (600)
                      ...+++.|++|..+......++++|.+|.+.+
T Consensus        55 ~~~iv~~c~~g~~s~~a~~~L~~~G~~v~~l~   86 (108)
T 3gk5_A           55 DKKYAVICAHGNRSAAAVEFLSQLGLNIVDVE   86 (108)
T ss_dssp             TSCEEEECSSSHHHHHHHHHHHTTTCCEEEET
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEC
T ss_conf             43422216985499999999998499889987


No 281
>>3cu5_A Two component transcriptional regulator, ARAC family; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} (A:)
Probab=43.97  E-value=18  Score=15.30  Aligned_cols=25  Identities=20%  Similarity=0.250  Sum_probs=8.9

Q ss_pred             CCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             7623455555417982799615447
Q gi|254780901|r  160 STSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       160 i~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      .+..++++.+.+...|++++|=..|
T Consensus        36 ~~~~eal~~~~~~~~DlvllD~~mP   60 (141)
T 3cu5_A           36 DDGINAIQIALKHPPNVLLTDVRMP   60 (141)
T ss_dssp             SSHHHHHHHHTTSCCSEEEEESCCS
T ss_pred             CCHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             8899999999837998999968899


No 282
>>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} (A:)
Probab=43.96  E-value=18  Score=15.27  Aligned_cols=13  Identities=38%  Similarity=0.575  Sum_probs=6.2

Q ss_pred             HHHHHCCCCEEEE
Q ss_conf             5554179827996
Q gi|254780901|r  167 QYATNQGIDVIVI  179 (600)
Q Consensus       167 ~~a~~~GidvIVt  179 (600)
                      ..+.+.|+.+++-
T Consensus       108 ~~~~~~gl~~~~~  120 (226)
T 1w0m_A          108 AKAKSLGLDVVVC  120 (226)
T ss_dssp             HHHHHTTCEEEEE
T ss_pred             HHHHHCCCEEEEE
T ss_conf             9999869989998


No 283
>>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix K1} (A:130-297)
Probab=43.47  E-value=18  Score=15.21  Aligned_cols=56  Identities=18%  Similarity=0.111  Sum_probs=35.0

Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCEEEEEEECC--C-CEEEEEEECCCCC
Q ss_conf             243475026205785812222227899884201079988637--9-8379998648986
Q gi|254780901|r  364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE--D-GKGIGSGRSIEGF  419 (600)
Q Consensus       364 ~~~~~~~ivv~~~~wh~GViGIVAsrL~e~y~kP~iv~s~~~--d-g~~kGS~RSi~g~  419 (600)
                      +.++..+|++|.|....|--=+.+.+-.-..+||++++-...  . ...-+|+.|..|-
T Consensus        74 ~Dp~t~~I~ly~E~~~~~~~~~~~a~r~~~~~KPVv~lk~G~s~~g~~aa~sa~shtgs  132 (168)
T 2yv2_A           74 EDPQTEALVLIGEIGGDMEERAAEMIKKGEFTKPVIAYIAGRTAPPEKRMGHAGAIIMM  132 (168)
T ss_dssp             TCTTCSEEEEEECSSSSHHHHHHHHHHTTSCCSCEEEEESCCC----------------
T ss_pred             CCCCCCEEEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCHHHCCCC
T ss_conf             57785579999984065304789998751378617999620468753234543123367


No 284
>>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} (A:)
Probab=43.34  E-value=19  Score=15.20  Aligned_cols=72  Identities=11%  Similarity=0.180  Sum_probs=51.2

Q ss_pred             HHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             9999999--77997999940788615289999999997699479980787433668897898874202686899964887
Q gi|254780901|r   83 RRIVQAI--YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        83 ~ri~~ai--~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      +.+.+.+  ..++++.||    |.-..++-.|++.|+..|..+.++..+.-.+   --...++++.....+.+|+.|++.
T Consensus        20 ~~l~~ll~~~~~~k~iIF----~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~---er~~~~~~F~~g~~~ilv~T~~~~   92 (172)
T 1t5i_A           20 RKLFDLLDVLEFNQVVIF----VKSVQRCIALAQLLVEQNFPAIAIHRGMPQE---ERLSRYQQFKDFQRRILVATNLFG   92 (172)
T ss_dssp             HHHHHHHHHSCCSSEEEE----CSSHHHHHHHHHHHHHTTCCEEEECTTSCHH---HHHHHHHHHHTTSCSEEEESSCCS
T ss_pred             HHHHHHHHHCCCCCEEEE----EEEECHHHHHHHHHHHCCCCCCCCCCCCHHH---HHHHHHHHHHHHHHEEEECHHHHH
T ss_conf             999999972788848999----7003022555677652034421000222023---321002232211010121217777


Q ss_pred             C
Q ss_conf             6
Q gi|254780901|r  161 T  161 (600)
Q Consensus       161 ~  161 (600)
                      .
T Consensus        93 ~   93 (172)
T 1t5i_A           93 R   93 (172)
T ss_dssp             T
T ss_pred             H
T ss_conf             5


No 285
>>2him_A L-asparaginase 1; hydrolase; 1.82A {Escherichia coli} PDB: 2p2d_A 2p2n_A 2ocd_A (A:229-358)
Probab=43.27  E-value=19  Score=15.19  Aligned_cols=87  Identities=17%  Similarity=0.266  Sum_probs=50.9

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCH-------HHHHHHHHCCCCEEEECCCCCCCCCCCCEEEEC-CCCCCCCCCCC
Q ss_conf             8897898874202686899964887623-------455555417982799615447655567256523-78888643344
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGSTSY-------DALQYATNQGIDVIVIDHHQVKSEEIPAYALVN-PNRLDDLSGQG  207 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi~~~-------e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivN-P~~~~~~~p~~  207 (600)
                      |++.+.++.+.+.+++=||.--.|..+.       ++++.+.++|+-|+++-.-.-....+..+..-+ -.+.+.- +..
T Consensus        12 g~~~~~l~~~~~~~~~giVl~~~G~Gn~p~~~~~~~~l~~~~~~gi~vV~~Sq~~~G~v~~~~y~~g~~l~~~G~i-~~g   90 (130)
T 2him_A           12 GISADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMGGYATGNALAHAGVI-GGA   90 (130)
T ss_dssp             TCCHHHHHHHTSSSCSEEEEEEBTTTBCCCCHHHHHHHHHHHHTTCEEEEEESSSBCCCCCC-----CHHHHTTCE-ECT
T ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHCCEE-ECC
T ss_conf             9888999999865588899971365678730799999999971898799952589885075666556889869999-899


Q ss_pred             CHHHHHHHHHHHHHHH
Q ss_conf             3047889999999999
Q gi|254780901|r  208 HLCAAGVVFLVLVLIY  223 (600)
Q Consensus       208 ~l~gaGvaf~l~~al~  223 (600)
                      +++.--.--||+++|.
T Consensus        91 ~lt~e~A~~kL~~~l~  106 (130)
T 2him_A           91 DMTVEATLTKLHYLLS  106 (130)
T ss_dssp             TCCHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHC
T ss_conf             9899999999999984


No 286
>>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} (B:)
Probab=43.26  E-value=19  Score=15.19  Aligned_cols=12  Identities=17%  Similarity=0.354  Sum_probs=4.0

Q ss_pred             HHHHHHHHHCCC
Q ss_conf             999999997699
Q gi|254780901|r  110 ALMMRFLSHCSV  121 (600)
Q Consensus       110 ail~~~L~~~g~  121 (600)
                      .++.+.|+.+|.
T Consensus        16 ~~l~~~L~~~g~   27 (133)
T 2r25_B           16 EVIKRMLNLEGI   27 (133)
T ss_dssp             HHHHHHHHHTTC
T ss_pred             HHHHHHHHHCCC
T ss_conf             999999998699


No 287
>>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP- binding, ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* (A:)
Probab=43.16  E-value=19  Score=15.18  Aligned_cols=37  Identities=11%  Similarity=0.147  Sum_probs=25.7

Q ss_pred             CCEEEEECCCCCH-HHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             9799994078861-528999999999769947998078
Q gi|254780901|r   93 EKIMIFGDYDVDG-AASVALMMRFLSHCSVNANMYIPD  129 (600)
Q Consensus        93 ekI~I~gDyD~DG-itstail~~~L~~~g~~v~~~IP~  129 (600)
                      +.|.|.|--=-.| .|-++-|..+|.+.|.+|.++-++
T Consensus        27 kvI~v~s~kGGvGKTtia~~LA~~la~~g~~vl~id~D   64 (251)
T 3fgn_A           27 TILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPV   64 (251)
T ss_dssp             EEEEEEESSTTSCHHHHHHHHHHHHHHTTCCEEEEEEE
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             86899869999619999999999999689949997740


No 288
>>1mio_B Nitrogenase molybdenum iron protein (beta chain); HET: HCA CFM CLP; 3.00A {Clostridium pasteurianum} (B:310-418)
Probab=42.95  E-value=19  Score=15.16  Aligned_cols=84  Identities=14%  Similarity=0.237  Sum_probs=48.0

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEE-EECCCCCCCCCCCHHHH-HHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             79979999407886152899999999976994799-80787433668897898-87420268689996488762345555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM-YIPDRIVDGYGPNPSLM-EKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~-~IP~R~~eGYGl~~~~i-~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      .++|+.||||-|     =+.=+.++|+.+|.++.. .+++--.+    ..+.+ +.+.+.+..=.+.+|.+ .-.+-.+.
T Consensus         2 ~GKrv~i~gd~~-----~~~~l~~~l~ElGm~vv~~~~~~~~~~----~~~~~~~~l~~~~~~~~~vv~~~-d~~el~~~   71 (109)
T 1mio_B            2 QGKKVALLGDPD-----EIIALSKFIIELGAIPKYVVTGTPGMK----FQKEIDAMLAEAGIEGSKVKVEG-DFFDVHQW   71 (109)
T ss_dssp             TTCEEEEEECHH-----HHHHHHHHHHTTTCEEEEEEESSCCHH----HHHHHHHHHHTTTCCSCEEEESC-BHHHHHHH
T ss_pred             CCCEEEEECCCH-----HHHHHHHHHHHCCCEEEEEEECCCCHH----HHHHHHHHHHHCCCCCCEEEECC-CHHHHHHH
T ss_conf             798799988818-----899999999984990148872689777----78999999986589887899799-99999999


Q ss_pred             HHHCCCCEEEECCCCC
Q ss_conf             5417982799615447
Q gi|254780901|r  169 ATNQGIDVIVIDHHQV  184 (600)
Q Consensus       169 a~~~GidvIVtDHH~~  184 (600)
                      +++...|++|...|+-
T Consensus        72 i~~~~pDliig~s~~~   87 (109)
T 1mio_B           72 IKNEGVDLLISNTYGK   87 (109)
T ss_dssp             HHHSCCSEEEESGGGH
T ss_pred             HHHCCCCEEEECCHHH
T ss_conf             9744999999794589


No 289
>>2v6o_A Thioredoxin glutathione reductase; FAD, flavoprotein, oxidoreductase, chimeric enzyme, thiol-mediated detoxification pathway; HET: FAD PG4; 2.20A {Schistosoma mansoni} PDB: 3h4k_A* (A:1-106)
Probab=42.89  E-value=19  Score=15.15  Aligned_cols=49  Identities=8%  Similarity=0.187  Sum_probs=34.6

Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             14879999999999977997999940788615289999999997699479980
Q gi|254780901|r   75 LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI  127 (600)
Q Consensus        75 l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~I  127 (600)
                      |.+++.+.+.+.+.+. ..+|.||+   .++.--+.-..++|..+|....++-
T Consensus         1 ms~~~~~~~~i~~~~~-~~~vviy~---~~~Cp~C~~~~~lL~~~~v~~~~~d   49 (106)
T 2v6o_A            1 MPPADGTSQWLRKTVD-SAAVILFS---KTTCPYCKKVKDVLAEAKIKHATIE   49 (106)
T ss_dssp             -------CHHHHHHHH-HCSEEEEE---CSSCHHHHHHHHHHHHTTCCCEEEE
T ss_pred             CCCCCHHHHHHHHHCC-CCEEEEEE---CCCCCCCHHHHHHHHHHCCCCCCCE
T ss_conf             9786048999998527-86399997---7999996799999997425167531


No 290
>>1kid_A Groel (HSP60 class); chaperone, cell division, ATP-binding, phosphorylation; 1.70A {Escherichia coli} (A:)
Probab=42.84  E-value=19  Score=15.14  Aligned_cols=102  Identities=15%  Similarity=0.266  Sum_probs=60.1

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC-HHHHHHHHHCCCCE
Q ss_conf             61487999999999997799799994078861528999999999769947998078743366889-78988742026868
Q gi|254780901|r   74 ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN-PSLMEKFINEGAQL  152 (600)
Q Consensus        74 ~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~-~~~i~~~~~~g~~L  152 (600)
                      .+..++.-+-.+..+.+++.+.+|+.+ |+||-.-+.++.+-++-.-.-+....|     |||-. ++.+++++--.-.-
T Consensus        53 ki~~~~~ilp~Le~~~~~~~pLlIiAe-dv~~eaL~~Li~N~~~g~l~v~aVkaP-----g~G~~rk~~L~DiAi~TG~~  126 (203)
T 1kid_A           53 KISNIREMLPVLEAVAKAGKPLLIIAE-DVEGEALATLVVNTMRGIVKVAAVKAP-----GFGDRRKAMLQDIATLTGGT  126 (203)
T ss_dssp             EECCHHHHHHHHHHHHHHTCCEEEEES-EECHHHHHHHHHHHHTTSCCEEEEECC-----SCHHHHHHHHHHHHHHHTCC
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEEC-CCCHHHHHHHHHHHHCCCCCEEEECCC-----CCCHHHHHHHHHHHHHHCCE
T ss_conf             547887879999999964994899966-215889999986431267423563288-----87766899999999983999


Q ss_pred             EEEECCCCCCHHHHHHHHHCCC--CEEEECCCC
Q ss_conf             9996488762345555541798--279961544
Q gi|254780901|r  153 IITVDCGSTSYDALQYATNQGI--DVIVIDHHQ  183 (600)
Q Consensus       153 iItvD~Gi~~~e~i~~a~~~Gi--dvIVtDHH~  183 (600)
                      +|..|.|.+-.+.  ....+|-  .|+||-++.
T Consensus       127 vi~~~~g~~l~~~--~~~~LG~a~~v~vtkd~T  157 (203)
T 1kid_A          127 VISEEIGMELEKA--TLEDLGQAKRVVINKDTT  157 (203)
T ss_dssp             CBCGGGTCCGGGC--CGGGCEEEEEEEECSSCE
T ss_pred             EECHHCCCCCCCC--CHHHCCEEEEEEECCCCE
T ss_conf             8753207762328--887888022899827855


No 291
>>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HUPR1; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B (A:)
Probab=42.71  E-value=19  Score=15.13  Aligned_cols=46  Identities=11%  Similarity=0.180  Sum_probs=33.7

Q ss_pred             CHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             97898874202686899964887623455555417982799615447655
Q gi|254780901|r  138 NPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE  187 (600)
Q Consensus       138 ~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~  187 (600)
                      +...+..+.+.|+.++.. .   +..++++.+.+...|+|++|-+.|...
T Consensus        13 ~~~~l~~~l~~g~~v~~a-~---~~~~al~~l~~~~~dlillD~~lP~~~   58 (139)
T 2jk1_A           13 SLAAMKLALEDDFDVLTA-Q---GAEAAIAILEEEWVQVIICDQRMPGRT   58 (139)
T ss_dssp             HHHHHHHHHTTTSCEEEE-S---SHHHHHHHHHHSCEEEEEEESCCSSSC
T ss_pred             HHHHHHHHHHCCCEEEEE-C---CHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             999999999879999996-5---499999999837898899634454243


No 292
>>2rjo_A Twin-arginine translocation pathway signal protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: GAL; 2.05A {Burkholderia phytofirmans psjn} (A:1-117,A:253-287)
Probab=42.32  E-value=19  Score=15.09  Aligned_cols=119  Identities=8%  Similarity=-0.055  Sum_probs=67.5

Q ss_pred             CCCEEEEECCCCCHHHHHHH--HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC--H-HHH
Q ss_conf             99799994078861528999--999999769947998078743366889789887420268689996488762--3-455
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVAL--MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS--Y-DAL  166 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstai--l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~--~-e~i  166 (600)
                      ...|.+.-..--+...+..+  +...++..|.++..+..+.-.+   --...++.+.+.+++-||.+-.-..+  . +.+
T Consensus         5 s~~Igviip~~~n~~~~~ii~gi~~~a~~~Gy~lii~~~~~d~~---~~~~~i~~l~~~~vDGIIi~~~~~~~~~~~~~i   81 (152)
T 2rjo_A            5 QTTLACSFRSLTNPYYTAFNKGAQSFAKSVGLPYVPLTTEGSSE---KGIADIRALLQKTGGNLVLNVDPNDSADARVIV   81 (152)
T ss_dssp             CCEEEEEESCTTSHHHHHHHHHHHHHHHHHTCCEEEEECTTCHH---HHHHHHHHHHHHTTTCEEEEECCSSHHHHHHHH
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHH
T ss_conf             96899994888888999999999999997299899993899999---999999999965999899983664210014778


Q ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCEEEECCCC--CCCCCCCCCHHHHHHHHHH
Q ss_conf             555417982799615447655567256523788--8864334430478899999
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQVKSEEIPAYALVNPNR--LDDLSGQGHLCAAGVVFLV  218 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~--~~~~~p~~~l~gaGvaf~l  218 (600)
                      +.+++.|+-||+.|-..++...+    .|.+..  ..-.-|| -|-|.|+..-|
T Consensus        82 ~~l~~~gIPvV~id~~~~~~~~~----~V~~Dn~~g~~~A~~-~~~~~~~~~~~  130 (152)
T 2rjo_A           82 EACSKAGAYVTTIWNKPKDLHPW----DYNPNYVAHLSYDPF-WLGGIGLSXGL  130 (152)
T ss_dssp             HHHHHHTCEEEEESCCCTTCCGG----GGTTTEEEEEECCHH-HHHHHHHHHHH
T ss_pred             HHHHHCCCEEEEECCCCCCCCCC----CCCCCCEEEEECCHH-HHHHHHHHHHH
T ss_conf             89997398789841556543222----357872146603299-99999999999


No 293
>>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural genomics consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} (A:246-384)
Probab=42.29  E-value=19  Score=15.08  Aligned_cols=76  Identities=13%  Similarity=0.187  Sum_probs=53.2

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             87999999999997799799994078861528999999999769947998078743366889789887420268689996
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      +...+...+.+....+++++||    |.-...+--+++.|+..+..+..+-..--.+   --.+.++.+.+...+++||.
T Consensus        16 ~k~~~l~~~l~~~~~~~k~iIF----~~t~~~~~~l~~~l~~~~~~~~~~h~~~~~~---~R~~~~~~f~~~~~~ilv~t   88 (139)
T 2i4i_A           16 DKRSFLLDLLNATGKDSLTLVF----VETKKGADSLEDFLYHEGYACTSIHGDRSQR---DREEALHQFRSGKSPILVAT   88 (139)
T ss_dssp             GHHHHHHHHHHTCCTTCEEEEE----CSSHHHHHHHHHHHHHTTCCEEEECTTSCHH---HHHHHHHHHHHTSSCEEEEC
T ss_pred             CCHHHHCCCCCCCCCCCCEEEE----EECCCHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHCCCCCCEEEEC
T ss_conf             2001101222112356630477----6303107899999986897699972765599---99999874036885056741


Q ss_pred             CCC
Q ss_conf             488
Q gi|254780901|r  157 DCG  159 (600)
Q Consensus       157 D~G  159 (600)
                      |+.
T Consensus        89 ~~~   91 (139)
T 2i4i_A           89 AVA   91 (139)
T ss_dssp             HHH
T ss_pred             CHH
T ss_conf             054


No 294
>>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S beta lyase; HET: PLP; 2.00A {Thermotoga maritima} (A:61-222)
Probab=42.18  E-value=19  Score=15.07  Aligned_cols=103  Identities=10%  Similarity=0.085  Sum_probs=68.3

Q ss_pred             CCCHHHHHHHHHHHHH----CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             1487999999999997----799799994078861528999999999769947998078743366889789887420268
Q gi|254780901|r   75 LTDCDKAARRIVQAIY----NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA  150 (600)
Q Consensus        75 l~dm~~A~~ri~~ai~----~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~  150 (600)
                      -.+-..|...+..++.    .+..+.+...   +...+..-........|.++...-+   .+.+.+..+.++.+....+
T Consensus         7 t~g~T~a~~~~~~~~~~~~~~~~~vv~~~~---~~~~~~~~~~~~~~~~g~~~~~~~~---~~~~~~~~~~~~~~i~~~t   80 (162)
T 1eg5_A            7 TSCATESINWILKTVAETFEKRKRTIITTP---IEHKAVLETXKYLSXKGFKVKYVPV---DSRGVVKLEELEKLVDEDT   80 (162)
T ss_dssp             ESCHHHHHHHHHHHHHHHTTTTCCEEEECT---TSCHHHHHHHHHHHHTTCEEEECCB---CTTSCBCHHHHHHHCCTTE
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCEEEECC---CCCHHHHHHHHHHHHCCCEEEEECC---CCCCCCCHHHHHHHCCCCC
T ss_conf             199899999999999986158999899889---8527799999999864988999703---9988758999985336795


Q ss_pred             CEEEEECCC-----CCCHHHHH-HHHHCCCCEEEECCCC
Q ss_conf             689996488-----76234555-5541798279961544
Q gi|254780901|r  151 QLIITVDCG-----STSYDALQ-YATNQGIDVIVIDHHQ  183 (600)
Q Consensus       151 ~LiItvD~G-----i~~~e~i~-~a~~~GidvIVtDHH~  183 (600)
                      ++++..-..     +.+.++|. .+++.|..+++-+-|.
T Consensus        81 ~~v~~~~~~n~tG~~~~i~ei~~i~~~~~~~~~~d~~~~  119 (162)
T 1eg5_A           81 FLVSIXAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAV  119 (162)
T ss_dssp             EEEEEESBCTTTCBBCCHHHHHHHHHHHCTTCEEEEECT
T ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCC
T ss_conf             699997764788850101379999997299499993231


No 295
>>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} (A:137-268)
Probab=42.13  E-value=19  Score=15.07  Aligned_cols=76  Identities=11%  Similarity=0.135  Sum_probs=44.1

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             97799799994078861528999999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ++.+++++|+|   +.|-.+.+. ..+++..|++|.....         +.+-.+.+.+.+.+.++..... ...+.+..
T Consensus         2 ik~Gd~VlI~G---a~G~vG~~a-~q~a~~~G~~vi~~~~---------~~~~~~~~~~~ga~~~~~~~~~-~~~~~i~~   67 (132)
T 1qor_A            2 IKPDEQFLFHA---AAGGVGLIA-CQWAKALGAKLIGTVG---------TAQKAQSALKAGAWQVINYREE-DLVERLKE   67 (132)
T ss_dssp             CCTTCEEEESS---TTBHHHHHH-HHHHHHHTCEEEEEES---------SHHHHHHHHHHTCSEEEETTTS-CHHHHHHH
T ss_pred             CCCCCEEEEEC---CCCHHHHHH-HHHHHHCCCEEEEECC---------CHHHHHHHHHCCCCEEEECCCC-CHHHHHHH
T ss_conf             89989999989---953999999-9999985998999747---------3778999997699899979998-99999999


Q ss_pred             H-HHCCCCEEE
Q ss_conf             5-417982799
Q gi|254780901|r  169 A-TNQGIDVIV  178 (600)
Q Consensus       169 a-~~~GidvIV  178 (600)
                      . ...|+|+++
T Consensus        68 ~~~~~g~d~v~   78 (132)
T 1qor_A           68 ITGGKKVRVVY   78 (132)
T ss_dssp             HTTTCCEEEEE
T ss_pred             HHCCCCCEEEE
T ss_conf             74899737999


No 296
>>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} (A:1-65)
Probab=42.13  E-value=19  Score=15.07  Aligned_cols=43  Identities=28%  Similarity=0.332  Sum_probs=23.9

Q ss_pred             CHHHHHHHHHC-CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             97898874202-686899964887623455555417982799615447
Q gi|254780901|r  138 NPSLMEKFINE-GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       138 ~~~~i~~~~~~-g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      +...+..+.+. |+. ++++++|   .++++.+++...|+|++|-+.|
T Consensus        22 ~~~~~~~~L~~~G~~-v~~a~~g---~~al~~l~~~~~dlil~Di~MP   65 (65)
T 3c97_A           22 CRLVAAKALEKCTND-ITVVTNG---LQALQAYQNRQFDVIIMDIQMP   65 (65)
T ss_dssp             HHHHHHHHHTTTCSE-EEEESSH---HHHHHHHHHSCCSEEEECTTCC
T ss_pred             HHHHHHHHHHHCCCE-EEEECCH---HHHHHHHHHCCCCEEEEEECCC
T ss_conf             999999999987999-9998999---9999999838998898630489


No 297
>>1bjt_A Topoisomerase II; quaternary change, DNA-binding, DNA topology; 2.50A {Saccharomyces cerevisiae} (A:1-153,A:197-245)
Probab=41.88  E-value=19  Score=15.20  Aligned_cols=14  Identities=43%  Similarity=0.646  Sum_probs=4.9

Q ss_pred             EEEEECCCCCHHHH
Q ss_conf             99994078861528
Q gi|254780901|r   95 IMIFGDYDVDGAAS  108 (600)
Q Consensus        95 I~I~gDyD~DGits  108 (600)
                      |+|..|-|+||.-=
T Consensus       113 IiImTDADvDGsHI  126 (202)
T 1bjt_A          113 LMIMTDQDHDGSHI  126 (202)
T ss_dssp             EEEEEC-----CCH
T ss_pred             EEEEECCCCCCHHH
T ss_conf             79998898884269


No 298
>>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii DSM2661} (A:1-128)
Probab=41.85  E-value=19  Score=15.04  Aligned_cols=87  Identities=16%  Similarity=0.178  Sum_probs=53.9

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCCCH-HHHHHHHH-CCCCEEEEECCCCCCHHHH
Q ss_conf             779979999407886152899999999976994799807874-33668897-89887420-2686899964887623455
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI-VDGYGPNP-SLMEKFIN-EGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~-~eGYGl~~-~~i~~~~~-~g~~LiItvD~Gi~~~e~i  166 (600)
                      .+.-+|.|.|   +.|..+...+....+.-+.++...-|.+. .+-+|+.. ..++++.+ ..+++++.+--.....+.+
T Consensus        11 ~~~irv~iiG---~gg~~g~~~~~~l~~~~~~~i~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~d~V~i~~~~~~h~~~~   87 (128)
T 2yv1_A           11 DENTKAIVQG---ITGRQGSFHTKKMLECGTKIVGGVTPGKGGQNVHGVPVFDTVKEAVKETDANASVIFVPAPFAKDAV   87 (128)
T ss_dssp             CTTCCEEEET---TTSHHHHHHHHHHHHTTCCEEEEECTTCTTCEETTEEEESSHHHHHHHHCCCEEEECCCHHHHHHHH
T ss_pred             CCCCEEEEEC---CCCCHHHHHHHHHHHHCCCEEEEECCCCCCCEEECCCCCCCHHHHCCCCCCCEEEEEECCCCCHHHH
T ss_conf             5998599989---9884768999999981997788777998864773812557456620555663699960355460579


Q ss_pred             HHHHHCCCCEEEE
Q ss_conf             5554179827996
Q gi|254780901|r  167 QYATNQGIDVIVI  179 (600)
Q Consensus       167 ~~a~~~GidvIVt  179 (600)
                      ..+.+.|+.|+|-
T Consensus        88 ~~~~~~G~~v~ve  100 (128)
T 2yv1_A           88 FEAIDAGIELIVV  100 (128)
T ss_dssp             HHHHHTTCSEEEE
T ss_pred             HHHHHCCCCEEEE
T ss_conf             9998658877874


No 299
>>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} (A:1-108,A:240-290)
Probab=41.80  E-value=20  Score=15.03  Aligned_cols=89  Identities=9%  Similarity=-0.022  Sum_probs=56.0

Q ss_pred             CCEEEE-ECCCCCHHHH-HHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             979999-4078861528-99999999976994799807874336688978988742026868999648876234555554
Q gi|254780901|r   93 EKIMIF-GDYDVDGAAS-VALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYAT  170 (600)
Q Consensus        93 ekI~I~-gDyD~DGits-tail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~  170 (600)
                      ..|.+. .+.+-.-..+ ..-+.++++..|..+...-+.+.+  .......++.+.+.+++-+|.+.+. .+-+.++.+.
T Consensus         9 ~~IGVIip~l~npf~~~il~gIe~aa~~~Gy~lil~~s~~~d--~e~q~~~i~~li~~~vDGIIi~~~~-~~~~~i~~l~   85 (159)
T 3clk_A            9 NVIAAVVSSVRTNFAQQILDGIQEEAHKNGYNLIIVYSGSAD--PEEQKHALLTAIERPVXGILLLSIA-LTDDNLQLLQ   85 (159)
T ss_dssp             CEEEEECCCCSSSHHHHHHHHHHHHHHTTTCEEEEEC------------CHHHHHHSSCCSEEEEESCC-----CHHHHH
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCC--HHHHHHHHHHHHHCCCCEEEEEHHH-HHHHHHHHHH
T ss_conf             989999099976899999999999999869989999689999--9999999999985695467520000-1356899987


Q ss_pred             HCCCCEEEECCCCC
Q ss_conf             17982799615447
Q gi|254780901|r  171 NQGIDVIVIDHHQV  184 (600)
Q Consensus       171 ~~GidvIVtDHH~~  184 (600)
                      +.|+.+++.|.-..
T Consensus        86 ~~gIPvVlid~~~~   99 (159)
T 3clk_A           86 SSDVPYCFLSXGFD   99 (159)
T ss_dssp             CC--CEEEESCC--
T ss_pred             HHCCCCCCCCCCCC
T ss_conf             41021112454334


No 300
>>2d6f_A Glutamyl-tRNA(Gln) amidotransferase subunit D; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} (A:301-435)
Probab=41.76  E-value=20  Score=15.03  Aligned_cols=87  Identities=11%  Similarity=0.127  Sum_probs=51.4

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCC-----HHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEEC-CCCCCCCCCCCCH
Q ss_conf             889789887420268689996488762-----3455555417982799615447655567256523-7888864334430
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGSTS-----YDALQYATNQGIDVIVIDHHQVKSEEIPAYALVN-PNRLDDLSGQGHL  209 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi~~-----~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivN-P~~~~~~~p~~~l  209 (600)
                      |++...++.+.+.+++=||..-.|..+     .++++.|.++|+-|+++-.-.-....+..+..=+ -...+.- +-.++
T Consensus        12 g~~~~~l~~~~~~~~~GiVl~~~G~Gn~p~~~~~~l~~a~~~gi~VV~~Sqc~~G~v~~~~y~~g~~l~~~G~I-~~g~l   90 (135)
T 2d6f_A           12 GISPDIIKWHLDEGYRGIVIEGTGLGHCPDTLIPVIGEAHDMGVPVAMTSQCLNGRVNMNVYSTGRRLLQAGVI-PCDDM   90 (135)
T ss_dssp             TCCHHHHHHHHHTTCSEEEEEEBTTTBCCGGGHHHHHHHHHTTCCEEEEETTCBSCCCTTSSHHHHHHHHTTCE-ECTTC
T ss_pred             CCCHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHCCEE-ECCCC
T ss_conf             99989999987511354899976577404999999999997899899971589886477756226778759989-89998


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             47889999999999
Q gi|254780901|r  210 CAAGVVFLVLVLIY  223 (600)
Q Consensus       210 ~gaGvaf~l~~al~  223 (600)
                      +..-.--||+++|.
T Consensus        91 t~e~A~~kL~~~L~  104 (135)
T 2d6f_A           91 LPEVAYVKMCWVLG  104 (135)
T ss_dssp             CHHHHHHHHHHHTT
T ss_pred             CHHHHHHHHHHHHC
T ss_conf             99999999999981


No 301
>>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} (A:1-114,A:252-303)
Probab=41.71  E-value=20  Score=15.02  Aligned_cols=69  Identities=12%  Similarity=-0.002  Sum_probs=46.8

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             9999997699479980787433668897898874202686899964887623455555417982799615447
Q gi|254780901|r  112 MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       112 l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      +.+.++..|..+..+..+...+   -....++.+...+++=+|.+.. ....+.++.+++.|+-++..|....
T Consensus        37 i~~~a~~~g~~~~l~~~~~~~~---~~~~~i~~l~~~~vDGiIi~~~-~~~~~~~~~l~~~~iPvV~id~~~~  105 (166)
T 3kke_A           37 VQMAASGHSTDVLLGQIDAPPR---GTQQLSRLVSEGRVDGVLLQRR-EDFDDDMLAAVLEGVPAVTINSRVP  105 (166)
T ss_dssp             HHHHHHHTTCCEEEEECCSTTH---HHHHHHHHHHSCSSSEEEECCC-TTCCHHHHHHHHTTSCEEEESCCCT
T ss_pred             HHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEECCC-CCCHHHHHHHHHCCCCEEEECCCCC
T ss_conf             9999997699899996899979---9999999999589788983245-6875999999975998898168788


No 302
>>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} (A:)
Probab=41.16  E-value=20  Score=14.96  Aligned_cols=43  Identities=14%  Similarity=0.320  Sum_probs=23.2

Q ss_pred             CCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             68897898874202686899964887623455555417982799
Q gi|254780901|r  135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIV  178 (600)
Q Consensus       135 YGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIV  178 (600)
                      -|.+...+..+.+. ++.-|.+|=||.+.+.+..+.+.|.|-++
T Consensus       183 ~~~~~~~~~~v~~~-~~ipvia~GGI~~~~Di~~~~~~GadgV~  225 (253)
T 1h5y_A          183 LGYDVELIRRVADS-VRIPVIASGGAGRVEHFYEAAAAGADAVL  225 (253)
T ss_dssp             SCCCHHHHHHHHHH-CSSCEEEESCCCSHHHHHHHHHTTCSEEE
T ss_pred             CCCCHHHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHCCCCEEE
T ss_conf             88578999999864-89889998788999999999878991777


No 303
>>1g8m_A Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} (A:398-593)
Probab=41.09  E-value=20  Score=14.95  Aligned_cols=48  Identities=17%  Similarity=0.265  Sum_probs=36.5

Q ss_pred             CCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             366889789887420268689996488762345555541798279961
Q gi|254780901|r  133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       133 eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtD  180 (600)
                      |++=+=...|+.+.+.|++-||-.--.+.+.|-|+.|+++||-.+-|-
T Consensus       143 DaFFPF~D~i~~a~~~Gv~aiiqPGGS~rD~~vi~a~~~~gi~m~ftg  190 (196)
T 1g8m_A          143 DAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTN  190 (196)
T ss_dssp             SSCCSSTHHHHHHHTTTEEEEEEECCCTTHHHHHHHHHHHTCEEEEES
T ss_pred             CCCCCCCHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHCCEEEECC
T ss_conf             147787548999998399099879874366999999997298899868


No 304
>>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1} (A:)
Probab=40.97  E-value=20  Score=14.94  Aligned_cols=76  Identities=11%  Similarity=0.076  Sum_probs=39.9

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC-HHHHHHHHHCCCCEEEEE
Q ss_conf             7999999999997799799994078861528999999999769947998078743366889-789887420268689996
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN-PSLMEKFINEGAQLIITV  156 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~-~~~i~~~~~~g~~LiItv  156 (600)
                      |+.+++.......++.+|+|..+.==|--+-..++...|+..|.++...       +.|-+ .+++..+.+..+++|| +
T Consensus         4 l~~~~~~~~~~~~~~~rILiV~~~iDD~~~~~~~l~~~L~~~g~~v~~~-------~~~~~~~~~~~~~~~~~~Dlvl-l   75 (161)
T 2yxb_A            4 LQSTRERVLGTPRRRYKVLVAKXGLDGHDRGAKVVARALRDAGFEVVYT-------GLRQTPEQVAXAAVQEDVDVIG-V   75 (161)
T ss_dssp             ------------CCSCEEEEEEESSSSCCHHHHHHHHHHHHTTCEEECC-------CSBCCHHHHHHHHHHTTCSEEE-E
T ss_pred             HHHHHHHHCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEC-------CCCCCHHHHHHHHHHCCCCEEE-E
T ss_conf             7888987334898898799983288702688999999999789879978-------9875999999999865996899-8


Q ss_pred             CCCCC
Q ss_conf             48876
Q gi|254780901|r  157 DCGST  161 (600)
Q Consensus       157 D~Gi~  161 (600)
                      |-...
T Consensus        76 D~~mP   80 (161)
T 2yxb_A           76 SILNG   80 (161)
T ss_dssp             EESSS
T ss_pred             ECCCC
T ss_conf             63654


No 305
>>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} (A:1-100,A:298-333)
Probab=40.94  E-value=20  Score=14.94  Aligned_cols=69  Identities=16%  Similarity=0.211  Sum_probs=40.0

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHH
Q ss_conf             88978988742026868999648876234555554179827996154476555672565237888864334430478899
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVV  215 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGva  215 (600)
                      .++.+.++.+...+.++|.++--|..+++ +++|+++||.|.                  |  -++  |.+.+-+--.+.
T Consensus        55 ~i~~ell~~l~~p~LK~Is~~gvG~DnID-v~aa~erGI~V~------------------N--vPg--~~~~~~~~~~~~  111 (136)
T 1dxy_A           55 PYAAGVFEKMHAYGIKFLTIRNVGTDNID-MTAMKQYGIRLS------------------N--VPA--YYYTETAVHNMV  111 (136)
T ss_dssp             CBCHHHHHHHHHTTCCEEEESSSCCTTBC-HHHHHHTTCEEE------------------C--CTT--STCSHHHHHHHH
T ss_pred             CCCHHHHHHCCCCCCEEEEECCCCCCHHH-HHHHHHCCCEEE------------------E--CCC--CCCHHHHHHHHH
T ss_conf             88999997376479879999886445215-999997899999------------------8--998--509699999999


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999999702
Q gi|254780901|r  216 FLVLVLIYRILR  227 (600)
Q Consensus       216 f~l~~al~~~l~  227 (600)
                      |+-++.|...|.
T Consensus       112 ~~~~~~~~~~~~  123 (136)
T 1dxy_A          112 YFSLQHLVDFLT  123 (136)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999981


No 306
>>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reductase; structural genomics, protein structure initiative; 2.19A {Arabidopsis thaliana} (A:1-162,A:331-359)
Probab=40.86  E-value=20  Score=14.93  Aligned_cols=86  Identities=8%  Similarity=0.077  Sum_probs=52.1

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC------------CCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             9779979999407886152899999999976994799807874------------3366889789887420268689996
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI------------VDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~------------~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      ..+.-||.|.|   +-|.++..++...+..-..++.+..-.|.            ..+.-+.....+.....++++++.+
T Consensus        13 ~~~~~kV~ViG---ATG~vG~eL~~lL~~hp~~ei~~l~s~~~aGk~~~~~~~~l~~~~~~~~~~~~~~~~~~~DvVf~a   89 (191)
T 1xyg_A           13 PEKDIRIGLLG---ASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCC   89 (191)
T ss_dssp             --CCEEEEEEC---CSSHHHHHHHHHHHTCSSEEEEEEBCSTTTTSCHHHHCGGGTTSCCCCCBCGGGCCGGGCSEEEEC
T ss_pred             CCCCCEEEEEC---CCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCCHHHHCCCCCCCCCCEEECCCHHHHHCCCEEEEE
T ss_conf             89987799999---671999999999974998589999974888968889582203885540303646565147889971


Q ss_pred             CCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             4887623455555417982799
Q gi|254780901|r  157 DCGSTSYDALQYATNQGIDVIV  178 (600)
Q Consensus       157 D~Gi~~~e~i~~a~~~GidvIV  178 (600)
                       .+...-.......+.|..||-
T Consensus        90 -l~~~~s~~~~~~~~~g~~VID  110 (191)
T 1xyg_A           90 -LPHGTTQEIIKELPTALKIVD  110 (191)
T ss_dssp             -CCTTTHHHHHHTSCTTCEEEE
T ss_pred             -CCCCHHHHHHHHHHHHCCCCC
T ss_conf             -575369999999875304444


No 307
>>1wls_A L-asparaginase; structural genomics, hydrolase; 2.16A {Pyrococcus horikoshii} PDB: 1wnf_A (A:199-328)
Probab=40.74  E-value=20  Score=14.91  Aligned_cols=87  Identities=10%  Similarity=0.127  Sum_probs=49.9

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCH-------HHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             8897898874202686899964887623-------455555417982799615447655567256523788886433443
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGSTSY-------DALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGH  208 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi~~~-------e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~  208 (600)
                      |++.+.++.+.+.+++=||.--.|..+.       +++..+.+.|+-|+++-.-.-....+..++.-..-....-.+-.+
T Consensus        12 g~~~~~~~~~~~~~~~GiVi~g~G~Gn~p~~~~~~~~l~~~~~~gi~vv~~Sq~~~G~~~~~~y~~g~~l~~~G~i~~gd   91 (130)
T 1wls_A           12 GLSGDIVREALRLGYKGIILEGYGVGGIPYRGTDLFEVVSSISKRIPVVLTTQAIYDGVDLQRYKVGRIALEAGVIPAGD   91 (130)
T ss_dssp             TCCTHHHHHHHHTTCSEEEEEESSSCCCCCSSSSHHHHHHHHTTTSCEEEEESSSBSCCCTTTBHHHHHHHHTTCEECTT
T ss_pred             CCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCHHHHHHHCCEEECCC
T ss_conf             96599999998679988999826798898530134667887625932787410367984755542034675199898899


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             04788999999999
Q gi|254780901|r  209 LCAAGVVFLVLVLI  222 (600)
Q Consensus       209 l~gaGvaf~l~~al  222 (600)
                      ++.--.--||+++|
T Consensus        92 lt~e~A~~kL~~~L  105 (130)
T 1wls_A           92 XTKEATITKLXWIL  105 (130)
T ss_dssp             CCHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             89999999999997


No 308
>>2zjt_A DNA gyrase subunit B; GYRB-CTD, toprim, tail, DNA topoisomerase II, G- segment, T-segment, ATP-binding, nucleotide-binding; HET: DNA; 2.80A {Mycobacterium tuberculosis} (A:1-125,A:181-247)
Probab=40.70  E-value=20  Score=14.91  Aligned_cols=28  Identities=32%  Similarity=0.516  Sum_probs=21.2

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             9979999407886152899999999976
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHC  119 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~  119 (600)
                      =.||.|..|-|+||.--..+|..|+-++
T Consensus        83 Y~kIiImTDADvDG~HIr~LLltfF~r~  110 (192)
T 2zjt_A           83 YHKIVLMADADVDGQHISTLLLTLLFRF  110 (192)
T ss_dssp             CSEEEEECCSSSTTCTTHHHHHHHHHTT
T ss_pred             CCEEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             4528999556534122556689998732


No 309
>>2z0f_A Putative phosphoglucomutase; isomerase, magnesium, metal-binding, structural genomics, NPPSFA; 2.52A {Thermus thermophilus HB8} (A:189-421)
Probab=40.54  E-value=20  Score=14.89  Aligned_cols=32  Identities=16%  Similarity=0.178  Sum_probs=14.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             26868999648876234555554179827996
Q gi|254780901|r  148 EGAQLIITVDCGSTSYDALQYATNQGIDVIVI  179 (600)
Q Consensus       148 ~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVt  179 (600)
                      .+.++++.+-+|++..-.-..+.++|.+|+.+
T Consensus        21 ~~lkIvvD~~~G~~~~~~~~il~~lg~~v~~i   52 (233)
T 2z0f_A           21 SGLRIGVDPLGGASLRVWERLAESHGLPLEVV   52 (233)
T ss_dssp             SCCCEEEECTTSTTHHHHHHHHHHHTCCEEEC
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHCCCCCEE
T ss_conf             68569872367633103566676524543123


No 310
>>1uuy_A CNX1, molybdopterin biosynthesis CNX1; chelatase, molybdenum cofactor biosynthesis; HET: MTE AMP; 1.45A {Arabidopsis thaliana} (A:)
Probab=40.47  E-value=20  Score=14.88  Aligned_cols=51  Identities=16%  Similarity=0.247  Sum_probs=30.5

Q ss_pred             CCCHHH-HHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHHHHHHHH-CCCCEEEEE
Q ss_conf             886152-8999999999769947998--078743366889789887420-268689996
Q gi|254780901|r  102 DVDGAA-SVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSLMEKFIN-EGAQLIITV  156 (600)
Q Consensus       102 D~DGit-stail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~i~~~~~-~g~~LiItv  156 (600)
                      |..|-. .+.++..+|+..|.++..+  +|+...+    -.++++++.+ .++++|||.
T Consensus        24 d~~g~~~ns~ll~~~l~~~G~~~~~~~iv~Dd~~~----i~~~i~~~~~~~~~Dlvitt   78 (167)
T 1uuy_A           24 DRSGPRAVSVVDSSSEKLGGAKVVATAVVPDEVER----IKDILQKWSDVDEMDLILTL   78 (167)
T ss_dssp             CSHHHHHHHHHHHTTTTTTSEEEEEEEEECSCHHH----HHHHHHHHHHTSCCSEEEEE
T ss_pred             CCCHHHHHHHHHHHCCCCCCCEEEEEEEECCCHHH----HHHHHHHHHHHCCCCEEEEE
T ss_conf             87589999999971310379779887776786999----99999988775154256610


No 311
>>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} (A:)
Probab=40.46  E-value=20  Score=14.88  Aligned_cols=33  Identities=18%  Similarity=0.421  Sum_probs=26.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             686899964887623455555417982799615
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDH  181 (600)
                      +..+|+.|.+|..+..+...++++|.+|-+.+-
T Consensus        56 ~~~iv~~c~~g~rs~~aa~~l~~~G~~v~~l~G   88 (100)
T 3foj_A           56 NETYYIICKAGGRSAQVVQYLEQNGVNAVNVEG   88 (100)
T ss_dssp             TSEEEEECSSSHHHHHHHHHHHTTTCEEEEETT
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEECC
T ss_conf             862999879986999999999985998799778


No 312
>>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} (D:)
Probab=40.42  E-value=20  Score=14.88  Aligned_cols=70  Identities=13%  Similarity=0.036  Sum_probs=37.0

Q ss_pred             HHHHHHHHHHHCCCCEEEE-ECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             8999999999769947998-0787433668897898874202686899964887623455555417982799
Q gi|254780901|r  108 SVALMMRFLSHCSVNANMY-IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIV  178 (600)
Q Consensus       108 stail~~~L~~~g~~v~~~-IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIV  178 (600)
                      ....+.+.+...+.....+ -..+....-+.+.+.+..+.+. .++-|.+|-||.+.+.+..+.+.|.|-+.
T Consensus       152 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~ia~~-~~~pvi~~GGI~s~~di~~~l~~GAd~V~  222 (253)
T 1thf_D          152 LLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPL-TTLPIIASGGAGKMEHFLEAFLAGADAAL  222 (253)
T ss_dssp             EHHHHHHHHHHTTCSEEEEEETTTTTSCSCCCHHHHHHHGGG-CCSCEEEESCCCSHHHHHHHHHTTCSEEE
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCCCC-CCCCEEEECCCCCHHHHHHHHHCCCCEEE
T ss_conf             388999999755598799997533576677541111010245-46718984488999999999977998999


No 313
>>2vw9_A Single-stranded DNA binding protein; DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, OB-fold; 2.30A {Helicobacter pylori} (A:)
Probab=40.25  E-value=21  Score=14.86  Aligned_cols=55  Identities=15%  Similarity=0.222  Sum_probs=38.3

Q ss_pred             EEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCC-----CEEEEEEEEEEECCCCC
Q ss_conf             7999997787870123553069987999999766545781-----10589999801113112
Q gi|254780901|r  540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGS-----KRCQLRVLDASPVEGHH  596 (600)
Q Consensus       540 ~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~-----~s~QL~I~Di~p~e~~~  596 (600)
                      .+.+++|+-....+.+  ....|..+-|.++++.+.|.++     .++++.+.+|...+...
T Consensus        50 ~~~v~~~g~~A~~~~~--~l~KG~~V~V~G~l~~~~~~~k~G~~~~~~~i~a~~i~~l~~~~  109 (134)
T 2vw9_A           50 FIDARLFGRTAEIANQ--YLSKGSSVLIEGRLTYESWMDQTGKKNSRHTITADSLQFMDKKS  109 (134)
T ss_dssp             EEEEEEEHHHHHHHHH--HCCTTCEEEEEEEEEEEEEECTTSCEEEEEEEEEEEEEECCCC-
T ss_pred             EEEEEEEEEHHHHHHH--HHCCCEEEEEEEEEEEEEEECCCCCEEEEEEEEEEEEEECCCCC
T ss_conf             8874773002334446--42266299999864045787689968999999997999745777


No 314
>>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* (A:1-116,A:250-289)
Probab=40.17  E-value=21  Score=14.85  Aligned_cols=127  Identities=7%  Similarity=0.050  Sum_probs=70.9

Q ss_pred             HHHHHHHCCC--CEEEEECCCCCHHHHHHH--HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             9999997799--799994078861528999--999999769947998078743366889789887420268689996488
Q gi|254780901|r   84 RIVQAIYNSE--KIMIFGDYDVDGAASVAL--MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        84 ri~~ai~~~e--kI~I~gDyD~DGitstai--l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      .+.+++..++  .|.+.-+.=.+...+..+  +..++...|..+..+-.+...+   .....++.+...+++-+|..  +
T Consensus         6 ~~ArsL~~~~s~~Igvi~~~~~~~~~~~i~~~i~~~~~~~g~~~~i~~~~~~~~---~~~~~i~~~~~~~vdGiIi~--~   80 (156)
T 2fep_A            6 HHHHHGSSKKTTTVGVIIPDISSIFYSELARGIEDIATMYKYNIILSNSDQNME---KELHLLNTMLGKQVDGIVFM--G   80 (156)
T ss_dssp             ----------CCEEEEEESCTTSHHHHHHHHHHHHHHHHTTCEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEEC--C
T ss_pred             CCCCCCCCHHHCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHH---HHHHHHHHHHHCCCCCCEEE--C
T ss_conf             677898362359999996888798999999999999998699899997899979---99999999985598740110--0


Q ss_pred             C-CCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             7-62345555541798279961544765556725652378888643344304788999999999997021488
Q gi|254780901|r  160 S-TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNK  231 (600)
Q Consensus       160 i-~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~  231 (600)
                      . ...+.++.+.+.|+-|++.|-+......|    .|.+.            ...++..-+..|.+.+.....
T Consensus        81 ~~~~~~~~~~l~~~~iPvV~i~~~~~~~~~~----~V~~D------------~~~~g~~a~~~l~~~~~~~~~  137 (156)
T 2fep_A           81 GNITDEHVAEFKRSPVPIVLAASVEEQEETP----SVAID------------TYDIGAVAMRLLTKLMNKEPV  137 (156)
T ss_dssp             SCCCHHHHHHHHHSSSCEEEESCCCTTCCSC----EEECC------------HHHHHHHHHHHHHHHHTTCCC
T ss_pred             CCCCHHHHHHHHCCCCCCCCCCCCCCCCCCE----EEEEC------------HHHHHHHHHHHHHHHHCCCCC
T ss_conf             1343276764312222233333455465323----99843------------999999999999999669899


No 315
>>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} (A:)
Probab=39.91  E-value=21  Score=14.82  Aligned_cols=14  Identities=7%  Similarity=-0.109  Sum_probs=5.6

Q ss_pred             HHHHHHHHCEEEEE
Q ss_conf             89988420107998
Q gi|254780901|r  388 ARLKEKFGRPSFAI  401 (600)
Q Consensus       388 srL~e~y~kP~iv~  401 (600)
                      .++.+..+-..+++
T Consensus       193 ~~l~~~~g~~~vv~  206 (224)
T 2bdq_A          193 QYICQETGVKQAHG  206 (224)
T ss_dssp             HHHHHHHTCCEEEE
T ss_pred             HHHHHHHCCEEEEE
T ss_conf             99999659848997


No 316
>>3hvb_A Protein FIMX; EAL phosphodiesterase, biofilm, C-DI-GMP, hydrolase; 2.99A {Pseudomonas aeruginosa PAO1} (A:)
Probab=39.54  E-value=21  Score=14.78  Aligned_cols=67  Identities=10%  Similarity=0.104  Sum_probs=31.7

Q ss_pred             CCHHHHHHHHHHHCCHH-HHHCCCCCCCEEEECC----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             24234566677430623-3312122221002034----25899999999998999999999999999999987521
Q gi|254780901|r  292 ITAENLGYMIGPSINAG-GRIGESNLGSRLLISD----DSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC  362 (600)
Q Consensus       292 i~~~di~f~iaPrINAa-GRl~~a~~av~lL~~~----d~~~a~~la~~L~~lN~~Rk~~e~~i~~~a~~~~~~~~  362 (600)
                      +....+.+..-|.++.. |++-..+.-+++-..+    .+..-...+.+....    ..+...+++.+.++.....
T Consensus       197 l~~~~~~~~~qpiv~~~~~~~~~~E~l~r~~~~~~~~~~~~~f~~~~~~~~l~----~~~~~~~~~~~~~~~~~~~  268 (437)
T 3hvb_A          197 LETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLA----EKIDRWVILNSIKLLAEHR  268 (437)
T ss_dssp             TTTTCCEEEEEEEEESSSCSSEEEEEEEEEECTTSSEECHHHHHHHHHHTTCH----HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHCCCC----CCCCCCHHHHHHHHHHHHH
T ss_conf             98654455430001123331000010011357543567335542111210001----2577505788888887776


No 317
>>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} (A:352-501)
Probab=39.45  E-value=17  Score=15.50  Aligned_cols=37  Identities=5%  Similarity=0.044  Sum_probs=29.9

Q ss_pred             CCCCCCCC---------CCCCEEECCCCHHHHHHHHHHHHHHHCCH
Q ss_conf             01156532---------22314642221588999999999862264
Q gi|254780901|r  434 LVKGGGHA---------MAAGLTVERVNFGRLCDFFQKFAHNIVPA  470 (600)
Q Consensus       434 l~~~GGH~---------~AaG~ti~~~~l~~f~~~l~~~~~~~~~~  470 (600)
                      |..||-|.         +||.+-++++.++.|.++|.+........
T Consensus        68 F~~fGsH~~~yp~~Ylt~AaAIG~~~~dVd~fv~rLdk~~~~~~k~  113 (150)
T 3hl2_A           68 FRGFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKE  113 (150)
T ss_dssp             ESSTTTTSSCCSSCEEEEECCTTCCHHHHHHHHHHHHHHHHHHHC-
T ss_pred             HHHCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             1104755334677767997127899999999999999999999740


No 318
>>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} (A:)
Probab=39.28  E-value=18  Score=15.24  Aligned_cols=80  Identities=15%  Similarity=0.186  Sum_probs=49.5

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHH---HHH
Q ss_conf             99799994078861528999999999769947998078743366889789887420268689996488762345---555
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDA---LQY  168 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~---i~~  168 (600)
                      +++|+|.-    |--+...++...|+..|.++...-     .    ..++++.+.+..+++|| +|......+.   ++.
T Consensus         1 ~~riLiVd----d~~~~~~~l~~~L~~~g~~v~~a~-----~----~~~Al~~l~~~~~d~ii-~D~~lp~~~g~el~~~   66 (124)
T 1mb3_A            1 TKKVLIVE----DNELNMKLFHDLLEAQGYETLQTR-----E----GLSALSIARENKPDLIL-MDIQLPEISGLEVTKW   66 (124)
T ss_dssp             CCEEEEEC----SCHHHHHHHHHHHHHTTCEEEEES-----C----HHHHHHHHHHHCCSEEE-EESBCSSSBHHHHHHH
T ss_pred             CCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHHCCCCEEE-ECCCCCCCCHHHHHHH
T ss_conf             97399995----999999999999998799999989-----9----99999999847999999-8689899998999999


Q ss_pred             HHH----CCCCEE-EECCCCCC
Q ss_conf             541----798279-96154476
Q gi|254780901|r  169 ATN----QGIDVI-VIDHHQVK  185 (600)
Q Consensus       169 a~~----~GidvI-VtDHH~~~  185 (600)
                      .++    .++-|| +|.++...
T Consensus        67 ir~~~~~~~~pii~lt~~~~~~   88 (124)
T 1mb3_A           67 LKEDDDLAHIPVVAVTAFAMKG   88 (124)
T ss_dssp             HHHSTTTTTSCEEEEC------
T ss_pred             HHHCCCCCCCCEEEEECCCCHH
T ss_conf             9818887999799998879989


No 319
>>2qv5_A AGR_C_5032P, uncharacterized protein ATU2773; structural genomics, unknown function, PSI-2, protein structure initiative; 1.90A {Agrobacterium tumefaciens str} (A:)
Probab=39.09  E-value=21  Score=14.73  Aligned_cols=46  Identities=9%  Similarity=-0.000  Sum_probs=34.1

Q ss_pred             CHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEE
Q ss_conf             61528999999999769947998078743366889789887420268689
Q gi|254780901|r  104 DGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLI  153 (600)
Q Consensus       104 DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~Li  153 (600)
                      ||-.++.-+.+.|++.+.++++++.....+    +.+.++.+.+.|..+-
T Consensus        38 Dg~~~~~~il~~L~~~~vkaTFFv~~~~~~----~~~~~~~~~~~GhEIg   83 (261)
T 2qv5_A           38 GLGLSQTGSQKAIRDLPPEVTLGFAASGNS----LQRWMQDARREGHEIL   83 (261)
T ss_dssp             EETSCHHHHHHHHHHSCTTSEEEEETTCSS----HHHHHHHHHHHTCCEE
T ss_pred             CCCCCCHHHHHHHHHCCCCEEEEECCCCCC----HHHHHHHHHHCCCEEE
T ss_conf             799983678999985898727998789977----7999999997798799


No 320
>>1n2z_A Vitamin B12 transport protein BTUF; HET: CNC PG4; 2.00A {Escherichia coli} (A:1-131)
Probab=39.08  E-value=21  Score=14.73  Aligned_cols=43  Identities=19%  Similarity=0.354  Sum_probs=30.3

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             98874202686899964887623455555417982799615447
Q gi|254780901|r  141 LMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       141 ~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      .+|.+...+++|||+.+ +....+.++.+++.|+.|++.+=..+
T Consensus        49 n~E~i~~l~PDlvi~~~-~~~~~~~~~~l~~~~i~v~~~~~~~~   91 (131)
T 1n2z_A           49 NLERIVALKPDLVIAWR-GGNAERQVDQLASLGIKVMWVDATSI   91 (131)
T ss_dssp             CHHHHHHTCCSEEEECT-TTSCHHHHHHHHHHTCCEEECCCCSH
T ss_pred             CHHHHHHCCCCEEEEEC-CCCCHHHHHHHHHCCCEEEEECCCCH
T ss_conf             99999843997488305-77728899999852986998179999


No 321
>>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} (A:158-292)
Probab=39.06  E-value=21  Score=14.73  Aligned_cols=78  Identities=19%  Similarity=0.296  Sum_probs=49.6

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC--CHHHHHHH------HHCCCCEEEEECCCCCC
Q ss_conf             79979999407886152899999999976994799807874336688--97898874------20268689996488762
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGP--NPSLMEKF------INEGAQLIITVDCGSTS  162 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl--~~~~i~~~------~~~g~~LiItvD~Gi~~  162 (600)
                      ++.||++.||  .-+-+.-+ +..++..+|.++...-|.-    |.+  ..+.++++      .+.|.++.+|-|.    
T Consensus         3 ~glkia~vGd--~~~rv~~S-~~~~~~~~g~~v~~~~P~~----~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~d~----   71 (135)
T 3grf_A            3 KGIKFAYCGD--SMNNVTYD-LMRGCALLGMECHVCCPDH----KDFKPIKEVIDECEEIIAKHGTGGSIKIFHDC----   71 (135)
T ss_dssp             GGCCEEEESC--CSSHHHHH-HHHHHHHHTCEEEEECCSS----GGGSCCHHHHHHHHHHHHHHTCCCEEEEESSH----
T ss_pred             CCCEEEEECC--CCCCHHHH-HHHHHHHCCCEEEEECCCC----CCCCCHHHHHHHHHHHHHHHCCCCEEEEEECH----
T ss_conf             5724887268--76553779-9999997799699965653----45676699999999987752369849999579----


Q ss_pred             HHHHHHHHHCCCCEEEECCCCC
Q ss_conf             3455555417982799615447
Q gi|254780901|r  163 YDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       163 ~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      .|++     .|.|||.||--..
T Consensus        72 ~eav-----~~aDviyt~~w~~   88 (135)
T 3grf_A           72 KKGC-----EGVDVVYTDSWMS   88 (135)
T ss_dssp             HHHH-----TTCSEEEECCCC-
T ss_pred             HHHH-----CCCCEEEECHHHH
T ss_conf             9985-----4799898511331


No 322
>>3d3j_A Enhancer of mRNA-decapping protein 3; HEDC3, cytoplasm, phosphoprotein, protein binding; 2.80A {Homo sapiens} (A:)
Probab=39.04  E-value=21  Score=14.73  Aligned_cols=90  Identities=18%  Similarity=0.099  Sum_probs=49.2

Q ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------CCCCCCCEEEEECCCCCHHHH
Q ss_conf             12222100203425899999999998999999999999999999987521---------124347502620578581222
Q gi|254780901|r  313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC---------DDIQQASVIVVEGDRWHPGIV  383 (600)
Q Consensus       313 ~a~~av~lL~~~d~~~a~~la~~L~~lN~~Rk~~e~~i~~~a~~~~~~~~---------~~~~~~~~ivv~~~~wh~GVi  383 (600)
                      ++...+.+++.+...++++.+.+.- + ..-+.+|.....-++. +.+..         +..+...++|+.+++ +.|=-
T Consensus        72 ~~~~~~~~~t~~q~~~ie~~~~~~G-l-s~~~LmE~Ag~~~a~~-i~~~~~~~~~~~~~~~~~~~~V~vl~G~g-nnGgd  147 (306)
T 3d3j_A           72 DSGLVVPSISYELHKKLLSVAEKHG-L-TLERRLEMTGVCASQM-ALTLLGGPNRLNPKNVHQRPTVALLCGPH-VKGAQ  147 (306)
T ss_dssp             TTCCEEECCCHHHHHHHHHHHHHTT-C-CHHHHHHHHHHHHHHH-HHHHHC-----------CCCEEEEEECSS-HHHHH
T ss_pred             CCCCEECCCCHHHHHHHHHHHHHCC-C-CHHHHHHHHHHHHHHH-HHHHHCCCCCCCCCCCCCCCEEEEEECCC-CCCHH
T ss_conf             9982722588999999999999809-9-8899999999999999-99982876324645468899799998999-87299


Q ss_pred             HHHHHHHHHHHHCEEEEEEECCC
Q ss_conf             22278998842010799886379
Q gi|254780901|r  384 GLLAARLKEKFGRPSFAISFEED  406 (600)
Q Consensus       384 GIVAsrL~e~y~kP~iv~s~~~d  406 (600)
                      |++|+|....++..|.|+-....
T Consensus       148 gl~~AR~L~~~G~~V~v~~~~~~  170 (306)
T 3d3j_A          148 GISCGRHLANHDVQVILFLPNFV  170 (306)
T ss_dssp             HHHHHHHHHHTTCEEEEECCCCS
T ss_pred             HHHHHHHHHHCCCEEEEEEECCC
T ss_conf             99999999977983899972786


No 323
>>1mio_B Nitrogenase molybdenum iron protein (beta chain); HET: HCA CFM CLP; 3.00A {Clostridium pasteurianum} (B:1-35,B:144-268)
Probab=39.00  E-value=21  Score=14.72  Aligned_cols=116  Identities=13%  Similarity=0.142  Sum_probs=70.8

Q ss_pred             HHHHHHHHHCCCCHHHHHHHCCCCHHHCCCCHHHCCCHHHHHHHHHHHH-----HCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             9999999967889789886619667771899556148799999999999-----77997999940788615289999999
Q gi|254780901|r   41 DIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAI-----YNSEKIMIFGDYDVDGAASVALMMRF  115 (600)
Q Consensus        41 ~~~a~iL~~Rgi~~~~~~~fL~p~l~~l~~dP~~l~dm~~A~~ri~~ai-----~~~ekI~I~gDyD~DGitstail~~~  115 (600)
                      ..+..++.+-||..                   ...+.++|+..|.+.+     ....+|-|.|+|---|  -..-|.+.
T Consensus        24 ~~~~~~~~~~~~GS-------------------~~~G~~~A~~ali~~l~~~~~~~~~~VNLIg~~~~~~--Dv~eLk~l   82 (160)
T 1mio_B           24 QPVGAMYAALGIGS-------------------HVTGFANMVQGIVNYLSENTGAKNGKINVIPGFVGPA--DMREIKRL   82 (160)
T ss_dssp             THHHHHHHHTTBSC-------------------HHHHHHHHHHHHHHHHCCCCSCCCSCEEEECCSCCHH--HHHHHHHH
T ss_pred             HHHHHHHHHHCCCC-------------------CHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCC--CHHHHHHH
T ss_conf             28789999951274-------------------3089999999998762688888889669989988714--79999999


Q ss_pred             HHHCCCCEEEEECCC--CCC-----------CCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH-HHCCCCEEEECC
Q ss_conf             997699479980787--433-----------668897898874202686899964887623455555-417982799615
Q gi|254780901|r  116 LSHCSVNANMYIPDR--IVD-----------GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA-TNQGIDVIVIDH  181 (600)
Q Consensus       116 L~~~g~~v~~~IP~R--~~e-----------GYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a-~~~GidvIVtDH  181 (600)
                      |+.+|.++.. +|+-  --|           ..|-+.+-++.+.+.  .+-|.+ |..+.....+++ +..|+..+..++
T Consensus        83 L~~~Gi~vnv-lpd~S~~lD~~~~~~~~~v~~ggttleei~~~~~A--~lnIvl-~~~~g~~~A~~Le~~fGiP~i~~p~  158 (160)
T 1mio_B           83 FEAMDIPYIM-FPDTSGVLDGPTTGEYKMYPEGGTKIEDLKDTGNS--DLTLSL-GSYASDLGAKTLEKKCKVPFKTLRT  158 (160)
T ss_dssp             HHHHTCCEEE-SSCCTTTSSCCCCSSCCSSCSCSBCHHHHHTTSSC--SEEEEE-SHHHHHHHHHHHHHHSCCCEEEECC
T ss_pred             HHHHCCCEEE-CCCCCCCCCCCCCCCCEEECCCCCCHHHHHHHHCC--CEEEEE-CHHHHHHHHHHHHHHHCCCEEECCC
T ss_conf             9981996674-25631123566667510432799979999986419--889997-8667688999999986998464788


No 324
>>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} (A:1-131)
Probab=38.93  E-value=21  Score=14.71  Aligned_cols=79  Identities=15%  Similarity=0.212  Sum_probs=49.6

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH---H
Q ss_conf             7997999940788615289999999997699479980787433668897898874202686899964887623455---5
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL---Q  167 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i---~  167 (600)
                      ++.+|+|.-    |-.....++...|+..|.++...     ..    ..++++.+.+..++++| +|.........   .
T Consensus         6 ~~~~ILiVd----Dd~~~~~~l~~~L~~~g~~v~~a-----~~----~~~al~~~~~~~~dlii-lD~~lp~~~g~e~~~   71 (131)
T 1ys7_A            6 TSPRVLVVD----DDSDVLASLERGLRLSGFEVATA-----VD----GAEALRSATENRPDAIV-LDINMPVLDGVSVVT   71 (131)
T ss_dssp             -CCEEEEEC----SCHHHHHHHHHHHHHTTCEEEEE-----SS----HHHHHHHHHHSCCSEEE-EESSCSSSCHHHHHH
T ss_pred             CCCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEE-----CC----HHHHHHHHHHCCCEEEE-EEECCCCCCCCCCHH
T ss_conf             998799997----99999999999999789999998-----99----99999999858982999-730233333222100


Q ss_pred             HHHHC--CCCEEE-ECCCC
Q ss_conf             55417--982799-61544
Q gi|254780901|r  168 YATNQ--GIDVIV-IDHHQ  183 (600)
Q Consensus       168 ~a~~~--GidvIV-tDHH~  183 (600)
                      ..++.  .+.+++ |.+..
T Consensus        72 ~ir~~~~~~~ii~~t~~~~   90 (131)
T 1ys7_A           72 ALRAMDNDVPVCVLSARSS   90 (131)
T ss_dssp             HHHHTTCCCCEEEEECCCT
T ss_pred             HHCCCCCCCCCCCCCCCCC
T ss_conf             1001455333123557899


No 325
>>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} (A:1-108)
Probab=38.83  E-value=21  Score=14.70  Aligned_cols=85  Identities=14%  Similarity=0.063  Sum_probs=48.6

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC------CCCCCCCHHHHHH--HHHCCCCEEEEECCCC--
Q ss_conf             79979999407886152899999999976994799807874------3366889789887--4202686899964887--
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI------VDGYGPNPSLMEK--FINEGAQLIITVDCGS--  160 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~------~eGYGl~~~~i~~--~~~~g~~LiItvD~Gi--  160 (600)
                      ++++++|+|-    |-. .....+.|...|+++..+-++..      .+.+|.....-+.  ..-.+++++|++ .|.  
T Consensus        11 ~gk~vlViG~----G~i-G~~~a~~L~~~G~~v~vi~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~divi~~-t~~~~   84 (108)
T 1pjq_A           11 RDRDCLIVGG----GDV-AERKARLLLEAGARLTVNALTFIPQFTVWANEGMLTLVEGPFDETLLDSCWLAIAA-TDDDT   84 (108)
T ss_dssp             BTCEEEEECC----SHH-HHHHHHHHHHTTBEEEEEESSCCHHHHHHHTTTSCEEEESSCCGGGGTTCSEEEEC-CSCHH
T ss_pred             CCCEEEEECC----CHH-HHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCEEEECCCCCHHHHCCCEEEEEC-CCCHH
T ss_conf             8983999889----899-99999999868987999938999899999877985999178997894893499984-79999


Q ss_pred             CCHHHHHHHHHCCCCEEEECC
Q ss_conf             623455555417982799615
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDH  181 (600)
                      .+..-.+.++++|+-|-|.|-
T Consensus        85 ~~~~~~~~~k~~~v~vnv~d~  105 (108)
T 1pjq_A           85 VNQRVSDAAESRRIFCNVVDA  105 (108)
T ss_dssp             HHHHHHHHHHHTTCEEEETTC
T ss_pred             HHHHHHHHHHHCCCEEEECCC
T ss_conf             999999999875996997888


No 326
>>1wqa_A Phospho-sugar mutase; alpha-beta protein, unphosphorylated form, enzyme-metal complex, isomerase; 2.00A {Pyrococcus horikoshii} (A:153-260,A:338-368)
Probab=38.82  E-value=21  Score=14.70  Aligned_cols=40  Identities=15%  Similarity=0.228  Sum_probs=28.9

Q ss_pred             HHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             8742026868999648876234555554179827996154
Q gi|254780901|r  143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       143 ~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH  182 (600)
                      +.+.+.+.++++.+-+|++..-.-..++++|++++.+..+
T Consensus        16 ~~ik~~~lkIvvD~~~Gsa~~~~~~il~~lG~evi~in~~   55 (139)
T 1wqa_A           16 EAIKKRKPFVVVDTSNGAGSLTLPYLLRELGCKVITVNAQ   55 (139)
T ss_dssp             HHHHHHCCEEEEECTTSGGGGTHHHHHHHHTCEEEEESCS
T ss_pred             CCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEECCCC
T ss_conf             2223343305785588838999999999729856762657


No 327
>>2pw9_A Putative formate dehydrogenase accessory protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Desulfotalea psychrophila LSV54} (A:32-268)
Probab=38.81  E-value=22  Score=14.70  Aligned_cols=14  Identities=29%  Similarity=0.290  Sum_probs=5.8

Q ss_pred             HHHHHHHCEEEEEE
Q ss_conf             99884201079988
Q gi|254780901|r  389 RLKEKFGRPSFAIS  402 (600)
Q Consensus       389 rL~e~y~kP~iv~s  402 (600)
                      .++++++-..+-++
T Consensus       200 elA~~~giTLigf~  213 (237)
T 2pw9_A          200 ALAKRSGATLVAYS  213 (237)
T ss_dssp             HHHHHHTCEEEEEE
T ss_pred             HHHHHCCCEEEEEE
T ss_conf             99998099899996


No 328
>>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA; 1.90A {Geobacillus kaustophilus HTA426} (A:42-147)
Probab=38.67  E-value=22  Score=14.68  Aligned_cols=81  Identities=17%  Similarity=0.147  Sum_probs=53.3

Q ss_pred             HHHHHHHHHHCCC----CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEE
Q ss_conf             9999999997799----799994078861528999999999769947998078743366889789887420268689996
Q gi|254780901|r   81 AARRIVQAIYNSE----KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV  156 (600)
Q Consensus        81 A~~ri~~ai~~~e----kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItv  156 (600)
                      |..-|.+++++++    +-.|.+   -+|-++.++.+-+ +.+|.+...++|..      .+..-.+.+..-|.++++ |
T Consensus         8 a~~~i~~~~~~g~~~~~~~iv~a---SsGN~g~alA~~a-~~~g~~~~iv~p~~------~~~~k~~~l~~~Ga~Vi~-v   76 (106)
T 2egu_A            8 ALAMIEAAEKAGKLKPGDTIVEP---TSGNTGIGLAMVA-AAKGYKAVLVMPDT------MSLERRNLLRAYGAELVL-T   76 (106)
T ss_dssp             HHHHHHHHHHTTCCCTTCEEEEE---CCHHHHHHHHHHH-HHHTCEEEEEEESC------SCHHHHHHHHHTTCEEEE-E
T ss_pred             HHHHHHHHHHCCCCCCCEEEEEE---CCCHHHHHHHHHH-HHCCCCEEEEECCC------CCHHHHHHHHHCCCEEEE-E
T ss_conf             99999999973985665036654---1430678899999-86599759996799------889999999953973697-0


Q ss_pred             CCCCCCHHHHHHHHHC
Q ss_conf             4887623455555417
Q gi|254780901|r  157 DCGSTSYDALQYATNQ  172 (600)
Q Consensus       157 D~Gi~~~e~i~~a~~~  172 (600)
                      +-|..-.+.++.+++.
T Consensus        77 ~~~~~~~~~~~~a~~~   92 (106)
T 2egu_A           77 PGAQGMRGAIAKAEEL   92 (106)
T ss_dssp             CGGGHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHH
T ss_conf             4410466899999999


No 329
>>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} (A:1-123,A:263-323)
Probab=38.45  E-value=22  Score=14.66  Aligned_cols=95  Identities=17%  Similarity=0.085  Sum_probs=44.0

Q ss_pred             CHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHH-HHHHHHHHCCCCCCCCHHHHHH
Q ss_conf             234555554179827996154476555672565237888864334430478899999-9999997021488764077999
Q gi|254780901|r  162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLV-LVLIYRILRQDNKVPLNFDLLS  240 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l-~~al~~~l~~~~~~~~~~~l~~  240 (600)
                      ....-+.+.+.++.-..+|--+.-+..++++.|.-|..       .+       +.. ..++..-..---.-|...++.+
T Consensus        37 ~~~~~~~a~~~~i~~~~td~eeLl~~~iDaV~I~tp~~-------~H-------~~ia~~aL~aGkhVlvEKPla~s~~e  102 (184)
T 1xea_A           37 PKVLGTLATRYRVSATCTDYRDVLQYGVDAVXIHAATD-------VH-------STLAAFFLHLGIPTFVDKPLAASAQE  102 (184)
T ss_dssp             HHHHHHHHHHTTCCCCCSSTTGGGGGCCSEEEECSCGG-------GH-------HHHHHHHHHTTCCEEEESCSCSSHHH
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHCCCCCEEEEECCCC-------CC-------CCCCCCCCCCCHHHHHCCCCCCCHHH
T ss_conf             99999999983998431889999558999999603432-------11-------22332112322133303453310566


Q ss_pred             HHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9999877542011114441189999878877
Q gi|254780901|r  241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVA  271 (600)
Q Consensus       241 ~ldlvaiGTvaD~vpL~~eNR~lvk~GL~~l  271 (600)
                      ..+|+.+.-=.++-=..+.||. ..+|..-|
T Consensus       103 ~~eL~~lA~~~g~~l~VgfnR~-~~~~~~~~  132 (184)
T 1xea_A          103 CENLYELAEKHHQPLYVGFNRL-ASKGFDAX  132 (184)
T ss_dssp             HHHHHHHHHHTTCCEEEECGGH-HHTTHHHH
T ss_pred             HHHHHHHHHHCCCCCEEEECCC-CCHHHHHH
T ss_conf             4135666764155311201120-02579999


No 330
>>2r7r_A RNA-dependent RNA polymerase; viral protein, RNA-dependent RNA polymerase, single subunit polymerase fold, fingers, PALM, thumb; 2.60A {Simian rotavirus} PDB: 2r7q_A 2r7s_A 2r7t_A 2r7u_A 2r7v_A 2r7w_A* 2r7x_A* 2r7o_A (A:869-921,A:1008-1074)
Probab=38.39  E-value=15  Score=15.95  Aligned_cols=57  Identities=25%  Similarity=0.340  Sum_probs=42.2

Q ss_pred             HHHHHHHCCCCHHHHHHHCCCCHHHCCCCHHH--------CCCHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             99999967889789886619667771899556--------14879999999999977997999940788
Q gi|254780901|r   43 VARVLVNRNVSIDYAKDFLNPSIRLLMPDPLI--------LTDCDKAARRIVQAIYNSEKIMIFGDYDV  103 (600)
Q Consensus        43 ~a~iL~~Rgi~~~~~~~fL~p~l~~l~~dP~~--------l~dm~~A~~ri~~ai~~~ekI~I~gDyD~  103 (600)
                      +-|..-+|-+..    +|=+|+++.+.+-||.        +-++..-.+.|..||++++-|.++.||--
T Consensus        42 v~~cigsrtyqi----DfNS~dle~lIriPfkgKiP~vtFilhlyakL~iIN~aIk~g~wItlfc~~pK  106 (120)
T 2r7r_A           42 IIQCIGSRTYQI----DFNSPDLEKLIRIPFKGKIPAVTFILHLYAKLEVINYAIKNGSWISLFCNYPK  106 (120)
T ss_dssp             HHHHHCBCSBCC----CTTCHHHHHTEECCCSSCCHHHHHHHHHHHHHHHHHHHHHHSSEEEEEECCCH
T ss_pred             HHHHHCCEEEEE----CCCCHHHHHHHCCCCCCCCCEEEEHHHHHHHHHHHHHHHCCCCEEEEEECCCH
T ss_conf             999865401110----36863068771164568887043268889889999998705967999957985


No 331
>>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} (A:1-109,A:230-268)
Probab=38.35  E-value=22  Score=14.65  Aligned_cols=89  Identities=8%  Similarity=0.066  Sum_probs=53.7

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHH----HCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHH
Q ss_conf             7799799994078861528999999999----769947998078743366889789887420268689996488762345
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLS----HCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDA  165 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~----~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~  165 (600)
                      ..+-||.+.-+-..+.-+-....+++++    .+|.++.++.+.--.+   --...++.+.++|++|||++  |..-.+.
T Consensus         3 ~~~~kValI~~G~i~D~sfN~s~~~G~~~~~~~~gi~~~~~e~~~~~~---d~~~~i~~la~~G~dlIi~~--g~~~~~~   77 (148)
T 2hqb_A            3 GGGGXVGLLVEDTIDDQGWNRKAYEGLLNIHSNLDVDVVLEEGVNSEQ---KAHRRIKELVDGGVNLIFGH--GHAFAEY   77 (148)
T ss_dssp             ---CEEEEECCCC----CCTHHHHHHHHHHHHHSCCEEEEECCCCSHH---HHHHHHHHHHHTTCCEEEEC--STHHHHH
T ss_pred             CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCHH---HHHHHHHHHHHCCCCEEEEE--CCHHHHH
T ss_conf             765289999769998611999999999999998598599995799879---99999999997799989980--7101479


Q ss_pred             HHHH-HH-CCCCEEEECCCC
Q ss_conf             5555-41-798279961544
Q gi|254780901|r  166 LQYA-TN-QGIDVIVIDHHQ  183 (600)
Q Consensus       166 i~~a-~~-~GidvIVtDHH~  183 (600)
                      +..+ .+ -.+..+++|=..
T Consensus        78 i~~vA~~yPdv~F~iidg~~   97 (148)
T 2hqb_A           78 FSTIHNQYPDVHFVSFNGEV   97 (148)
T ss_dssp             HHTTTTSCTTSEEEEESCCC
T ss_pred             HHHHHHHCCCCCEEEEECCC
T ss_conf             99999855587289962664


No 332
>>1kq3_A Glycerol dehydrogenase; zinc, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.50A {Thermotoga maritima} (A:20-169)
Probab=38.30  E-value=9.6  Score=17.44  Aligned_cols=96  Identities=13%  Similarity=0.149  Sum_probs=46.8

Q ss_pred             HHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             999999997-7997999940788615289999999997699479980787433668897898874202686899964887
Q gi|254780901|r   82 ARRIVQAIY-NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        82 ~~ri~~ai~-~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      ..++.+-++ .++++++++|--+-.......+.+.|...|..+..+--.+..    -..+.++.+.+.++++||.+--|+
T Consensus        11 ~~~l~~~l~~~g~~~livtd~~~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~d~iiaiGGGs   86 (150)
T 1kq3_A           11 INILEEELSRFGERAFVVIDDFVDKNVLGENFFSSFTKVRVNKQIFGGECSD----EEIERLSGLVEEETDVVVGIGGGK   86 (150)
T ss_dssp             GGGHHHHHHTTCSEEEEEECHHHHHHTTCTTGGGGCSSSEEEEEECCSSCBH----HHHHHHHTTCCTTCCEEEEEESHH
T ss_pred             HHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCC----HHHHHHHHHHHCCCCEEEEECCCH
T ss_conf             9999999996699289998976556059999999898769879963899993----799999999853999899947960


Q ss_pred             CCHHHHHH-HHHCCCCEEEECCC
Q ss_conf             62345555-54179827996154
Q gi|254780901|r  161 TSYDALQY-ATNQGIDVIVIDHH  182 (600)
Q Consensus       161 ~~~e~i~~-a~~~GidvIVtDHH  182 (600)
                      . .+-.++ +-..++.+|..=-.
T Consensus        87 v-~D~aK~~a~~~~~~~i~vPTt  108 (150)
T 1kq3_A           87 T-LDTAKAVAYKLKKPVVIVPTI  108 (150)
T ss_dssp             H-HHHHHHHHHHTTCCEEEEESS
T ss_pred             H-HHHHHHHHHCCCCCEEEECCC
T ss_conf             2-110268874147872885477


No 333
>>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} (A:)
Probab=38.24  E-value=22  Score=14.64  Aligned_cols=46  Identities=15%  Similarity=0.145  Sum_probs=31.7

Q ss_pred             CCHHHHHHHHH--CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             89789887420--26868999648876234555554179827996154
Q gi|254780901|r  137 PNPSLMEKFIN--EGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       137 l~~~~i~~~~~--~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH  182 (600)
                      +...-+.....  .+..+++.|.+|..+......+++.|.+|.+.+.=
T Consensus        39 ip~~~~~~~~~~~~~~~vv~~c~~g~~s~~a~~~L~~~G~~v~~l~GG   86 (94)
T 1wv9_A           39 VPLEKIQKGEHGLPRRPLLLVCEKGLLSQVAALYLEAEGYEAXSLEGG   86 (94)
T ss_dssp             CCHHHHTTTCCCCCSSCEEEECSSSHHHHHHHHHHHHHTCCEEEETTG
T ss_pred             CCCCCCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHCCCCEEEECCH
T ss_conf             111122223454652179999567640999999999879939996647


No 334
>>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, disulfide oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} (A:1-120,A:275-333)
Probab=38.19  E-value=22  Score=14.63  Aligned_cols=75  Identities=9%  Similarity=0.038  Sum_probs=45.1

Q ss_pred             HHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCC-CCC-HHHHHHHHHHHHHH
Q ss_conf             4202686899964887623455555417982799615447655567256523788886433-443-04788999999999
Q gi|254780901|r  145 FINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSG-QGH-LCAAGVVFLVLVLI  222 (600)
Q Consensus       145 ~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p-~~~-l~gaGvaf~l~~al  222 (600)
                      +....++++| +-.|-+-.-+.-+|...|++++|+|........|-.-...-|..  .+|| |++ ++|.-++=.+....
T Consensus         4 ~~~~~yDviI-IG~GPAGlsAAi~a~r~gl~~lviEk~~~~~~~~GGqi~~t~~I--eNy~G~~~gi~G~eL~~~~~~qa   80 (179)
T 1vdc_A            4 LETHNTRLCI-VGSGPAAHTAAIYAARAELKPLLFEGWMANDIAPGGQLTTTTDV--ENFPGFPEGILGVELTDKFRKQS   80 (179)
T ss_dssp             CEEEEEEEEE-ECCSHHHHHHHHHHHHTTCCCEEECCSSBTTBCTTCGGGGCSEE--CCSTTCTTCEEHHHHHHHHHHHH
T ss_pred             CCCCCCCEEE-ECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCEECCCCCC--CCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             8646987999-99769999999999988998899943676786547675502431--22466740126288999988755


No 335
>>1txy_A Primosomal replication protein N; OB fold, dimer, DNA binding protein; 2.00A {Escherichia coli} (A:)
Probab=38.16  E-value=22  Score=14.63  Aligned_cols=54  Identities=11%  Similarity=0.169  Sum_probs=40.7

Q ss_pred             EEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCCC-EEEEEEEEEEECCCC
Q ss_conf             79999977878701235530699879999997665457811-058999980111311
Q gi|254780901|r  540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSK-RCQLRVLDASPVEGH  595 (600)
Q Consensus       540 ~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~~-s~QL~I~Di~p~e~~  595 (600)
                      .+.+++|+.....+.+++  ..|..+-+-++++.+.|.++. ..++.+.+|+..+..
T Consensus        49 ~~~v~~~~~~A~~~~~~l--~kG~~V~V~G~l~~~~~~dkdg~~~~~~~~i~~l~~k  103 (104)
T 1txy_A           49 QXPVIVSGHENQAITHSI--TVGSRITVQGFISCHKAKNGLSKXVLHAEQIELIDSG  103 (104)
T ss_dssp             EEEEEEESSTTHHHHTTC--CTTCEEEEEEEEEC--------CCEEEEEEEEEC---
T ss_pred             EEEEEEEHHHHHHHHHHC--CCCCEEEEEEEEEEECCCCCCCEEEEEEEEEEEECCC
T ss_conf             999999909989988754--7999999999988722628996299999999995179


No 336
>>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} (A:166-339)
Probab=38.11  E-value=22  Score=14.62  Aligned_cols=53  Identities=13%  Similarity=0.098  Sum_probs=22.7

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             977997999940788615289999999997699479980787433668897898874202686899
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLII  154 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiI  154 (600)
                      ++.+++++|+|   +-|+...++  ..++.+|+++.+-+-        .+++..+.+.+.|++-+|
T Consensus        18 v~~G~~VlI~G---aG~vG~~a~--q~a~~~G~~~v~~~~--------~~~~~~~~~~~~Ga~~vi   70 (174)
T 2dph_A           18 VKPGSHVYIAG---AGPVGRCAA--AGARLLGAACVIVGD--------QNPERLKLLSDAGFETID   70 (174)
T ss_dssp             CCTTCEEEEEC---CSHHHHHHH--HHHHHHTCSEEEEEE--------SCHHHHHHHHTTTCEEEE
T ss_pred             CCCCCEEEECC---CCCCHHHHH--HHHHHHCCCCCCCCC--------CCCCHHHHHHHCCCEEEE
T ss_conf             14798776417---775214456--665441243211123--------332101234314750574


No 337
>>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} (A:241-367)
Probab=38.05  E-value=22  Score=14.61  Aligned_cols=29  Identities=24%  Similarity=0.427  Sum_probs=13.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             89996488762345555541798279961
Q gi|254780901|r  152 LIITVDCGSTSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       152 LiItvD~Gi~~~e~i~~a~~~GidvIVtD  180 (600)
                      +++.|+.|..+......++++|.+|-+.|
T Consensus        85 iv~~c~~g~~s~~~a~~l~~~G~~v~~l~  113 (127)
T 1yt8_A           85 LVLVDDDGVRANXSASWLAQXGWQVAVLD  113 (127)
T ss_dssp             EEEECSSSSHHHHHHHHHHHTTCEEEEEC
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCCCCCC
T ss_conf             99994897168888999986266500014


No 338
>>2zzc_A Thioredoxin reductase 1, cytoplasmic; rossmann fold, alternative splicing, electron transport, FAD, flavoprotein, NADP, nucleus, oxidoreductase; HET: FAD NAP; 2.60A {Homo sapiens} PDB: 2zzb_A* 2zz0_A* 2j3n_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* (A:193-305)
Probab=38.05  E-value=22  Score=14.61  Aligned_cols=66  Identities=14%  Similarity=0.256  Sum_probs=39.9

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHH----HHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             7799799994078861528999999999769947998078743366889789----88742026868999648876234
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSL----MEKFINEGAQLIITVDCGSTSYD  164 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~----i~~~~~~g~~LiItvD~Gi~~~e  164 (600)
                      +..++++|+|     |=-+..-+..+|..+|.+|....-+..-  -++..++    .+.+.+.|++++  ..+.++..+
T Consensus        10 ~~~k~vvVvG-----gG~~g~e~A~~l~~~g~~Vtiv~r~~~~--~~~d~~~~~~~~~~~~~~gv~~~--~~~~v~~i~   79 (113)
T 2zzc_A           10 YCPGKTLVVG-----ASYVALECAGFLAGIGLDVTVMVRSILL--RGFDQDMANKIGEHMEEHGIKFI--RQFVPIKVE   79 (113)
T ss_dssp             SCCCSEEEEC-----CSHHHHHHHHHHHHTTCCEEEEESSCSS--TTSCHHHHHHHHHHHHHTTCEEE--ESEEEEEEE
T ss_pred             CCCCCEEEEC-----CCHHHHHHHHHHHHCCCEEEEEECCCCC--CCCCHHHHHHHHHHHHHCCCCCC--CCCCCEEEE
T ss_conf             1787114324-----4313212415555227749999747645--54498999999998664010001--355301101


No 339
>>1eqq_A Single stranded DNA binding protein; beta barrel, protein-DNA complex, replication/RNA complex; HET: 5MU; 3.20A {Escherichia coli} (A:)
Probab=37.97  E-value=14  Score=16.07  Aligned_cols=53  Identities=13%  Similarity=0.250  Sum_probs=35.9

Q ss_pred             EEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCC-----CEEEEEEEEEEECCC
Q ss_conf             7999997787870123553069987999999766545781-----105899998011131
Q gi|254780901|r  540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGS-----KRCQLRVLDASPVEG  594 (600)
Q Consensus       540 ~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~-----~s~QL~I~Di~p~e~  594 (600)
                      .+.+++|+.....+.++  ...|..+-|.++|..+.|.++     ..+++.+.+|...+.
T Consensus        55 ~~~v~~~g~~A~~~~~~--l~KG~~V~V~G~l~~~~~~~~dG~~~~~~~i~a~~i~~l~~  112 (178)
T 1eqq_A           55 WHRVVLFGKLAEVASEY--LRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQM  112 (178)
T ss_dssp             EEEEEECHHHHHHHHHH--CCTTCEEEECCEEEEEEEECSSSEEEEEEEEECSSSCCEEC
T ss_pred             EEEEEECCHHHHHHHHH--HCCCCEEEEEEEEEECCEECCCCCEEEEEEEEEEECCCEEE
T ss_conf             88636454899999987--25899899998976041499999889999999974473588


No 340
>>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} (A:1-114,A:247-295)
Probab=37.70  E-value=22  Score=14.58  Aligned_cols=72  Identities=7%  Similarity=0.045  Sum_probs=46.3

Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             9999769947998078743366889789887420268689996488762345555541798279961544765556
Q gi|254780901|r  114 RFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       114 ~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      +.++..|..+.++.-+...   ....+.++.+.+.+++-+|.+.. -.+.+.++.+++.|+.++++|.-.+....|
T Consensus        36 ~~a~~~Gy~lii~~~~~~~---~~~~~~i~~l~~~~vDGiII~~~-~~~~~~i~~l~~~~iPvVlid~~~~~~~~~  107 (163)
T 3hcw_A           36 ETCNQHGYGTQTTVSNNMN---DLMDEVYKMIKQRMVDAFILLYS-KENDPIKQMLIDESMPFIVIGKPTSDIDHQ  107 (163)
T ss_dssp             HHHHTTTCEEEECCCCSHH---HHHHHHHHHHHTTCCSEEEESCC-CTTCHHHHHHHHTTCCEEEESCCCSSGGGG
T ss_pred             HHHHHCCCEEEEEECCCCH---HHHHHHHHHHHHCCCCEEEEEEC-CCCCHHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             9999859989999789997---99999999999669984999722-553156788886401000253035667765


No 341
>>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE TAR; 2.10A {Bacillus halodurans} (A:1-125,A:270-293)
Probab=37.68  E-value=22  Score=14.57  Aligned_cols=63  Identities=24%  Similarity=0.293  Sum_probs=37.1

Q ss_pred             CCCCEEEE-ECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCCH-HHHHHHHHCCCCEEEEECCCC
Q ss_conf             79979999-407886152899999999976994799807874336-68897-898874202686899964887
Q gi|254780901|r   91 NSEKIMIF-GDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG-YGPNP-SLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        91 ~~ekI~I~-gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eG-YGl~~-~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      ++.+|.|. ||      ---+.+.+.|..+|++|..+=|.....+ .|... ..++++.++ ++.+|-.=-|+
T Consensus         4 ~G~kiaIIGGD------~R~s~vArsL~~~Ga~V~~~G~~~~~~~~~gv~~~~~~~eal~~-aDvvILpvp~e   69 (149)
T 3d4o_A            4 TGKHVVIIGGD------ARQLEIIRKLSTFDAKISLVGFDQLDDGFIGVTKXRIDEVDWNT-VDAILLPISGT   69 (149)
T ss_dssp             TTCEEEEECBC------HHHHHHHHHHHHTTCEEEEESCTTCC--CTTCEEECGGGCCGGG-CSEEECCTTCC
T ss_pred             CCCEEEEECCC------HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEEEECCHHHHHHC-CCEEEECCCCC
T ss_conf             87489997986------63999999999789989999667643455772562687678737-99999468665


No 342
>>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, RSGI, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} (A:79-187)
Probab=37.54  E-value=22  Score=14.56  Aligned_cols=86  Identities=19%  Similarity=0.140  Sum_probs=58.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             99999999977997999940788615289999999997699479980787433668897898874202686899964887
Q gi|254780901|r   81 AARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        81 A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      |..-+.++.+++++-.|+-  --.|-++.++-+-+ +.+|.++..++|.-..+   ....-++.+...|.+++.+.++|-
T Consensus         8 a~~~i~~~~~~G~~~~vv~--aSsGN~g~alA~~~-~~~G~~~~iv~p~~~~~---~~~~k~~~~~~~Ga~v~~~~~~~~   81 (109)
T 1v8z_A            8 AIGQALLAKFMGKTRLIAE--TGAGQHGVATAMAG-ALLGMKVDIYMGAEDVE---RQKMNVFRMKLLGANVIPVNSGSR   81 (109)
T ss_dssp             HHHHHHHHHHTTCCEEEEE--ESSSHHHHHHHHHH-HHTTCEEEEEEEHHHHT---TCHHHHHHHHHTTCEEEEECSTTS
T ss_pred             HHHHHHHHHHCCCCCEEEC--CCHHHHHHHHHHHH-HHCCCCEEEECCCCHHH---HHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             7999998765188624520--10457899999999-97388612301321243---317999999974981699568865


Q ss_pred             CCHHHHHHHHHC
Q ss_conf             623455555417
Q gi|254780901|r  161 TSYDALQYATNQ  172 (600)
Q Consensus       161 ~~~e~i~~a~~~  172 (600)
                      .-.+.+.++++.
T Consensus        82 ~~~~~~~~a~e~   93 (109)
T 1v8z_A           82 TLKDAINEALRD   93 (109)
T ss_dssp             SHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHH
T ss_conf             377888889999


No 343
>>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, amino-acid biosynthesis cobalamin, precorrin, novel fold; 2.10A {Thermotoga maritima} (A:)
Probab=37.48  E-value=22  Score=14.55  Aligned_cols=42  Identities=17%  Similarity=0.155  Sum_probs=15.7

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             8897898874202686899964887623455555417982799
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIV  178 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIV  178 (600)
                      ......+....+. ..+.+..-.++...+........|.+-+.
T Consensus        60 ~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  101 (266)
T 2w6r_A           60 GYDTEMIRFVRPL-TTLPIIASGGAGKMEHFLEAFLAGADKAL  101 (266)
T ss_dssp             CCCHHHHHHHGGG-CCSCEEEESCCCSTHHHHHHHHHTCSEEE
T ss_pred             CCCHHHHHHHHHE-ECCEEEECCCCCCCCCHHHHHHHHHHHEE
T ss_conf             8667776434532-48549976772120210033322000001


No 344
>>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} (A:1-183)
Probab=37.19  E-value=23  Score=14.52  Aligned_cols=64  Identities=20%  Similarity=0.237  Sum_probs=25.5

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHH----HHHHHCCCCEEEEECCC
Q ss_conf             997999940788615289999999997699479980787433668897898----87420268689996488
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLM----EKFINEGAQLIITVDCG  159 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i----~~~~~~g~~LiItvD~G  159 (600)
                      .++++|++|--+.-.--..-+...|+..|.++..|--.+..    .+.+.+    +.+.+.+++.||.+--|
T Consensus        31 ~~~~livt~~~~~~~~~~~~i~~~l~~~~i~~~~~~~~~~~----~t~~~v~~~~~~~~~~~~D~iiaiGGG   98 (183)
T 1rrm_A           31 YQKALIVTDKTLVQCGVVAKVTDKXDAAGLAWAIYDGVVPN----PTITVVKEGLGVFQNSGADYLIAIGGG   98 (183)
T ss_dssp             CCEEEEECBHHHHHTTHHHHHHHHHHHTTCEEEEECBCCSS----CBHHHHHHHHHHHHHHTCSEEEEEESH
T ss_pred             CCEEEEEECCCHHHCCHHHHHHHHHHHCCCEEEEECCCCCC----CCHHHHHHHHHHHHCCCCCEEEECCCC
T ss_conf             98799998977565827999999998759839998784799----799999998655503588879976886


No 345
>>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2} (A:1-127,A:265-275)
Probab=37.03  E-value=23  Score=14.50  Aligned_cols=84  Identities=18%  Similarity=0.118  Sum_probs=42.0

Q ss_pred             CCEEEEEC-CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC--CCHHHHHHH
Q ss_conf             97999940-788615289999999997699479980787433668897898874202686899964887--623455555
Q gi|254780901|r   93 EKIMIFGD-YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS--TSYDALQYA  169 (600)
Q Consensus        93 ekI~I~gD-yD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi--~~~e~i~~a  169 (600)
                      ++|.|+.- .+-.+.....-+.+.|+..|.++.+..-..-..+.+.......+...++++++|++  |=  |-.+.+..+
T Consensus         6 kkv~ii~n~~~~~~~~~~~~i~~~L~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~vv~~--GGDGTil~a~~~l   83 (138)
T 2an1_A            6 KCIGIVGHPRHPTALTTHEMLYRWLCDQGYEVIVEQQIAHELQLKNVPTGTLAEIGQQADLAVVV--GGDGNMLGAARTL   83 (138)
T ss_dssp             CEEEEECC-------CHHHHHHHHHHHTTCEEEEEHHHHHHTTCSSCCEECHHHHHHHCSEEEEC--SCHHHHHHHHHHH
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHCCCCCCCCCCHHHHCCCCCEEEEE--CCCCHHHHHHHHH
T ss_conf             68999950899799999999999999786999980789876399888846655725477689997--7883598886764


Q ss_pred             HHCCCCEEE
Q ss_conf             417982799
Q gi|254780901|r  170 TNQGIDVIV  178 (600)
Q Consensus       170 ~~~GidvIV  178 (600)
                      ...++.|++
T Consensus        84 ~~~~ipi~~   92 (138)
T 2an1_A           84 ARYDINVIG   92 (138)
T ss_dssp             TTSSCEEEE
T ss_pred             CCCCCEEEE
T ss_conf             255745997


No 346
>>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, alternative splicing, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* (A:159-289)
Probab=36.91  E-value=23  Score=14.49  Aligned_cols=74  Identities=12%  Similarity=0.110  Sum_probs=34.7

Q ss_pred             HCCCCEEEEECCCCCHHHHHHH-HHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             7799799994078861528999-999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVAL-MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstai-l~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      +.+++|+|+|     |.++... .....+..|+++.....         +++..+.+++.|.+-+|.. ..-...+++..
T Consensus         3 k~G~~Vli~g-----g~g~vG~~~iqla~~~g~~vi~~~~---------~~~~~~~~~~~ga~~~i~~-~~~~~~~~~~~   67 (131)
T 2j8z_A            3 QAGDYVLIHA-----GLSGVGTAAIQLTRMAGAIPLVTAG---------SQKKLQMAEKLGAAAGFNY-KKEDFSEATLK   67 (131)
T ss_dssp             CTTCEEEESS-----TTSHHHHHHHHHHHHTTCEEEEEES---------CHHHHHHHHHHTCSEEEET-TTSCHHHHHHH
T ss_pred             CCCCEEEEEE-----CCCCHHEEEEECCCCCCCCCEEEEE---------CHHHHHHHHHHCCCEEECC-CCCCHHHHHHH
T ss_conf             9999899962-----8975310023411232444269981---------0454445665133113202-45216899999


Q ss_pred             HH-HCCCCEEE
Q ss_conf             54-17982799
Q gi|254780901|r  169 AT-NQGIDVIV  178 (600)
Q Consensus       169 a~-~~GidvIV  178 (600)
                      .. ..|.|+++
T Consensus        68 ~~~~~~~d~v~   78 (131)
T 2j8z_A           68 FTKGAGVNLIL   78 (131)
T ss_dssp             HTTTSCEEEEE
T ss_pred             HHCCCCCEEEE
T ss_conf             85799837999


No 347
>>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} (A:)
Probab=36.88  E-value=23  Score=14.48  Aligned_cols=91  Identities=4%  Similarity=-0.014  Sum_probs=56.7

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC--CEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH
Q ss_conf             977997999940788615289999999997699--479980787433668897898874202686899964887623455
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV--NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~--~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i  166 (600)
                      ..+.-||+++|   .++.+...-+.+.|..-+.  .+.+.+|+|-..      ...+.+.+.+...+++-.-.....+.+
T Consensus         5 ~~~~~ki~~~g---s~~~s~~~~~l~~l~~~~~~~~iv~~~~~~~~~------~~~~~a~~~~i~~~~~~~~~~~~~~~~   75 (215)
T 3kcq_A            5 MKKELRVGVLI---SGRGSNLEALAKAFSTEESSVVISCVISNNAEA------RGLLIAQSYGIPTFVVKRKPLDIEHIS   75 (215)
T ss_dssp             --CCEEEEEEE---SSCCHHHHHHHHHTCCC-CSEEEEEEEESCTTC------THHHHHHHTTCCEEECCBTTBCHHHHH
T ss_pred             CCCCCEEEEEE---ECCCHHHHHHHHHHHCCCCCEEEEEEEECCCCC------HHHHHHHHCCCCEEECCCCCCCHHHHH
T ss_conf             89987899999---498774999999977699883999999579653------777787763998763378650689999


Q ss_pred             HHHHHCCCCEEEECC--CCCCCCC
Q ss_conf             555417982799615--4476555
Q gi|254780901|r  167 QYATNQGIDVIVIDH--HQVKSEE  188 (600)
Q Consensus       167 ~~a~~~GidvIVtDH--H~~~~~~  188 (600)
                      +..++.+.|++|+=+  +..+.+.
T Consensus        76 ~~l~~~~~Dl~v~~~~~~ii~~~~   99 (215)
T 3kcq_A           76 TVLREHDVDLVCLAGFMSILPEKF   99 (215)
T ss_dssp             HHHHHTTCSEEEESSCCSCCCHHH
T ss_pred             HHHHHCCCCEEEEECCHHHCCHHH
T ss_conf             999874999999924002267655


No 348
>>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg, hyperthermophIle; HET: PLP; 2.33A {Pyrococcus furiosus dsm 3638} (A:99-284)
Probab=36.85  E-value=23  Score=14.48  Aligned_cols=136  Identities=13%  Similarity=0.112  Sum_probs=82.0

Q ss_pred             CCHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             48799999999999-77997999940788615289999999997699479980787433668897898874202686899
Q gi|254780901|r   76 TDCDKAARRIVQAI-YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLII  154 (600)
Q Consensus        76 ~dm~~A~~ri~~ai-~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiI  154 (600)
                      .+...|...+.+++ +.+.+|++..-+       -.-....++..|.++..+ |-+...++.+..+.+........++++
T Consensus        10 ~G~~~ai~~~~~~l~~pgd~vi~~~p~-------y~~~~~~~~~~g~~~~~v-~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (186)
T 1xi9_A           10 AAVTEALQLIFGALLDPGDEILVPGPS-------YPPYTGLVKFYGGKPVEY-RTIEEEDWQPDIDDIRKKITDRTKAIA   81 (186)
T ss_dssp             SHHHHHHHHHHHHHCCTTCEEEEEESC-------CHHHHHHHHHTTCEEEEE-EEEGGGTSEECHHHHHHHCCTTEEEEE
T ss_pred             CCCHHHHHHHHHHHCCCCCEEEECCCC-------CCCHHHHHHHCCCEEEEE-ECCCCCCCCCCHHHHHHHHCCCCCEEE
T ss_conf             231112101223203799989982783-------331077898739767997-511345866577999997425765899


Q ss_pred             EECCCC----C-CH----HHHHHHHHCCCCEEEECCCCCC---CCCCCCEEEECC-CCCCCCCCCCCH--HHHHHHHHHH
Q ss_conf             964887----6-23----4555554179827996154476---555672565237-888864334430--4788999999
Q gi|254780901|r  155 TVDCGS----T-SY----DALQYATNQGIDVIVIDHHQVK---SEEIPAYALVNP-NRLDDLSGQGHL--CAAGVVFLVL  219 (600)
Q Consensus       155 tvD~Gi----~-~~----e~i~~a~~~GidvIVtDHH~~~---~~~p~a~aivNP-~~~~~~~p~~~l--~gaGvaf~l~  219 (600)
                      .+-+..    . ..    +-++.+++.|+-+|+=|-|..-   +..++......+ +..-..+..|.+  +|..+.|.++
T Consensus        82 ~~~p~nPtG~~~~~~~l~~i~~~~~~~~~~ii~D~ay~~~~~~~~~~~~~~~~~~~~~i~~~S~SK~~g~~G~R~G~~i~  161 (186)
T 1xi9_A           82 VINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYF  161 (186)
T ss_dssp             EESSCTTTCCCCCHHHHHHHHHHHHHHTCCEEEECTTTTCBSSSCCCCHHHHCSSSCEEEEEESTTTTCCGGGCCEEEEE
T ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHCCEEEECCCCHHCCCCCCCCCCHHHCCCCCCEEEEECCCHHCCCCCCCEECCCC
T ss_conf             81899974512308999999854422480111231011023334555702117888889995860324054000044112


No 349
>>2iye_A Copper-transporting ATPase; hydrolase, P-type ATPase, CPX-ATPase, COPB, heavy metal translocation; 2.6A {Sulfolobus solfataricus} (A:1-39,A:139-263)
Probab=36.81  E-value=23  Score=14.48  Aligned_cols=28  Identities=29%  Similarity=0.447  Sum_probs=11.0

Q ss_pred             CEEEEECCCC--CCHHHHHHHHHCCCCEEE
Q ss_conf             6899964887--623455555417982799
Q gi|254780901|r  151 QLIITVDCGS--TSYDALQYATNQGIDVIV  178 (600)
Q Consensus       151 ~LiItvD~Gi--~~~e~i~~a~~~GidvIV  178 (600)
                      +-+|+=-.|+  .+.+.++.+++.|+.|+|
T Consensus        29 ~~~~~~~~~~~P~a~e~I~~L~~~Gi~v~I   58 (164)
T 2iye_A           29 DTIIFDKTGTLPNLKDYLEKLKNEGLKIII   58 (164)
T ss_dssp             CEEEEESTTTTSCCHHHHHHHHGGGCEEEE
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHCCCCEEE
T ss_conf             999991885231299999999975992798


No 350
>>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrolase, cellulose degradation; 1.60A {Clostridium cellulolyticum H10} (A:)
Probab=36.56  E-value=23  Score=14.45  Aligned_cols=54  Identities=17%  Similarity=0.285  Sum_probs=31.7

Q ss_pred             CCCCHHHHHHHHHCCCCEEEE-E--------CCCCCC---H----HHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             688978988742026868999-6--------488762---3----4555554179827996154476555
Q gi|254780901|r  135 YGPNPSLMEKFINEGAQLIIT-V--------DCGSTS---Y----DALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       135 YGl~~~~i~~~~~~g~~LiIt-v--------D~Gi~~---~----e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      |-+.++-++.+++.|.+.|=. +        +.+.-+   .    +.++.|++.||.|||.=||.+....
T Consensus        60 ~~~~e~D~~~i~~~G~n~vRipi~~~~~~~~~~~~~~~~~l~~ld~~i~~a~~~gl~vildlh~~~~~~~  129 (380)
T 1edg_A           60 IKTTKQMIDAIKQKGFNTVRIPVSWHPHVSGSDYKISDVWMNRVQEVVNYCIDNKMYVILNTHHDVDKVK  129 (380)
T ss_dssp             SCCCHHHHHHHHHHTCCEEEECCCCGGGEETTTTEECHHHHHHHHHHHHHHHTTTCEEEEECCSCBCTTT
T ss_pred             CCCCHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             6156999999998699869981417872578998429899999999999999889989997346777666


No 351
>>3f2b_A DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* (A:111-405)
Probab=36.48  E-value=23  Score=14.44  Aligned_cols=56  Identities=20%  Similarity=0.223  Sum_probs=35.8

Q ss_pred             EEEEECCCCC--CCCCCCHHHHHHHHHCCCCEEEEECCCC-C-CHHHHHHHHHCCCCEEE
Q ss_conf             7998078743--3668897898874202686899964887-6-23455555417982799
Q gi|254780901|r  123 ANMYIPDRIV--DGYGPNPSLMEKFINEGAQLIITVDCGS-T-SYDALQYATNQGIDVIV  178 (600)
Q Consensus       123 v~~~IP~R~~--eGYGl~~~~i~~~~~~g~~LiItvD~Gi-~-~~e~i~~a~~~GidvIV  178 (600)
                      +..|+-.-++  ||-.--.+.++.+++.|.+.|-..|-++ . ..+..+.+++.|+.+|+
T Consensus         7 ~dlH~HT~~S~lDg~~~p~~lv~~A~~~Gl~~iaiTDH~~~~g~~~~~~~~~~~~i~~i~   66 (295)
T 3f2b_A            7 VELHLHTPMSQMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHGMKVIY   66 (295)
T ss_dssp             CBCCBCCTTSTTTCCSCHHHHHHHHHHTTCSCEEECCBSCCTTHHHHHHHHHHHTCCEEE
T ss_pred             EEECCCCCCHHHHHCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             670478755443002799999999998599999993038587899999999986998699


No 352
>>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A (A:1-192,A:357-375)
Probab=36.43  E-value=23  Score=14.43  Aligned_cols=41  Identities=12%  Similarity=0.055  Sum_probs=27.5

Q ss_pred             HHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             87420268689996488762345555541798279961544
Q gi|254780901|r  143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       143 ~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      .-+.+..++++++.+-+.++.-..-.|+.+||.|+...+-.
T Consensus        89 ~~l~~~kPD~V~v~~~~~~~l~~~laA~~~~IPvv~~~~~~  129 (211)
T 3beo_A           89 KVMKEAKPDIVLVHGDTTTTFIASLAAFYNQIPVGHVEAGL  129 (211)
T ss_dssp             HHHHHHCCSEEEEETTSHHHHHHHHHHHHTTCCEEEESCCC
T ss_pred             HHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCEEEEEECCC
T ss_conf             98874475504420145642015888873063179985245


No 353
>>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'- phosphate, hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} (A:1-62,A:273-416)
Probab=36.34  E-value=23  Score=14.42  Aligned_cols=59  Identities=10%  Similarity=0.026  Sum_probs=40.1

Q ss_pred             EEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCC---CC-CEEECCCCHHHHHHHHHHHHHHHC
Q ss_conf             999864898618888885303353011565322---23-146422215889999999998622
Q gi|254780901|r  410 IGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAM---AA-GLTVERVNFGRLCDFFQKFAHNIV  468 (600)
Q Consensus       410 kGS~RSi~g~~l~~~l~~~~~~~ll~~~GGH~~---Aa-G~ti~~~~l~~f~~~l~~~~~~~~  468 (600)
                      .|+.=+.++.+-.++...|.+++++..++++..   +- -+....+.++.|.+.+.+.+.+..
T Consensus       131 ~~~~~~~~~~~~~~v~~~L~~~Gvi~d~r~p~vIR~sp~PLy~t~~dId~~v~~L~~~l~~~~  193 (206)
T 1qz9_A          131 RGSHVSFEHPEGYAVIQALIDRGVIGDYREPRIMRFGFTPLYTTFTEVWDAVQILGEILDRKT  193 (206)
T ss_dssp             BCSEEEEECTTHHHHHHHHHTTTEECEEETTTEEEEECCTTTCCHHHHHHHHHHHHHHHHHTT
T ss_pred             CEEEEEECCCCHHHHHHHHHHCCCEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCH
T ss_conf             246999837999999999987898973269987999799778999999999999999997060


No 354
>>1m1n_A Nitrogenase molybdenum-iron protein alpha chain; atomic resolution, FEMO cofactor, nitrogen fixation, central nitrogen ligand; HET: HCA CLF CFN; 1.16A {Azotobacter vinelandii} (A:213-298)
Probab=36.34  E-value=23  Score=14.42  Aligned_cols=79  Identities=15%  Similarity=0.127  Sum_probs=49.1

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             77997999940788615289999999997699479980787433668897898874202686899964887623455555
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA  169 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a  169 (600)
                      +.+.+|-|+|+|---|=  ..-+.+.|+.+|.+|...+|.      |-+.+-++++...  ++-|.+ |..+.....+++
T Consensus         5 ~~~~~VNiig~~~~~~d--~~eik~lL~~~Gi~v~~~~~~------~~s~~ei~~~~~A--~~niv~-~~~~g~~~a~~L   73 (86)
T 1m1n_A            5 STPYDVAIIGDYNIGGD--AWSSRILLEEMGLRCVAQWSG------DGSISEIELTPKV--KLNLVH-CYRSMNYISRHM   73 (86)
T ss_dssp             CCTTEEEEEEECCBTTT--THHHHHHHHHTTCEEEEEEET------TCCHHHHHHGGGC--SEEEES-CHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCC--HHHHHHHHHHCCCEEEEECCC------CCCHHHHHHHCCC--CEEEEE-CHHHHHHHHHHH
T ss_conf             78775455788888335--999999999729815997789------9878999861027--689984-678899999999


Q ss_pred             -HHCCCCEEEE
Q ss_conf             -4179827996
Q gi|254780901|r  170 -TNQGIDVIVI  179 (600)
Q Consensus       170 -~~~GidvIVt  179 (600)
                       ++.|+..+..
T Consensus        74 ~e~~GiPyi~~   84 (86)
T 1m1n_A           74 EEKYGIPWMEY   84 (86)
T ss_dssp             HHHHCCCEEEC
T ss_pred             HHHHCCCEEEC
T ss_conf             99739864305


No 355
>>1z9f_A Single-strand binding protein; TM0604, single stranded DNA-binding protein, structural genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} (A:)
Probab=36.32  E-value=23  Score=14.42  Aligned_cols=54  Identities=9%  Similarity=0.203  Sum_probs=38.6

Q ss_pred             EEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEEEEEECCC-----CEEEEEEEEEEECCCC
Q ss_conf             7999997787870123553069987999999766545781-----1058999980111311
Q gi|254780901|r  540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGS-----KRCQLRVLDASPVEGH  595 (600)
Q Consensus       540 ~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~~N~~~G~-----~s~QL~I~Di~p~e~~  595 (600)
                      .+++++|+-....+.++  ...|..+-|.+++..+.|.++     .++++.+.++...+..
T Consensus        64 ~~~v~~~g~~A~~~~~~--l~KG~~V~V~G~l~~~~~~~~~G~~~~~~~i~a~~i~~l~~~  122 (153)
T 1z9f_A           64 FFRIVTFGRLAEFARTY--LTKGRLVLVEGEMRMRRWETPTGEKRVSPEVVANVVRFMDRK  122 (153)
T ss_dssp             EEEEEEEHHHHHHHHHH--CCTTCEEEEEEEEEEEC-------CCCEEEEEEEEEEECC--
T ss_pred             EEEEEECCCCCHHHHHH--CCCCCEEEEEEEEEEEEEECCCCCEEEEEEEEEEEEEECCCC
T ss_conf             24445300000011120--158848999996664378999998999999999489987677


No 356
>>3cg4_A Response regulator receiver domain protein (CHEY- like); structural genomics, unknown function, uncharacterized protein; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} (A:)
Probab=36.25  E-value=23  Score=14.41  Aligned_cols=82  Identities=11%  Similarity=0.182  Sum_probs=51.8

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC---HHHH
Q ss_conf             7799799994078861528999999999769947998078743366889789887420268689996488762---3455
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS---YDAL  166 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~---~e~i  166 (600)
                      +++.+|+|.-    |--+....+...|...|.++...     .+    -.++++.+.+..+++|| +|.....   ++-+
T Consensus         5 ~~~~~ILiVD----D~~~~~~~l~~~L~~~g~~v~~a-----~~----~~~al~~l~~~~~dlvi-lD~~mP~~dG~~l~   70 (142)
T 3cg4_A            5 EHKGDVXIVD----DDAHVRIAVKTILSDAGFHIISA-----DS----GGQCIDLLKKGFSGVVL-LDIXXPGXDGWDTI   70 (142)
T ss_dssp             -CCCEEEEEC----SCHHHHHHHHHHHHHTTCEEEEE-----SS----HHHHHHHHHTCCCEEEE-EESCCSSSCHHHHH
T ss_pred             CCCCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEE-----CC----HHHHHHHHHHCCCCEEE-EECCCCCCCHHHHH
T ss_conf             8999099997----98999999999999879999997-----88----79999998705766445-40356799889999


Q ss_pred             HHHHHC----CCCEEE-ECCCCCC
Q ss_conf             555417----982799-6154476
Q gi|254780901|r  167 QYATNQ----GIDVIV-IDHHQVK  185 (600)
Q Consensus       167 ~~a~~~----GidvIV-tDHH~~~  185 (600)
                      ...++.    .+-||+ |.+..+.
T Consensus        71 ~~ir~~~~~~~~piI~ls~~~~~~   94 (142)
T 3cg4_A           71 RAILDNSLEQGIAIVXLTAKNAPD   94 (142)
T ss_dssp             HHHHHTTCCTTEEEEEEECTTCCC
T ss_pred             HHHHHCCCCCCCEEEEECCCCCHH
T ss_conf             999860545898199982778889


No 357
>>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* (A:175-354)
Probab=36.07  E-value=24  Score=14.39  Aligned_cols=81  Identities=11%  Similarity=0.101  Sum_probs=49.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--C------CCC-CCC--CHHHHHHHHH
Q ss_conf             9999999999977997999940788615289999999997699479980787--4------336-688--9789887420
Q gi|254780901|r   79 DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--I------VDG-YGP--NPSLMEKFIN  147 (600)
Q Consensus        79 ~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~------~eG-YGl--~~~~i~~~~~  147 (600)
                      +.+++.+.+.+.+-++.+|+.+..+-  -+..-+.++.+.+|+-|......+  +      --| ||.  +.. ..++.+
T Consensus        14 ~~~i~~~~~~L~~Ak~Pvii~G~g~~--~a~~~l~~lae~~~~Pv~~t~~~kg~~~~~~p~~~G~~g~~~~~~-~~~~l~   90 (180)
T 3eya_A           14 EEELRKLAQLLRYSSNIALMCGSGCA--GAHKELVEFAGKIKAPIVHALRGKEHVEYDNPYDVGMTGLIGFSS-GFHTMM   90 (180)
T ss_dssp             HHHHHHHHHHHHTCCSEEEEECGGGT--TCHHHHHHHHHHHTCCEEECGGGHHHHSSSCTTBCCCCSTTSCHH-HHHHHH
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCC--HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH-HHHEEE
T ss_conf             89999999986404650899446543--048999986764148743234433234567763212233333310-011021


Q ss_pred             CCCCEEEEECCCCCCH
Q ss_conf             2686899964887623
Q gi|254780901|r  148 EGAQLIITVDCGSTSY  163 (600)
Q Consensus       148 ~g~~LiItvD~Gi~~~  163 (600)
                      + ++|||.+.+-....
T Consensus        91 ~-aDlil~iG~~~~~~  105 (180)
T 3eya_A           91 N-ADTLVLLGTQFPYR  105 (180)
T ss_dssp             H-CSEEEEESCCCCCG
T ss_pred             C-CCCEEEEEEECCCC
T ss_conf             2-44237986403654


No 358
>>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} (A:143-315)
Probab=35.83  E-value=24  Score=14.36  Aligned_cols=77  Identities=14%  Similarity=0.122  Sum_probs=46.8

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH--
Q ss_conf             977997999940788615289999999997699479980787433668897898874202686899964887623455--
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL--  166 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i--  166 (600)
                      ++.+++++|.|   +-|+-..  ....++..|+++.....         +.+..+.+++.|++.+|..+.........  
T Consensus        24 i~~g~~vlI~G---aG~vG~~--a~qla~~~G~~vi~v~~---------~~~~~~~~~~lGa~~~i~~~~~~~~~~~~~~   89 (173)
T 1e3j_A           24 VQLGTTVLVIG---AGPIGLV--SVLAAKAYGAFVVCTAR---------SPRRLEVAKNCGADVTLVVDPAKEEESSIIE   89 (173)
T ss_dssp             CCTTCEEEEEC---CSHHHHH--HHHHHHHTTCEEEEEES---------CHHHHHHHHHTTCSEEEECCTTTSCHHHHHH
T ss_pred             CCCCCEEEEEC---CCCCHHH--HHHHHHHCCCEEEEEEC---------CHHHHHHHHHCCCCEEEECCCCCCCHHHHHH
T ss_conf             99999899989---8730458--99999987998999968---------8899999997399989975887423789999


Q ss_pred             --HHHHHCCCCEEEE
Q ss_conf             --5554179827996
Q gi|254780901|r  167 --QYATNQGIDVIVI  179 (600)
Q Consensus       167 --~~a~~~GidvIVt  179 (600)
                        ......|.|+++-
T Consensus        90 ~~~~~~~~g~d~v~d  104 (173)
T 1e3j_A           90 RIRSAIGDLPNVTID  104 (173)
T ss_dssp             HHHHHSSSCCSEEEE
T ss_pred             HHHHHCCCCCCEEEE
T ss_conf             998633887639998


No 359
>>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.50A {Lactobacillus plantarum} (A:1-18,A:79-209)
Probab=35.76  E-value=24  Score=14.36  Aligned_cols=112  Identities=8%  Similarity=-0.017  Sum_probs=65.7

Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC--EEEEECCCCCCCCCCCHHHHHHHHHC-
Q ss_conf             556148799999999999779979999407886152899999999976994--79980787433668897898874202-
Q gi|254780901|r   72 PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN--ANMYIPDRIVDGYGPNPSLMEKFINE-  148 (600)
Q Consensus        72 P~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~--v~~~IP~R~~eGYGl~~~~i~~~~~~-  148 (600)
                      ...++++.++.+.    ++.+-++.|....+      ...+-..|+.+|..  +...+-.-....+-.+++.+..+.+. 
T Consensus        22 ~~~~pgv~e~L~~----Lk~g~~i~ivTn~~------~~~~~~~l~~~gl~~~f~~i~~~~~~~~~KP~~~~~~~~~~~~   91 (149)
T 2hdo_A           22 IELYPGITSLFEQ----LPSELRLGIVTSQR------RNELESGXRSYPFXXRXAVTISADDTPKRKPDPLPLLTALEKV   91 (149)
T ss_dssp             CEECTTHHHHHHH----SCTTSEEEEECSSC------HHHHHHHHTTSGGGGGEEEEECGGGSSCCTTSSHHHHHHHHHT
T ss_pred             CCCCCCHHHHHCC----CCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             3346403443002----22355410013322------2221111222222222222222222211212567788887724


Q ss_pred             CC--CEEEEECCCCCCHHHHHHHHHCCCCEEEE-CCCCCCCCCCCCEEEEC
Q ss_conf             68--68999648876234555554179827996-15447655567256523
Q gi|254780901|r  149 GA--QLIITVDCGSTSYDALQYATNQGIDVIVI-DHHQVKSEEIPAYALVN  196 (600)
Q Consensus       149 g~--~LiItvD~Gi~~~e~i~~a~~~GidvIVt-DHH~~~~~~p~a~aivN  196 (600)
                      ++  +=++.++-   +...+..|+..|+.+|-. .-.....+.+.+..+++
T Consensus        92 ~~~p~~~i~IgD---~~~Di~~A~~aG~~~i~v~~~~~~~~~~~~~~~~i~  139 (149)
T 2hdo_A           92 NVAPQNALFIGD---SVSDEQTAQAANVDFGLAVWGXDPNADHQKVAHRFQ  139 (149)
T ss_dssp             TCCGGGEEEEES---SHHHHHHHHHHTCEEEEEGGGCCTTGGGSCCSEEES
T ss_pred             CCCHHHEEEECC---CHHHHHHHHHCCCEEEEEECCCCCHHHHHHCCEEEC
T ss_conf             977221458547---787899999839929999279897567642492869


No 360
>>2j5c_A 1,8-cineole synthase; terpene synthases, 1, monoterpene, lyase; 1.95A {Salvia fruticosa} (A:119-224)
Probab=35.75  E-value=20  Score=14.92  Aligned_cols=37  Identities=22%  Similarity=0.254  Sum_probs=24.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC
Q ss_conf             0788615289999999997699479980787433668
Q gi|254780901|r  100 DYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYG  136 (600)
Q Consensus       100 DyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYG  136 (600)
                      |++-+.+..||+-.+.|++-|.+|..-+=.+|.+.=|
T Consensus         1 e~~~~DL~~~AL~FRLLRqhGy~Vs~dvf~~F~d~~g   37 (106)
T 2j5c_A            1 EIDERDLYSTALRFRLLRQYDFSVSQEVFDCFKNAKG   37 (106)
T ss_dssp             CSCTTCHHHHHHHHHHHHHTTCCCCGGGGGGGBCSSS
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCC
T ss_conf             6773668899999999996598869899954405798


No 361
>>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} (A:259-455)
Probab=35.63  E-value=24  Score=14.34  Aligned_cols=84  Identities=11%  Similarity=0.103  Sum_probs=57.6

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCHH-HHHHHHHHHHHHCCCCEEEEECCC--CCC------C-CCCC-HHHHHH
Q ss_conf             4879999999999977997999940788615-289999999997699479980787--433------6-6889-789887
Q gi|254780901|r   76 TDCDKAARRIVQAIYNSEKIMIFGDYDVDGA-ASVALMMRFLSHCSVNANMYIPDR--IVD------G-YGPN-PSLMEK  144 (600)
Q Consensus        76 ~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGi-tstail~~~L~~~g~~v~~~IP~R--~~e------G-YGl~-~~~i~~  144 (600)
                      ..-..+++++.+.+.+-++-+|+.+..++-. -+...+.++.+.+|+-|......|  +.+      | ||.. ......
T Consensus        15 ~~~~~~i~~~~~~L~~A~rPvii~G~~~~~~~~a~~~l~~lae~~~ipv~~t~~~kg~~~~~~p~~~G~~G~~~~~~~~~   94 (197)
T 1t9b_A           15 EFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDMLGMHGCATANL   94 (197)
T ss_dssp             -CHHHHHHHHHHHHHTCSSEEEEECGGGGGSTTHHHHHHHHHHHTTCCEEECGGGTTSSCTTSTTEEEECSTTSCHHHHH
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCHHHHHCCCCCHHHHHH
T ss_conf             54689999999999837798798326643004689999999872141279866667766875640122145423588998


Q ss_pred             HHHCCCCEEEEECCCC
Q ss_conf             4202686899964887
Q gi|254780901|r  145 FINEGAQLIITVDCGS  160 (600)
Q Consensus       145 ~~~~g~~LiItvD~Gi  160 (600)
                      +.++ ++|||.+.+=.
T Consensus        95 ~i~~-aDlil~iG~~~  109 (197)
T 1t9b_A           95 AVQN-ADLIIAVGARF  109 (197)
T ss_dssp             HHHH-CSEEEEESCCC
T ss_pred             HHCC-CCEEEEECCCC
T ss_conf             7715-99899989977


No 362
>>1zgz_A Torcad operon transcriptional regulatory protein TORR; two-component system, gene regulation, transcription factor, TMAO respiratory system; 1.80A {Escherichia coli} (A:)
Probab=35.62  E-value=24  Score=14.34  Aligned_cols=18  Identities=28%  Similarity=0.490  Sum_probs=6.6

Q ss_pred             HHHHHCCCCEEEECCCCC
Q ss_conf             555417982799615447
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~  184 (600)
                      +.+.+...|+||+|.+.|
T Consensus        40 ~~~~~~~~dliilD~~mp   57 (122)
T 1zgz_A           40 EIXQNQSVDLILLDINLP   57 (122)
T ss_dssp             HHHHHSCCSEEEEESCCS
T ss_pred             HHHHCCCCCEEEEEHHCC
T ss_conf             997515996886500104


No 363
>>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate- loop, pyridoxal phosphate, selenocysteine synthase (SECS; HET: LLP; 1.65A {Mus musculus} (A:334-450)
Probab=35.57  E-value=20  Score=14.91  Aligned_cols=35  Identities=14%  Similarity=0.068  Sum_probs=28.2

Q ss_pred             CCCCCCCC---------CCCCEEECCCCHHHHHHHHHHHHHHHC
Q ss_conf             01156532---------223146422215889999999998622
Q gi|254780901|r  434 LVKGGGHA---------MAAGLTVERVNFGRLCDFFQKFAHNIV  468 (600)
Q Consensus       434 l~~~GGH~---------~AaG~ti~~~~l~~f~~~l~~~~~~~~  468 (600)
                      |..||-|.         +||++-++++.++.|.++|++......
T Consensus        68 F~~fGsh~~~yp~~Ylt~AaaIG~~~~dvd~f~~rLdk~~~~~~  111 (117)
T 3bc8_A           68 FRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIVR  111 (117)
T ss_dssp             EETTTTTSSCCSSCEEEEECCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             65338761247777499982489999999999999999999985


No 364
>>1eu1_A Dimethyl sulfoxide reductase; molybdenum, molybdenum cofactor, DMSO, molybdopterin, MGD, oxidoreductase; HET: GLC MGD EPE; 1.30A {Rhodobacter sphaeroides} (A:146-375,A:585-619)
Probab=35.31  E-value=24  Score=14.31  Aligned_cols=67  Identities=15%  Similarity=0.233  Sum_probs=39.5

Q ss_pred             CCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHH---------------HHHHHHHCCCCEEEECCCCCCCCCCCCEEEEC
Q ss_conf             336688978988742026868999648876234---------------55555417982799615447655567256523
Q gi|254780901|r  132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYD---------------ALQYATNQGIDVIVIDHHQVKSEEIPAYALVN  196 (600)
Q Consensus       132 ~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e---------------~i~~a~~~GidvIVtDHH~~~~~~p~a~aivN  196 (600)
                      ..+||-.....+++..  ++++|.+  |++..+               .+..++++|..+||+|.+.-+.-...|+.-|-
T Consensus        17 ~~~~G~~~~~~~D~~n--ad~ii~~--G~Np~~s~~~~~~~~~~~~~~~~~~~~~~G~klvvIdP~~t~ta~~~Ad~~l~   92 (265)
T 1eu1_A           17 LEVYEQQTAWPVVVEN--TDLMVFW--AADPMKTNEIGWVIPDHGAYAGMKALKEKGTRVIXINPVRTETADYFGADVVS   92 (265)
T ss_dssp             CCTTSCCSCHHHHHHH--CSEEEEE--SCCHHHHTTCCSSBCCCHHHHHHHHHHHHTCEEEEESSBCCHHHHHHTCEEEC
T ss_pred             CCCCCCCCCCHHHHHH--CCEEEEE--CCCHHHCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHCCEEEC
T ss_conf             4335777888778961--9989999--16868737542234316899999999977996999878767544562055867


Q ss_pred             CCCCCCC
Q ss_conf             7888864
Q gi|254780901|r  197 PNRLDDL  203 (600)
Q Consensus       197 P~~~~~~  203 (600)
                      + +++.+
T Consensus        93 i-rPGTD   98 (265)
T 1eu1_A           93 P-RPQTD   98 (265)
T ss_dssp             C-CTTCH
T ss_pred             C-CCCCH
T ss_conf             7-89948


No 365
>>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} (A:1-129)
Probab=35.26  E-value=24  Score=14.30  Aligned_cols=41  Identities=15%  Similarity=0.107  Sum_probs=15.3

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             88742026868999648876234555554179827996154
Q gi|254780901|r  142 MEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       142 i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH  182 (600)
                      ++.+...++..||.+..-.-+-+-++.|++.|+-++.|+++
T Consensus        73 ~~~~~~~~~~~iiit~~~~~~~~i~~~a~~~~iPil~t~~~  113 (129)
T 1ko7_A           73 MRKLCRPETPAIIVTRDLEPPEELIEAAKEHETPLITSKIA  113 (129)
T ss_dssp             HHHHCCTTCCCEEECTTCCCCHHHHHHHHHTTCCEEECCSC
T ss_pred             HHHHHCCCCCEEEEECCCCCCHHHHHHHHHHCCEEEECCCC
T ss_conf             99973679988999799999899999999819839984874


No 366
>>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} (A:1-124)
Probab=35.22  E-value=24  Score=14.30  Aligned_cols=65  Identities=11%  Similarity=0.196  Sum_probs=40.8

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             7997999940788615289999999997699479980787433668897898874202686899964887623455555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYA  169 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a  169 (600)
                      .+.+|+|.-    |--+...++...|+..|.+|...-     .    -.++++.+.+..++++|+ |...-.....+.+
T Consensus         4 ~~~~VLiVD----D~~~~~~~l~~~L~~~g~~v~~a~-----~----~~eal~~l~~~~~dlii~-D~~lP~~~g~e~~   68 (124)
T 2gwr_A            4 XRQRILVVD----DDASLAEXLTIVLRGEGFDTAVIG-----D----GTQALTAVRELRPDLVLL-DLXLPGXNGIDVC   68 (124)
T ss_dssp             CCCEEEEEC----SCHHHHHHHHHHHHHTTCEEEEEC-----C----GGGHHHHHHHHCCSEEEE-ESSCSSSCHHHHH
T ss_pred             CCCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHHCCCCCCCC-CCCCCCCCCCCCC
T ss_conf             788399998----999999999999997899999989-----9----999999998659982122-3221123322211


No 367
>>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* (A:144-328)
Probab=35.08  E-value=24  Score=14.39  Aligned_cols=35  Identities=11%  Similarity=0.270  Sum_probs=22.0

Q ss_pred             HHCCCCEEEEECCCCCHHHH-HHHHHHHHHHCCCCEEEEE
Q ss_conf             97799799994078861528-9999999997699479980
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAAS-VALMMRFLSHCSVNANMYI  127 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGits-tail~~~L~~~g~~v~~~I  127 (600)
                      ++.+++|+|+|    .|..+ .++.....+..|+.+.+..
T Consensus        27 ~~~g~~VlV~G----aG~~G~~~~~~~~a~~~g~~~v~~~   62 (185)
T 2b5w_A           27 DWDPSSAFVLG----NGSLGLLTLAMLKVDDKGYENLYCL   62 (185)
T ss_dssp             CCCCCEEEEEC----CSHHHHHHHHHHHHCTTCCCEEEEE
T ss_pred             CCCCCEEEEEC----CCCCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             64454057613----4551699999999837983788885


No 368
>>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} (A:523-662)
Probab=35.05  E-value=24  Score=14.28  Aligned_cols=21  Identities=14%  Similarity=0.251  Sum_probs=12.8

Q ss_pred             CHHHHHHHHHCCCCEEEECCC
Q ss_conf             234555554179827996154
Q gi|254780901|r  162 SYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       162 ~~e~i~~a~~~GidvIVtDHH  182 (600)
                      +..++..+++.|+++|+.+.-
T Consensus        60 ~~~~~~~Lk~~G~~tiliN~N   80 (140)
T 1a9x_A           60 CVHASLALREDGYETIMVNCN   80 (140)
T ss_dssp             HHHHHHHHHHTTCEEEEECCC
T ss_pred             HHHHHHHHHHCCCEEEEEECC
T ss_conf             899999998669868997168


No 369
>>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; HET: NAD; 2.05A {Pyrococcus horikoshii OT3} PDB: 2dfv_A* 3gfb_A* (A:146-314)
Probab=35.01  E-value=24  Score=14.27  Aligned_cols=87  Identities=14%  Similarity=0.161  Sum_probs=48.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             99999999997799799994078861528999999999769947998078743366889789887420268689996488
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      -|..-+...++.++.++|+|   +=|+-+  .....++..|..+.+.+-        -+.+.++.+.+.|++.++. ...
T Consensus        11 ta~~~l~~~~~~g~~vlI~G---ag~~g~--~a~~~a~~~g~~~vi~~~--------~~~~~~~~~~~~g~~~~~~-~~~   76 (169)
T 2d8a_A           11 NAVDTVLAGPISGKSVLITG---AGPLGL--LGIAVAKASGAYPVIVSE--------PSDFRRELAKKVGADYVIN-PFE   76 (169)
T ss_dssp             HHHHHHTTSCCTTCCEEEEC---CSHHHH--HHHHHHHHTTCCSEEEEC--------SCHHHHHHHHHHTCSEEEC-TTT
T ss_pred             HHHHHHHHCCCCCCEEEEEC---CCHHHH--HHHHHHHHCCCEEEEEEE--------CCHHHHHHHHHCCCCEEEC-CCC
T ss_conf             66666552047999899989---788999--999999975991899996--------9999999999709989987-999


Q ss_pred             CCCHHHHH-HHHHCCCCEEEEC
Q ss_conf             76234555-5541798279961
Q gi|254780901|r  160 STSYDALQ-YATNQGIDVIVID  180 (600)
Q Consensus       160 i~~~e~i~-~a~~~GidvIVtD  180 (600)
                      ....+++. .....|+|+++-.
T Consensus        77 ~~~~~~~~~~~~~~g~d~vid~   98 (169)
T 2d8a_A           77 EDVVKEVXDITDGNGVDVFLEF   98 (169)
T ss_dssp             SCHHHHHHHHTTTSCEEEEEEC
T ss_pred             CCHHHHHHHHHCCCCCEEEEEC
T ss_conf             7899999998389984399999


No 370
>>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} (A:189-373)
Probab=34.97  E-value=24  Score=14.27  Aligned_cols=102  Identities=15%  Similarity=0.268  Sum_probs=62.6

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC-HHHHHHHHHCCCCE
Q ss_conf             61487999999999997799799994078861528999999999769947998078743366889-78988742026868
Q gi|254780901|r   74 ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPN-PSLMEKFINEGAQL  152 (600)
Q Consensus        74 ~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~-~~~i~~~~~~g~~L  152 (600)
                      .+..++.-+-.+..+.+++.+.+|+.+ |+||=.-+.++.+-++-.---+....|     |||-+ ++.++++.----.-
T Consensus        37 ki~~~~~ilp~Le~~~~~~~pLlIiAe-dv~~eaL~~Li~N~~~g~~~v~aVkaP-----gfG~~rk~~L~DiAi~TG~~  110 (185)
T 1kp8_A           37 KISNIREMLPVLEAVAKAGKPLLIIAE-DVEGEALATLVVNTMRGIVKVAAVKAP-----GFGDRRKAMLQDIATLTGGT  110 (185)
T ss_dssp             EECCGGGTHHHHHHHHGGGCCEEEEES-EECHHHHHHHHHHGGGTSSCEEEEECS-----SCHHHHHHHHHHHHHHHTCC
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEEC-CCCHHHHHHHHHHHHHHHHHEEEECCC-----CCHHHHHHHHHHHHHHHCCE
T ss_conf             106799999999999975997899955-670999999999777513342434176-----30489999999999974999


Q ss_pred             EEEECCCCCCHHHHHHHHHCCC--CEEEECCCC
Q ss_conf             9996488762345555541798--279961544
Q gi|254780901|r  153 IITVDCGSTSYDALQYATNQGI--DVIVIDHHQ  183 (600)
Q Consensus       153 iItvD~Gi~~~e~i~~a~~~Gi--dvIVtDHH~  183 (600)
                      +|..|.|.+-.+.-  ...+|-  .|+||-++.
T Consensus       111 vi~~~~g~~le~~~--~~~LG~a~~v~vtkd~T  141 (185)
T 1kp8_A          111 VISEEIGMELEKAT--LEDLGQAKRVVINKDTT  141 (185)
T ss_dssp             CEEGGGTCCSTTCC--TTTSEEEEEEEECSSCE
T ss_pred             EECCCCCCCHHHCC--HHHCCCEEEEEECCCCC
T ss_conf             95220347644479--98879726999658761


No 371
>>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.07A {Escherichia coli K12} (A:1-94,A:422-459)
Probab=34.97  E-value=24  Score=14.27  Aligned_cols=87  Identities=14%  Similarity=0.080  Sum_probs=53.7

Q ss_pred             CCHHHHHHHHHHHHHH-CCCCEE-EEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHH---HHHHHHHCCCCEE
Q ss_conf             8615289999999997-699479-9807874336688978988742026868999648876234---5555541798279
Q gi|254780901|r  103 VDGAASVALMMRFLSH-CSVNAN-MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYD---ALQYATNQGIDVI  177 (600)
Q Consensus       103 ~DGitstail~~~L~~-~g~~v~-~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e---~i~~a~~~GidvI  177 (600)
                      +.|+..-.-+-+.... ..+++- .++|.++      ..++++++.+.|++.++.. -|.+..+   ..+.|++.||.+|
T Consensus        18 V~GipvY~SI~ei~~~p~~vDlaVI~vpp~~------v~~vi~ea~~~GvkvViIt-~G~~e~~~~~l~~~Ar~~GirII   90 (132)
T 3dmy_A           18 SQALTQVRRWDSACQKLPDANLALISVAGEY------AAELANQALDRNLNVXXFS-DNVTLEDEIQLKTRAREKGLLVX   90 (132)
T ss_dssp             --CCEEESSHHHHHHHSTTCCEEEECSCHHH------HHHHHHHHHHTTCEEEECC-CCCCHHHHHHHHHHHHHTTCCEE
T ss_pred             CCCCCCCCCHHHHHHCCCCCCEEEEEECHHH------HHHHHHHHHHCCCCEEEEE-CCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             6046755539999735899898999728899------9999999998799789995-99998999999999998799999


Q ss_pred             EECCCCCCCCCCCCEEEECCC
Q ss_conf             961544765556725652378
Q gi|254780901|r  178 VIDHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       178 VtDHH~~~~~~p~a~aivNP~  198 (600)
                      =-.-|.|  .+...++++|--
T Consensus        91 GPNC~~~--~~~~~~~~~~~~  109 (132)
T 3dmy_A           91 GPDCHTP--SLLENVAVINIG  109 (132)
T ss_dssp             CSSCCCC--HHHHCCCEEECS
T ss_pred             CCCCCCC--CCCCCCCHHHHH
T ss_conf             8998677--643342024432


No 372
>>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A (A:1-358)
Probab=34.63  E-value=25  Score=14.23  Aligned_cols=23  Identities=17%  Similarity=0.034  Sum_probs=10.7

Q ss_pred             EEEEECHHHCCHHHHHHHHHCCC
Q ss_conf             60443468979999999985184
Q gi|254780901|r  479 IDGVLNASAVNIALIDMLESAGP  501 (600)
Q Consensus       479 iD~el~~~~i~~~l~~~L~~leP  501 (600)
                      +|..+-+.....+--.++....|
T Consensus       255 ~D~VIvl~H~G~~~~~~~a~~~~  277 (358)
T 2wdc_A          255 ANAVVLLSHNGMQLDAALAERIR  277 (358)
T ss_dssp             CSEEEEEECSCHHHHHHHHTTSS
T ss_pred             CCEEEEECCCCCCCCHHHHHHCC
T ss_conf             99999954678542267775136


No 373
>>2poc_A D-fructose-6-, isomerase domain of glutamine-fructose-6- phosphate transaminase (isomerizing); glucosamine-6-phosphate synthase; HET: BG6 UD1; 1.80A {Candida albicans SC5314} PDB: 2put_A* 2puv_A* 2puw_A* (A:1-206)
Probab=34.57  E-value=25  Score=14.22  Aligned_cols=91  Identities=12%  Similarity=0.103  Sum_probs=48.8

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCHHHHHH-HHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH-CCCCEEEEECC-
Q ss_conf             99999999779979999407886152899-9999999769947998078743366889789887420-26868999648-
Q gi|254780901|r   82 ARRIVQAIYNSEKIMIFGDYDVDGAASVA-LMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN-EGAQLIITVDC-  158 (600)
Q Consensus        82 ~~ri~~ai~~~ekI~I~gDyD~DGitsta-il~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~-~g~~LiItvD~-  158 (600)
                      ++.+.+.+.+-++|.|||   +.+--..| -+...|..+|..+..+.+.     +    ........ ..-+++|.+-. 
T Consensus        40 ~~~~~~~l~~a~~I~i~G---~G~S~~~a~~~~~~l~~~g~~~~~~~~~-----~----~~~~~~~~~~~~dlvI~iS~s  107 (206)
T 2poc_A           40 LKSWLSTIRRCRRIIMIA---CGTSYHSCLATRSIFEELTEIPVSVELA-----S----DFLDRRSPVFRDDTCVFVSQS  107 (206)
T ss_dssp             TGGGHHHHHTSSEEEEEE---CHHHHHHHHHHHHHHHHHHCSCEEEEEH-----H----HHHHTTCCCCTTEEEEEEESS
T ss_pred             CHHHHHHHCCCCEEEEEE---CHHHHHHHHHHHHHHHHHHCCCCCEECC-----C----CCHHCCCCCCCCCEEEEEECC
T ss_conf             244488860589799997---2389999999999999862806510024-----2----101102335666449997369


Q ss_pred             CCC--CHHHHHHHHHCCCCEEE-ECCCCC
Q ss_conf             876--23455555417982799-615447
Q gi|254780901|r  159 GST--SYDALQYATNQGIDVIV-IDHHQV  184 (600)
Q Consensus       159 Gi~--~~e~i~~a~~~GidvIV-tDHH~~  184 (600)
                      |-+  -.+.++.|+++|..||. |+-...
T Consensus       108 G~t~~~i~~~~~a~~~g~~vI~IT~~~~s  136 (206)
T 2poc_A          108 GETADSILALQYCLERGALTVGIVNSVGS  136 (206)
T ss_dssp             SCCHHHHHHHHHHHHTTCEEEEEESSTTS
T ss_pred             CCCHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             99679999999998669859999547774


No 374
>>1j7j_A HPRT, hypoxanthine phosphoribosyltransferase; glycosyltransferase, nucleotide metabolism, purine salvage; 2.30A {Salmonella typhimurium} (A:1-11,A:151-178)
Probab=34.53  E-value=18  Score=15.29  Aligned_cols=20  Identities=30%  Similarity=0.579  Sum_probs=16.4

Q ss_pred             CCCEEEEECCCCCCCCCCCH
Q ss_conf             99479980787433668897
Q gi|254780901|r  120 SVNANMYIPDRIVDGYGPNP  139 (600)
Q Consensus       120 g~~v~~~IP~R~~eGYGl~~  139 (600)
                      ...|...||.+|-=||||.-
T Consensus         2 ~~~~~~~~~~~FVVGYGLDy   21 (39)
T 1j7j_A            2 KHTVEVMIPEEFVVGYGIDY   21 (39)
T ss_dssp             -CCEEEEECHCCEEBTTBCS
T ss_pred             CCCEEEECCHCEEEECCCCC
T ss_conf             97537965892399877247


No 375
>>2q2e_A Type II DNA topoisomerase VI subunit A; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} (A:142-297)
Probab=34.44  E-value=25  Score=14.21  Aligned_cols=36  Identities=17%  Similarity=0.162  Sum_probs=20.2

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHHCEEEEEEE
Q ss_conf             750262057858122222278998842010799886
Q gi|254780901|r  368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISF  403 (600)
Q Consensus       368 ~~~ivv~~~~wh~GViGIVAsrL~e~y~kP~iv~s~  403 (600)
                      .++++++..+++.--.-..-.+|.++-+-|++.+++
T Consensus        78 ~~~ili~~~G~p~~~tr~~l~~L~~~~~l~~~~~~D  113 (156)
T 2q2e_A           78 YNAILVHLKGQPARSTRRIIKRMNEELGIPVAVFTD  113 (156)
T ss_dssp             TCCCEEECCSSCCHHHHHHHHHHTTSSCCCEEEECC
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             556888079889878999999985361898899977


No 376
>>1vd6_A Glycerophosphoryl diester phosphodiesterase; glycerophosphodiester phosphodiesterase, glycerol complex; 1.30A {Thermus thermophilus HB8} (A:)
Probab=34.41  E-value=25  Score=14.20  Aligned_cols=28  Identities=14%  Similarity=0.336  Sum_probs=18.8

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             6234555554179827996154476555
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      ++.++...|.+.|.++|=+|=|.-.+..
T Consensus        23 NT~~af~~A~~~Ga~~iE~DV~lTkDg~   50 (224)
T 1vd6_A           23 NTLESFRLALEAGLDGVELDVWPTRDGV   50 (224)
T ss_dssp             TSHHHHHHHHHTTCSEEEEEEEECTTSC
T ss_pred             CHHHHHHHHHHCCCCEEEEEEEEECCCC
T ss_conf             0599999999869898999889946874


No 377
>>2gre_A Deblocking aminopeptidase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; 2.65A {Bacillus cereus} (A:1-72,A:171-349)
Probab=34.40  E-value=25  Score=14.20  Aligned_cols=132  Identities=11%  Similarity=0.087  Sum_probs=57.8

Q ss_pred             CCCCEEEEECCCC---------------CHHHHHHHHHHHHHHC---CC----CEE-EEECCCCCCCCCCCHHHHHHHHH
Q ss_conf             7997999940788---------------6152899999999976---99----479-98078743366889789887420
Q gi|254780901|r   91 NSEKIMIFGDYDV---------------DGAASVALMMRFLSHC---SV----NAN-MYIPDRIVDGYGPNPSLMEKFIN  147 (600)
Q Consensus        91 ~~ekI~I~gDyD~---------------DGitstail~~~L~~~---g~----~v~-~~IP~R~~eGYGl~~~~i~~~~~  147 (600)
                      .+..|++.|+||+               |.-++.+++..+++.+   +.    ++. .+.+.-....+|.. ..+++..+
T Consensus        60 ~~~~i~~~~h~D~v~~~~~~~~i~ggg~D~k~G~a~~L~~ar~L~~~~~~~~~~I~~~~~~~EE~g~~Gs~-~~~~~~~~  138 (251)
T 2gre_A           60 DAQHRLLTAHVDTRVQITESGYIKSRHLDDKVSVAILLKLIKRLQDENVTLPYTTHFLISNNEEIGYGGNS-NIPEETVE  138 (251)
T ss_dssp             EEEEEEEEEECCBCCEECTTSEEEESCCTTHHHHHHHHHHHHHHHHHTCCCSEEEEEEEESCC----CCCC-CCCTTEEE
T ss_pred             CCCEEEEEECCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCEECCCEEEEEECCCCC-CCCCCCCC
T ss_conf             99759998334438999950530010234532068899999975652445456512112035665024346-67676542


Q ss_pred             C----------------CCCEEEEECCCCCCHH-----HHHHHHHCCCCEEE---------ECCCCCCCCCCCCEEEECC
Q ss_conf             2----------------6868999648876234-----55555417982799---------6154476555672565237
Q gi|254780901|r  148 E----------------GAQLIITVDCGSTSYD-----ALQYATNQGIDVIV---------IDHHQVKSEEIPAYALVNP  197 (600)
Q Consensus       148 ~----------------g~~LiItvD~Gi~~~e-----~i~~a~~~GidvIV---------tDHH~~~~~~p~a~aivNP  197 (600)
                      .                ......+.+.+.....     ....+...++....         +||-.......++..+-+|
T Consensus       139 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~gi~~~~~~~~  218 (251)
T 2gre_A          139 YLAVDXGALGDGQASDEYTVSICAKDSSGPYHYALRKHLVELAKTNHIEYKVDIYPYYGSDASAAIRAGFDVKHALIGAG  218 (251)
T ss_dssp             EEEECCCCCSCC--CCTTSEEEEEEETTEECCHHHHHHHHHHHHHHTCCEEEEECSCC--------CCSSSCEEEEEEEC
T ss_pred             HHEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHCCCCCEEEECCC
T ss_conf             13033202466654443431465214433223320157787898739982387477734058999984899979998825


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             88886433443047889999999999
Q gi|254780901|r  198 NRLDDLSGQGHLCAAGVVFLVLVLIY  223 (600)
Q Consensus       198 ~~~~~~~p~~~l~gaGvaf~l~~al~  223 (600)
                      .+....+..-+.-..--+..++.++.
T Consensus       219 ~~~~ht~~~~d~~~~~~~~~~l~~~l  244 (251)
T 2gre_A          219 IDSSHAFERTHESSIAHTEALVYAYV  244 (251)
T ss_dssp             CBSTTSSEEEEHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEHHHHHHHHHHHHHHH
T ss_conf             26775797977999999999999999


No 378
>>2au3_A DNA primase; zinc ribbon, toprim, RNA polymerase, DNA replication, transferase; HET: DNA; 2.00A {Aquifex aeolicus} (A:225-349)
Probab=34.39  E-value=25  Score=14.20  Aligned_cols=41  Identities=17%  Similarity=0.109  Sum_probs=25.5

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             97799799994078861528999999999769947998078
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD  129 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~  129 (600)
                      ....+.|.|+.|-|..|.+++.=+.+.|...+..+....|.
T Consensus        60 ~~~~~~vvi~~D~D~aG~~~a~~~~~~l~~~~~~~~~~~~p  100 (125)
T 2au3_A           60 SKFTKKVYILYDGDDAGRKAMKSAIPLLLSAGVEVYPVYLP  100 (125)
T ss_dssp             HTTCSEEEEECCSSHHHHHHHHHHHHHHHHTTCEEEEECCC
T ss_pred             HHCCCCEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             61277236742786777755788776540236521366589


No 379
>>3ks6_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Agrobacterium tumefaciens str} PDB: 3ks5_A* (A:1-50,A:84-250)
Probab=34.29  E-value=25  Score=14.19  Aligned_cols=24  Identities=17%  Similarity=0.257  Sum_probs=17.5

Q ss_pred             CCCCEEEECCCHHHHHHHHHHHHH
Q ss_conf             222100203425899999999998
Q gi|254780901|r  315 NLGSRLLISDDSQELEMLAMKLDV  338 (600)
Q Consensus       315 ~~av~lL~~~d~~~a~~la~~L~~  338 (600)
                      +.+|+-++|+.+..+.++.++++.
T Consensus       190 ~~GVDgI~TD~P~~~~~~l~~~~~  213 (217)
T 3ks6_A          190 DLGVKVFTTDRPTLAIALRTEHRX  213 (217)
T ss_dssp             HHTCSEEEESCHHHHHHHHHHHHH
T ss_pred             HCCCCEEEECCHHHHHHHHHHHHH
T ss_conf             769999998969999999997420


No 380
>>1n1b_A (+)-bornyl diphosphate synthase; terpene synthase fold, isomerase; 2.00A {Salvia officinalis} (A:95-203)
Probab=34.19  E-value=22  Score=14.65  Aligned_cols=25  Identities=20%  Similarity=0.173  Sum_probs=13.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEE
Q ss_conf             0788615289999999997699479
Q gi|254780901|r  100 DYDVDGAASVALMMRFLSHCSVNAN  124 (600)
Q Consensus       100 DyD~DGitstail~~~L~~~g~~v~  124 (600)
                      |+.-+.+..||+-.+.|++-|.+|.
T Consensus         1 e~~~~Dl~~~AL~FRLLRqhGy~Vs   25 (109)
T 1n1b_A            1 EVEKMDLYFTALGFRLLRQHGFNIS   25 (109)
T ss_dssp             CCCSCCHHHHHHHHHHHHHTTCCCC
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             6543649999999999996699778


No 381
>>2cul_A Glucose-inhibited division protein A-related protein, probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus HB8} (A:1-122,A:186-232)
Probab=34.03  E-value=25  Score=14.16  Aligned_cols=41  Identities=15%  Similarity=0.164  Sum_probs=31.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCC
Q ss_conf             686899964887623455555417982799615447655567
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP  190 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~  190 (600)
                      .++.+| +-.|.+...+...++++|++|+++|-+..+.....
T Consensus         3 ~yDViI-IGAGpAGL~AA~~Lar~G~kV~lIEk~~~~gg~~~   43 (169)
T 2cul_A            3 AYQVLI-VGAGFSGAETAFWLAQKGVRVGLLTQSLDAVMMPF   43 (169)
T ss_dssp             CCSEEE-ECCSHHHHHHHHHHHHTTCCEEEEESCGGGTTCCS
T ss_pred             CCCEEE-ECCCHHHHHHHHHHHHCCCEEEEEECCHHHHCCCC
T ss_conf             789899-99688999999999988990899955667842567


No 382
>>1pq4_A Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} (A:189-270)
Probab=33.99  E-value=25  Score=14.15  Aligned_cols=62  Identities=11%  Similarity=0.154  Sum_probs=41.3

Q ss_pred             HHHHCCCCEEEEECCCCCCCCCCCHHHH----HHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             9997699479980787433668897898----874202686899964887623455555417982799615
Q gi|254780901|r  115 FLSHCSVNANMYIPDRIVDGYGPNPSLM----EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       115 ~L~~~g~~v~~~IP~R~~eGYGl~~~~i----~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDH  181 (600)
                      +.+.+|.++...+-.    |--.+..-+    +.+++.+++.|. ++-..+.--.-..+++.|+.++++|.
T Consensus        15 ~a~~ygl~~~~~i~~----~~eps~~~i~~l~~~ik~~~i~~if-~e~~~~~k~~~~ia~etg~~~~~ld~   80 (82)
T 1pq4_A           15 FARDYNLVQIPIEVE----GQEPSAQELKQLIDTAKENNLTMVF-GETQFSTKSSEAIAAEIGAGVELLDP   80 (82)
T ss_dssp             HHHHTTCEEEESCBT----TBCCCHHHHHHHHHHHHTTTCCEEE-EETTSCCHHHHHHHHHHTCEEEEECT
T ss_pred             HHHHCCCCEEECCCC----CCCCCHHHHHHHHHHHHHCCCCEEE-ECCCCCCHHHHHHHHHHCCCEEEECC
T ss_conf             999679935204467----8899989999999999974998899-72899919999999980998798788


No 383
>>2vp8_A Dihydropteroate synthase 2; RV1207, transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} (A:)
Probab=33.82  E-value=25  Score=14.13  Aligned_cols=112  Identities=13%  Similarity=0.142  Sum_probs=72.2

Q ss_pred             HHCCCCHHHCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEEC------CCCCHHHHHHHHHHHHH---HCCCCEEEEECC
Q ss_conf             661966777189955614879999999999977997999940------78861528999999999---769947998078
Q gi|254780901|r   59 DFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD------YDVDGAASVALMMRFLS---HCSVNANMYIPD  129 (600)
Q Consensus        59 ~fL~p~l~~l~~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gD------yD~DGitstail~~~L~---~~g~~v~~~IP~  129 (600)
                      .-+|.+.+.. .|.....+.++++++..+-++++-.|.=+|=      -.+|--.--.-|..+++   .-+.++-.-|=.
T Consensus        46 g~iNvt~~sf-~d~~~~~d~~~~~~~a~~~i~~GAdiIDig~~st~p~~~v~~eeE~~rl~~vi~~i~~~~~~vpiSIDT  124 (318)
T 2vp8_A           46 AIVNRTPDSF-YDKGATFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLISVDT  124 (318)
T ss_dssp             EEEC---------------CHHHHHHHHHHHHTTCSEEEEC----------CHHHHHHHHHHHHHHHHHHSTTCEEEEEC
T ss_pred             EEEECCCCCC-CCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHEEECCCCHHHHHCCCCEEEEEEECC
T ss_conf             9982899889-889858799999999999998799699979701799897880222301232143320233058874033


Q ss_pred             CCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             74336688978988742026868999648876234555554179827996
Q gi|254780901|r  130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI  179 (600)
Q Consensus       130 R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVt  179 (600)
                             .+.++++...+.|.++|=.+ +|...-+-+..+++.|..+|+.
T Consensus       125 -------~~~~v~~~al~~G~~iINdi-sg~~~~~~~~l~~~~~~~vV~m  166 (318)
T 2vp8_A          125 -------WRAQVAKAACAAGADLINDT-WGGVDPAMPEVAAEFGAGLVCA  166 (318)
T ss_dssp             -------SCHHHHHHHHHHTCCEEEET-TSSSSTTHHHHHHHHTCEEEEE
T ss_pred             -------CCHHHHHHHHHCCCEEEECC-CCCCHHHHHHHHHHCCCCCCCC
T ss_conf             -------57788777875262276254-3021388999998528984103


No 384
>>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* (A:1-147,A:300-349)
Probab=33.77  E-value=25  Score=14.13  Aligned_cols=41  Identities=17%  Similarity=0.300  Sum_probs=30.4

Q ss_pred             HCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             026868999648876234555554179827996154476555
Q gi|254780901|r  147 NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       147 ~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      +..+|+|| +-.|.+-......|.+.|.+|+|+|.+......
T Consensus         4 ~~~yDviV-IGaG~aGl~aA~~la~~G~~V~iiE~~~~~~~~   44 (197)
T 1zmd_A            4 PIDADVTV-IGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGT   44 (197)
T ss_dssp             CEEEEEEE-ECCSHHHHHHHHHHHHTTCCEEEEECSSSSSHH
T ss_pred             CCCCCEEE-ECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCE
T ss_conf             86248899-898889999999998688978999827996542


No 385
>>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} (A:1-258)
Probab=33.77  E-value=25  Score=14.13  Aligned_cols=70  Identities=13%  Similarity=0.141  Sum_probs=29.0

Q ss_pred             HHHHHHHHHHHHHH--HHCEEEEEEECCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCHHHHH
Q ss_conf             12222227899884--2010799886379837999864898618888885303353011565322231464222158899
Q gi|254780901|r  380 PGIVGLLAARLKEK--FGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLC  457 (600)
Q Consensus       380 ~GViGIVAsrL~e~--y~kP~iv~s~~~dg~~kGS~RSi~g~~l~~~l~~~~~~~ll~~~GGH~~AaG~ti~~~~l~~f~  457 (600)
                      +|....+.+ |++.  -+.|+++++-.......|.. +...+|...+...+..               .+......+++.
T Consensus       155 pG~~n~~~~-i~~A~~~~~Pli~i~g~~~~~~~~~~-~~Q~~d~~~~~~~~tk---------------~~~~v~~~~~~~  217 (258)
T 1t9b_A          155 PGATNVVTP-MADAFADGIPMVVFTGQVPTSAIGTD-AFQEADVVGISRSCTK---------------WNVMVKSVEELP  217 (258)
T ss_dssp             HHHHTTHHH-HHHHHHHTCCEEEEEEECCTTTTTSC-CTTCCCHHHHTGGGSS---------------EEEECCSGGGHH
T ss_pred             HHHHHHHHH-HHHHHHHCCCEEEEECCCCHHHCCCC-CCHHHHHHHHHCCCEE---------------EEEEECCHHHHH
T ss_conf             689989999-99999749986999698876761888-6247899876003014---------------899947867716


Q ss_pred             HHHHHHHHH
Q ss_conf             999999986
Q gi|254780901|r  458 DFFQKFAHN  466 (600)
Q Consensus       458 ~~l~~~~~~  466 (600)
                      +.+.+.+..
T Consensus       218 ~~i~~A~~~  226 (258)
T 1t9b_A          218 LRINEAFEI  226 (258)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
T ss_conf             999999986


No 386
>>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa PAO1} PDB: 3i5a_A* (A:1-147)
Probab=33.61  E-value=16  Score=15.63  Aligned_cols=27  Identities=19%  Similarity=0.101  Sum_probs=13.3

Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             345555541798279961544765556
Q gi|254780901|r  163 YDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       163 ~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      .++.+.+.+.-.|+||+|.+.|.....
T Consensus        53 ~~al~~l~~~~pdliilD~~lp~~dG~   79 (147)
T 3bre_A           53 QQAVAVANQIKPTVILQDLVMPGVDGL   79 (147)
T ss_dssp             HHHHHHHHHHCCSEEEEESBCSSSBHH
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCHH
T ss_conf             999999973699999988999997669


No 387
>>3d8x_A Thioredoxin reductase 1; NADPH, yeast, , modpipe model of A6Z, cytoplasm, FAD, flavoprotein, NADP, oxidoreductase, redox- active center; HET: FAD NAP; 2.80A {Saccharomyces cerevisiae} (A:1-126,A:284-326)
Probab=33.46  E-value=26  Score=14.09  Aligned_cols=42  Identities=14%  Similarity=0.196  Sum_probs=33.3

Q ss_pred             HCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             0268689996488762345555541798279961544765556
Q gi|254780901|r  147 NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       147 ~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      ...+|+|| +-.|.+-..+.-+|.+.|.+|.|+|....+....
T Consensus         8 ~~~yDVII-IGaGpAGl~AA~~aar~G~kVlvIE~~~~~g~~~   49 (169)
T 3d8x_A            8 HVHNKVTI-IGSGPAAHTAAIYLARAEIKPILYEGMMANGIAA   49 (169)
T ss_dssp             -CEEEEEE-ECCSHHHHHHHHHHHHTTCCCEEECCSSGGGCCT
T ss_pred             CCCCCEEE-ECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCC
T ss_conf             76189999-9986999999999997899889994567678864


No 388
>>3kf8_A Protein STN1; OB fold; 2.40A {Candida tropicalis mya-3404} (A:42-220)
Probab=33.45  E-value=26  Score=14.09  Aligned_cols=81  Identities=11%  Similarity=0.046  Sum_probs=46.5

Q ss_pred             EEEECCEEEEEEEEECC----C------------EEEEEEECCCCCEEEEEEECCCCCCH---HHHHHCCCCCEEEEEEE
Q ss_conf             68427809988888479----6------------49999984998779999977878701---23553069987999999
Q gi|254780901|r  510 VFAFPNHKLQSIRVVNL----A------------HLQMTFESQDSETLQAIAFRVYGTPL---GEFLMQSRGKRMHVTGH  570 (600)
Q Consensus       510 ~F~~~~~~i~~~r~vGk----~------------Hlkl~l~~~~g~~i~aI~Fn~~~~~~---~~~~~~~~g~~idii~~  570 (600)
                      +|...|..|..++++|.    .            -..+.+.|..|......|-+......   ........+..+++.+.
T Consensus        36 i~fy~NhPI~~V~i~G~VV~~~~k~~~~~~~r~~~~~~~iDD~SG~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~i~G~  115 (179)
T 3kf8_A           36 VVLVNNYPVNQINIFGKIVYEQYKEKEFNGVEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGE  115 (179)
T ss_dssp             CEEETTEEECEEEEEEEEEEEEEECCBCSSCBCCEEEEEEECCCSSSCEEEEEEEHHHHHTTTCCTTSCCTTCEEEEEEE
T ss_pred             EEEECCCCEEEEEEEEEEEEEEEECCCCCCCCCCEEEEEEECCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEE
T ss_conf             89998765189999999999997235445766534999995689994689999576323565624444676846999878


Q ss_pred             EE-----EE-EECCCCEEEEEEEEEEEC
Q ss_conf             76-----65-457811058999980111
Q gi|254780901|r  571 LC-----VN-YWRGSKRCQLRVLDASPV  592 (600)
Q Consensus       571 l~-----~N-~~~G~~s~QL~I~Di~p~  592 (600)
                      +.     ++ +|||.  -||.++.+...
T Consensus       116 i~~v~g~i~~t~r~~--rqi~ve~~~~~  141 (179)
T 3kf8_A          116 IYNWYDSINVSKKPD--RELKVSKITVL  141 (179)
T ss_dssp             EEECCCSTTTTSCCC--EEEEEEEEEEE
T ss_pred             EEEEEEECCCCCCCC--EEEEEEEEEEE
T ss_conf             610542022232455--38999999994


No 389
>>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} (A:)
Probab=33.44  E-value=26  Score=14.09  Aligned_cols=90  Identities=7%  Similarity=-0.145  Sum_probs=51.0

Q ss_pred             CCCCCHHHHHHHHHCCCCEEEEE---C-------CCCCC-------HHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEEC
Q ss_conf             66889789887420268689996---4-------88762-------3455555417982799615447655567256523
Q gi|254780901|r  134 GYGPNPSLMEKFINEGAQLIITV---D-------CGSTS-------YDALQYATNQGIDVIVIDHHQVKSEEIPAYALVN  196 (600)
Q Consensus       134 GYGl~~~~i~~~~~~g~~LiItv---D-------~Gi~~-------~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivN  196 (600)
                      -|-..++-|+.+++.|.+.+=+.   +       .|.-+       -+.++.|.+.||.||++-||.+.....       
T Consensus        34 ~~~~~~~di~~~k~~G~n~vR~~i~w~~~~~~~~~~~~~~~~~~~~d~~v~~~~~~Gi~vii~lh~~~~~~~~-------  106 (341)
T 1vjz_A           34 TGNFKEEDFLWXAQWDFNFVRIPXCHLLWSDRGNPFIIREDFFEKIDRVIFWGEKYGIHICISLHRAPGYSVN-------  106 (341)
T ss_dssp             CCCCCHHHHHHHHHTTCCEEEEEEEGGGTSCSSCTTCCCGGGHHHHHHHHHHHHHHTCEEEEEEEEETTEESC-------
T ss_pred             CCCCCHHHHHHHHHCCCCEEEECCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-------
T ss_conf             6677599999999859988991166999057888766598999999999999997599479972368876667-------


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7888864334430478899999999999702148
Q gi|254780901|r  197 PNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN  230 (600)
Q Consensus       197 P~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~  230 (600)
                      |........+..=.-......++..+.+.++...
T Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~~a~ry~~~~  140 (341)
T 1vjz_A          107 KEVEEKTNLWKDETAQEAFIHHWSFIARRYKGIS  140 (341)
T ss_dssp             TTSCCSSCTTTCHHHHHHHHHHHHHHHHHHTTSC
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             7765554234652457779999999999872158


No 390
>>1wu2_A MOEA protein, molybdopterin biosynthesis MOEA protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.30A {Pyrococcus horikoshii} (A:1-23,A:182-322)
Probab=33.40  E-value=26  Score=14.09  Aligned_cols=84  Identities=14%  Similarity=0.273  Sum_probs=53.1

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCC--CC---------H---HHHHHHHHHHHHHCCCCEEEE--ECCCCCCCCCCCHHH
Q ss_conf             7999999999997799799994078--86---------1---528999999999769947998--078743366889789
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYD--VD---------G---AASVALMMRFLSHCSVNANMY--IPDRIVDGYGPNPSL  141 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD--~D---------G---itstail~~~L~~~g~~v~~~--IP~R~~eGYGl~~~~  141 (600)
                      -.+|...+.+-|+.+=+|.|..=-|  ++         |   =|++.++...|++.|.++.++  +|+...+    -.++
T Consensus        10 ~~~~~~~~~~~~~~r~rv~Ii~tGdEl~~~~~~~~~~~G~i~Dsn~~~l~~~L~~~G~~v~~~~iv~Dd~~~----I~~a   85 (164)
T 1wu2_A           10 YREALKLLLDDINEKPKVGIIITGSELIEEPSEEGFKEGKIVETNSIXLQGLVEKFFGEPILYGVLPDDESI----IKET   85 (164)
T ss_dssp             HHHHHHHHHHHCCCCCEEEEEEECTTEESSCCHHHHHTTCEECCHHHHHHHHHHHTTCEEEEEEEECSCHHH----HTTH
T ss_pred             HHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHCCCCCCCCCCCCHHH----HHHH
T ss_conf             999999998518898638999405310020023578889474358788899998521022332222430566----6566


Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             887420268689996488762345555
Q gi|254780901|r  142 MEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus       142 i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ++++. +++++|||.  |-++.-+-++
T Consensus        86 l~~~~-~~~DiVItt--GGtg~g~~D~  109 (164)
T 1wu2_A           86 LEKAK-NECDIVLIT--GGSAFGDKDY  109 (164)
T ss_dssp             HHHHH-HCSEEEECC----------CC
T ss_pred             HHHHH-HHCCEEEEC--CCCCCCCCCC
T ss_conf             55435-433567632--7768887663


No 391
>>3cwn_A Transaldolase B; directed evolution, cytoplasm, pentose shunt, transferase; 1.40A {Escherichia coli} PDB: 1ucw_A* 1onr_A 1i2r_A 1i2q_A 1i2o_A 1i2p_A 1i2n_A (A:)
Probab=33.35  E-value=26  Score=14.08  Aligned_cols=99  Identities=16%  Similarity=0.124  Sum_probs=69.2

Q ss_pred             CHHHCC-CHHHHHHHHHHHHHCC-CCEEEEEC----CCCCHHHHHHHHHHHH-HHC---CCCEEEEECCCCCCCCCCCHH
Q ss_conf             955614-8799999999999779-97999940----7886152899999999-976---994799807874336688978
Q gi|254780901|r   71 DPLILT-DCDKAARRIVQAIYNS-EKIMIFGD----YDVDGAASVALMMRFL-SHC---SVNANMYIPDRIVDGYGPNPS  140 (600)
Q Consensus        71 dP~~l~-dm~~A~~ri~~ai~~~-ekI~I~gD----yD~DGitstail~~~L-~~~---g~~v~~~IP~R~~eGYGl~~~  140 (600)
                      +|.+.. +...+++.+.+.+... .++.+.-|    ||.+++.+-|-....| +..   +.++...||-- .+|    ..
T Consensus        87 ~~~l~~~~~~~~~~~~~~~~~~~~G~vsiev~p~~a~d~e~~v~~A~~L~~l~~~~~i~~~ni~IKIPaT-~~G----i~  161 (337)
T 3cwn_A           87 AQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKRLIKLYNDAGISNDRILIKLAST-WQG----IR  161 (337)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTCSSCEEEECCGGGTTCHHHHHHHHHHHHHHHHHTTCCGGGEEEEEECS-HHH----HH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCC-HHH----HH
T ss_conf             9999999999999988998627888658995777555738999999999999987288876437732575-789----99


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEE
Q ss_conf             9887420268689996488762345555541798279
Q gi|254780901|r  141 LMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVI  177 (600)
Q Consensus       141 ~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvI  177 (600)
                      +++.+..+|++...|   .+-+.++...|.+.|.++|
T Consensus       162 A~~~L~~~GI~vn~T---~vfS~~Qa~~aa~Aga~~i  195 (337)
T 3cwn_A          162 AAEQLEKEGINCNLT---LLFSFAQARACAEAGVFLI  195 (337)
T ss_dssp             HHHHHHHTTCCEEEE---EECSHHHHHHHHHTTCSEE
T ss_pred             HHHHHHHCCCCCCCC---EEECHHHHHHHHHHCCCEE
T ss_conf             999999759612531---1201788999998276202


No 392
>>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} (A:)
Probab=33.30  E-value=26  Score=14.07  Aligned_cols=55  Identities=13%  Similarity=0.096  Sum_probs=27.9

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             799994078861528999999999769947998078743366889789887420268689996488762
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTS  162 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~  162 (600)
                      ||+|.-    |--+...++.+.|+..|.++...     ..    ..++++.+.+..++++| +|-....
T Consensus         2 kVLiVd----Dd~~~~~~l~~~L~~~g~~v~~a-----~~----~~~Al~~l~~~~~dlii-lD~~lp~   56 (121)
T 2pl1_A            2 RVLVVE----DNALLRHHLKVQIQDAGHQVDDA-----ED----AKEADYYLNEHIPDIAI-VDLGLPD   56 (121)
T ss_dssp             EEEEEC----SCHHHHHHHHHHHHHTTCEEEEE-----SS----HHHHHHHHHHSCCSEEE-ECSCCSS
T ss_pred             EEEEEE----CCHHHHHHHHHHHHHCCCEEEEE-----CC----HHHHHHHHHHCCHHHHH-HHHCCCC
T ss_conf             899996----79999999999999879999998-----98----89999988603201243-5402566


No 393
>>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, protein structure initiative; 2.14A {Rhodococcus jostii RHA1} (A:1-109,A:240-289)
Probab=33.26  E-value=26  Score=14.07  Aligned_cols=111  Identities=9%  Similarity=-0.009  Sum_probs=70.0

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHH---HHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH
Q ss_conf             77997999940788615289999---999997699479980787433668897898874202686899964887623455
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALM---MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail---~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i  166 (600)
                      .+...|.|.-|  .+.--.+.++   .+.++..|..+..+.-+- .+   --.+.++.+.+.+++=+|.+  |....++.
T Consensus        10 ~kS~~IGVI~~--l~npF~~eii~gI~~~a~~~GY~lli~~~~~-~e---~e~~~l~~l~~~~VDGIIl~--~~~~~~~~   81 (159)
T 3k9c_A           10 ASSRLLGVVFE--LQQPFHGDLVEQIYAAATRRGYDVXLSAVAP-SR---AEKVAVQALXRERCEAAILL--GTRFDTDE   81 (159)
T ss_dssp             ---CEEEEEEE--TTCHHHHHHHHHHHHHHHHTTCEEEEEEEBT-TB---CHHHHHHHHTTTTEEEEEEE--TCCCCHHH
T ss_pred             CCCCEEEEEEC--CCCHHHHHHHHHHHHHHHHCCCEEEEEECCC-CH---HHHHHHHHHHHCCCCEEEEE--CCCHHHHH
T ss_conf             89998999953--7876999999999999998699899994898-88---99999999997097512110--23015889


Q ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             55541798279961544765556725652378888643344304788999999
Q gi|254780901|r  167 QYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVL  219 (600)
Q Consensus       167 ~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~  219 (600)
                      ....+.++-+|++|.+.+....+  +..+|.         ..|+.+.|.=-|.
T Consensus        82 ~~ll~~~iPvVlId~~~~~~~~~--~V~~D~---------~~~~~~~~~~~~~  123 (159)
T 3k9c_A           82 LGALADRVPALVVARASGLPGVG--AVRGDA---------THXAEAAVDGALA  123 (159)
T ss_dssp             HHHHHTTSCEEEESSCCSSTTSE--EEEECH---------HHHHHHHHHHHHH
T ss_pred             HHHHHCCCCEEEECCCCCCCCCC--CCCCCH---------HHHHHHHHHHHHH
T ss_conf             98754447758632446755566--445659---------9999999999999


No 394
>>1t6t_1 Putative protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, unknown function; 1.80A {Aquifex aeolicus VF5} (1:)
Probab=33.12  E-value=26  Score=14.05  Aligned_cols=45  Identities=16%  Similarity=0.079  Sum_probs=37.2

Q ss_pred             HHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             999999779979999407886152899999999976994799807
Q gi|254780901|r   84 RIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP  128 (600)
Q Consensus        84 ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP  128 (600)
                      .....+.+.++|.|+.|.|.-|...+.=+.+.|...|.++.-++.
T Consensus        54 ~~~~~l~~~~~vii~~D~D~~G~~~~~~~~~~l~~~g~D~~~~~~   98 (118)
T 1t6t_1           54 VVDXLEGKWEKVILLFDLDTHGERINQKXKELLSSQGFLVDENFR   98 (118)
T ss_dssp             HHHHHTTTCSEEEECCCSSHHHHHHHHHHHHHHHHTTCEEECHHH
T ss_pred             HHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHCCCEEEHHHH
T ss_conf             999998348926998489888999999999999986994424599


No 395
>>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics; 2.01A {Thermus thermophilus HB8} (A:1-147,A:317-345)
Probab=33.04  E-value=26  Score=14.04  Aligned_cols=85  Identities=13%  Similarity=0.056  Sum_probs=54.2

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC------CCCH-----HHHHHHHHCCCCEEEEECC
Q ss_conf             7799799994078861528999999999769947998078743366------8897-----8988742026868999648
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY------GPNP-----SLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGY------Gl~~-----~~i~~~~~~g~~LiItvD~  158 (600)
                      .+.-||.|.|   +-|.++..++...+..-..++....-+| ..|-      +-..     .........++++++.+=-
T Consensus         2 s~~~kV~IvG---AtG~vG~~l~~~L~~~p~~ei~~l~~~~-~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~DvV~~a~~   77 (176)
T 2ozp_A            2 TGKKTLSIVG---ASGYAGGEFLRLALSHPYLEVKQVTSRR-FAGEPVHFVHPNLRGRTNLKFVPPEKLEPADILVLALP   77 (176)
T ss_dssp             --CEEEEEET---TTSHHHHHHHHHHHTCTTEEEEEEBCST-TTTSBGGGTCGGGTTTCCCBCBCGGGCCCCSEEEECCC
T ss_pred             CCCCEEEEEC---CCHHHHHHHHHHHHHCCCCEEEEEECCC-CCCCCHHHHCCCCCCCCCCEECCHHHCCCCCEEEEECC
T ss_conf             9998899989---3619999999999809996799998168-79980889594435866632258667234668998136


Q ss_pred             CCCCHHHHHHHHHCCCCEEE
Q ss_conf             87623455555417982799
Q gi|254780901|r  159 GSTSYDALQYATNQGIDVIV  178 (600)
Q Consensus       159 Gi~~~e~i~~a~~~GidvIV  178 (600)
                      .-.+.+-+..+.+.|..||-
T Consensus        78 ~~~~~~~~~~~~~~g~~VId   97 (176)
T 2ozp_A           78 HGVFAREFDRYSALAPVLVD   97 (176)
T ss_dssp             TTHHHHTHHHHHTTCSEEEE
T ss_pred             CCEEEEECCCCCCCCEEEEC
T ss_conf             63145640110221126741


No 396
>>3gfp_A DEAD box protein 5; mRNA export, ATPase, RECA-fold, ATP-binding, cytoplasm, helicase, hydrolase, membrane, mRNA transport; 1.80A {Saccharomyces cerevisiae} (A:)
Probab=32.97  E-value=26  Score=14.04  Aligned_cols=73  Identities=12%  Similarity=0.150  Sum_probs=49.6

Q ss_pred             HHHHHHHHH--CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             999999997--799799994078861528999999999769947998078743366889789887420268689996488
Q gi|254780901|r   82 ARRIVQAIY--NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        82 ~~ri~~ai~--~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      .+.+.+.++  .+++++||    |.-...+-.|++.|...|..+.++-.+.-.+   --..+++++.+...+.+|+.|+.
T Consensus        25 ~~~l~~il~~~~~~k~lIf----~~~~~~~~~l~~~L~~~~~~~~~~h~~~~~~---er~~~~~~F~~~~~~iLv~T~~~   97 (189)
T 3gfp_A           25 FDVLTELYGLXTIGSSIIF----VATKKTANVLYGKLKSEGHEVSILHGDLQTQ---ERDRLIDDFREGRSKVLITTNVL   97 (189)
T ss_dssp             HHHHHHHHHHCCCSCEEEE----ESCHHHHHHHHHHHHHTTCCEEEECTTSCHH---HHHHHHHHHHHTSCSEEEEETTT
T ss_pred             HHHHHHHHHHCCCCCEEEE----EEEEEHHHHHHHHHHHCCCHHHHHHCCCCHH---HHHHHHCCCCCCCCCEEECCCCH
T ss_conf             9999999984788857999----9643034666655431020133331343126---77764000137875321103400


Q ss_pred             CC
Q ss_conf             76
Q gi|254780901|r  160 ST  161 (600)
Q Consensus       160 i~  161 (600)
                      ..
T Consensus        98 ~~   99 (189)
T 3gfp_A           98 AR   99 (189)
T ss_dssp             TT
T ss_pred             HH
T ss_conf             31


No 397
>>1gu7_A 2,4-dienoyl-COA reductase; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} (A:149-329)
Probab=32.95  E-value=26  Score=14.03  Aligned_cols=14  Identities=14%  Similarity=-0.012  Sum_probs=6.3

Q ss_pred             HHHHHCCCCEEEEE
Q ss_conf             99997699479980
Q gi|254780901|r  114 RFLSHCSVNANMYI  127 (600)
Q Consensus       114 ~~L~~~g~~v~~~I  127 (600)
                      ..++..|+++...+
T Consensus        38 qlak~~G~~vi~~~   51 (181)
T 1gu7_A           38 QIGKLLNFNSISVI   51 (181)
T ss_dssp             HHHHHHTCEEEEEE
T ss_pred             HHHHHCCCEEEEEE
T ss_conf             99987799799999


No 398
>>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus JCSC1435} (A:120-276)
Probab=32.94  E-value=26  Score=14.03  Aligned_cols=75  Identities=8%  Similarity=0.150  Sum_probs=43.8

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             97799799994078861528999999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ++.+++++|+|   +-|..+ .......+..|.++.....         +.+..+.+.+.+.+.+|  |.-....+....
T Consensus        29 ~~~g~~vlV~G---~g~~~g-~~a~~~a~~~g~~vi~~~~---------~~~k~~~~~~~g~~~~~--~~~~~~~~~~~~   93 (157)
T 3fbg_A           29 ENEGKTLLIIN---GAGGVG-SIATQIAKAYGLRVITTAS---------RNETIEWTKKMGADIVL--NHKESLLNQFKT   93 (157)
T ss_dssp             HHTTCEEEEES---TTSHHH-HHHHHHHHHTTCEEEEECC---------SHHHHHHHHHHTCSEEE--CTTSCHHHHHHH
T ss_pred             CCCCCEEEEEC---CCCCCC-EEEECCCCCCCCCCCCCCC---------CHHHHHHHHHHCCCCCC--CCCCCCHHHHCC
T ss_conf             68999899990---788751-2100011246752112456---------57899999863222001--244320011012


Q ss_pred             HHHCCCCEEE
Q ss_conf             5417982799
Q gi|254780901|r  169 ATNQGIDVIV  178 (600)
Q Consensus       169 a~~~GidvIV  178 (600)
                      ....|.|+++
T Consensus        94 ~~~~g~d~vi  103 (157)
T 3fbg_A           94 QGIELVDYVF  103 (157)
T ss_dssp             HTCCCEEEEE
T ss_pred             CCCCCCCCCC
T ss_conf             2221122122


No 399
>3ckm_A The Yram C-Terminal Domain {Haemophilus influenzae} (A:)
Probab=32.94  E-value=26  Score=14.03  Aligned_cols=87  Identities=6%  Similarity=-0.035  Sum_probs=42.8

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHH--HCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             799994078861528999999999--769947998078743366889789887420268689996488762345555541
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLS--HCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATN  171 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~--~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~  171 (600)
                      ||.+.++.--....-+--+.++++  .-|.++.+.+   .++++.....+.+.+..+++..+|...|...+......+.+
T Consensus         4 ~IG~~~p~sG~~a~~g~~~~~g~~lav~g~~ie~~~---~D~~~~p~~a~~~~~~~~~v~~iiG~~~s~~~~a~~~~~~~   80 (327)
T 3ckm_A            4 QIGLLLPLSGDGQILGTTIQSGFNDAKGNSTIPVQV---FDTSXNSVQDIIAQAKQAGIKTLVGPLLKQNLDVILADPAQ   80 (327)
T ss_dssp             CEEEEECCSSTTHHHHHHHHHHHHHHHTTCCSCEEE---EETTTSCHHHHHHHHHHTTCCEEECCCSHHHHHHHHHCGGG
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHCCCCEEEEE---EECCCCHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHHH
T ss_conf             999981367770678899999999855583139999---70888989999998740893499748862238999999985


Q ss_pred             CCCCEEEECCCC
Q ss_conf             798279961544
Q gi|254780901|r  172 QGIDVIVIDHHQ  183 (600)
Q Consensus       172 ~GidvIVtDHH~  183 (600)
                      .++-+|...=..
T Consensus        81 ~~ip~i~~~~~~   92 (327)
T 3ckm_A           81 IQGXDVLALNAT   92 (327)
T ss_dssp             GTTCEEEESCCC
T ss_pred             CCCEEEEECCCC
T ss_conf             496798716787


No 400
>>1j5x_A Glucosamine-6-phosphate deaminase; structural genomics, TM0813, JCSG, PSI, protein structure initiative; 1.80A {Thermotoga maritima} (A:44-182)
Probab=32.80  E-value=26  Score=14.02  Aligned_cols=102  Identities=9%  Similarity=0.080  Sum_probs=50.0

Q ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHH--HHHHHC-CCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             99999779979999407886152899999--999976-994799807874336688978988742026868999648876
Q gi|254780901|r   85 IVQAIYNSEKIMIFGDYDVDGAASVALMM--RFLSHC-SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST  161 (600)
Q Consensus        85 i~~ai~~~ekI~I~gDyD~DGitstail~--~~L~~~-g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~  161 (600)
                      +.+.+.+.++|.|+|    =|.+...-.+  ..|..+ +..+...-|.-+..  .    .... .. .-+++|.+...=.
T Consensus         2 a~~~l~~a~~I~i~G----~G~S~~~a~~~~~~l~~~~~~~~~~~~~~~~~~--~----~~~~-~~-~~d~vi~iS~sg~   69 (139)
T 1j5x_A            2 SEIQKNLTDEVLFVG----CGSSYNLALTISYYFERVLKIRTKAIPAGEVAF--Q----KIPD-LE-ERGLAFLFSRTGN   69 (139)
T ss_dssp             --C----CCEEEEEE----STHHHHHHHHHHHHHHHHHCCEEEEEEHHHHHT--T----CSCC-CC-SSEEEEEECSSSC
T ss_pred             HHHHHCCCCEEEEEE----ECHHHHHHHHHHHHHHHHHCCCEEEEECHHHHH--C----CCCC-CC-CCCEEEEECCCCC
T ss_conf             888757899799998----307999999999999998599879996602221--2----4675-68-9867999768999


Q ss_pred             C---HHHHHHHHHCCCCEEEE-CCCCCCCCCCCCEEEECCC
Q ss_conf             2---34555554179827996-1544765556725652378
Q gi|254780901|r  162 S---YDALQYATNQGIDVIVI-DHHQVKSEEIPAYALVNPN  198 (600)
Q Consensus       162 ~---~e~i~~a~~~GidvIVt-DHH~~~~~~p~a~aivNP~  198 (600)
                      .   .+.++.|+++|+.||.+ +....+=.....+.+.-|.
T Consensus        70 t~~~~~~~~~ak~~g~~vi~iT~~~~s~l~~~ad~~l~~~~  110 (139)
T 1j5x_A           70 TTEVLLANDVLKKRNHRTIGITIEEESRLAKESDLPLVFPV  110 (139)
T ss_dssp             CHHHHHHHHHHHHTTEEEEEEESCTTSHHHHHSSEEEECCC
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECCCCCCHHHCCCEEEEECC
T ss_conf             67999999999876980887624666410003660564214


No 401
>>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} (A:184-315)
Probab=32.63  E-value=5.9  Score=19.10  Aligned_cols=93  Identities=9%  Similarity=0.045  Sum_probs=53.2

Q ss_pred             HHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             999977997999940788615289999999997699479980787--433668897898874202686899964887623
Q gi|254780901|r   86 VQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        86 ~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      .+.+.+-++-+|..++.+.---+..-+.++.+.+|+.|...--.+  +.+.|-++.....-  -..++|+|.+.|-  -.
T Consensus         7 ~~~L~~A~rPvii~G~g~~~~~~~~~l~~lae~~~iPv~~t~~~kg~~~~~~p~~~G~~g~--~~~aDlil~vG~~--~~   82 (132)
T 1efv_A            7 DRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTGK--IVAPELYIAVGIS--GA   82 (132)
T ss_dssp             CSCCGGGCSEEEEECGGGCSTGGGHHHHHHHHHHTCEEEECHHHHHTTSSCGGGBBSTTSB--CCCCSEEEEESCC--CC
T ss_pred             CCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEHHHCCCCCCCCHHHCCCCCC--CCCCCEEEEECCC--CC
T ss_conf             5545245758998677617888999999999986991897474430789991764066785--2488899997625--75


Q ss_pred             HHHHHHHHCCCCEEEECCC
Q ss_conf             4555554179827996154
Q gi|254780901|r  164 DALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       164 e~i~~a~~~GidvIVtDHH  182 (600)
                      +-...-......+|.+|=|
T Consensus        83 ~~~~~~~~~~~~~i~I~~d  101 (132)
T 1efv_A           83 IQHLAGMKDSKTIVAINKD  101 (132)
T ss_dssp             HHHHTTTTTCSEEEEEESC
T ss_pred             HHHHCCCCCCCEEEEEECC
T ss_conf             6775268888779994489


No 402
>>2oog_A Glycerophosphoryl diester phosphodiesterase; phosphatase, structural genomics, protein structure initiative, PSI; 2.20A {Staphylococcus aureus subsp} PDB: 2p76_A (A:)
Probab=32.35  E-value=27  Score=13.96  Aligned_cols=38  Identities=18%  Similarity=0.289  Sum_probs=23.9

Q ss_pred             EEEEECCCC------CCHHHHHHHHH-CCCCEEEECCCCCCCCCC
Q ss_conf             899964887------62345555541-798279961544765556
Q gi|254780901|r  152 LIITVDCGS------TSYDALQYATN-QGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       152 LiItvD~Gi------~~~e~i~~a~~-~GidvIVtDHH~~~~~~p  189 (600)
                      -+|..--|-      ++.++.+.|.+ .|.+.|=+|=|.-.+..|
T Consensus        24 ~~iiaHRG~~~~~pENTl~af~~A~~~~Ga~~iE~DV~~TkDg~~   68 (287)
T 2oog_A           24 FTTIAHRGASGYAPEHTFQAYDKSHNELKASYIEIDLQRTKDGHL   68 (287)
T ss_dssp             SEEEETTTTTTTSCSSSHHHHHHHHHTSCCSEEEEEEEECTTCCE
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCE
T ss_conf             038988998999972159999999997499989987799169998


No 403
>>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} (A:199-372)
Probab=32.22  E-value=27  Score=13.95  Aligned_cols=82  Identities=12%  Similarity=0.103  Sum_probs=52.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCC------C-CCCC-HHHHHHHHHCC
Q ss_conf             999999999977997999940788615289999999997699479980787--433------6-6889-78988742026
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVD------G-YGPN-PSLMEKFINEG  149 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~e------G-YGl~-~~~i~~~~~~g  149 (600)
                      ++++++.+.+.+.++.+|+.+..  .-.+.+-+.++...+|+.|......+  +.+      | ||.. .....++.++ 
T Consensus         4 ~~i~~a~~~L~~AkrPvii~G~g--~~~a~~~l~~lae~~~~pv~~t~~~kg~~~~~hp~~~G~~g~~~~~~~~~~l~~-   80 (174)
T 1ybh_A            4 SHLEQIVRLISESKKPVLYVGGG--CLNSSDELGRFVELTGIPVASTLMGLGSYPXDDELSLHMLGMHGTVYANYAVEH-   80 (174)
T ss_dssp             HHHHHHHHHHHHCSSEEEEECGG--GTTCHHHHHHHHHHHCCCEEECTTTTTSSCTTSTTEEEECSTTSCHHHHHHHHH-
T ss_pred             HHHHHHHHHHHCCCCCEEEECCC--CCCHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHC-
T ss_conf             99999999997079919998986--245199999999986989998742476668400132002577687999865212-


Q ss_pred             CCEEEEECCCCCCHH
Q ss_conf             868999648876234
Q gi|254780901|r  150 AQLIITVDCGSTSYD  164 (600)
Q Consensus       150 ~~LiItvD~Gi~~~e  164 (600)
                      ++|||.+.+-.+...
T Consensus        81 aDlil~iG~~~~~~~   95 (174)
T 1ybh_A           81 SDLLLAFGVRFDDRV   95 (174)
T ss_dssp             CSEEEEESCCCCHHH
T ss_pred             CCEEEEECCCCCCCC
T ss_conf             899999698652013


No 404
>>1c4k_A Protein (ornithine decarboxylase); HET: PLP GTP; 2.70A {Lactobacillus SP} (A:415-572)
Probab=32.08  E-value=27  Score=13.93  Aligned_cols=42  Identities=21%  Similarity=0.329  Sum_probs=32.0

Q ss_pred             CCCEEEEE-----------CCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECC
Q ss_conf             68689996-----------48876234555554179827996154476555672565237
Q gi|254780901|r  149 GAQLIITV-----------DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNP  197 (600)
Q Consensus       149 g~~LiItv-----------D~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP  197 (600)
                      -.++.|.|           |+|++.++.-+++++.||.+=-+|++.+       .+++.|
T Consensus        79 ptKl~I~~~g~~~~g~~~~~~GisG~~l~~~L~e~~I~~E~~~~~~v-------l~l~t~  131 (158)
T 1c4k_A           79 PNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHGIIPEKSDLNSI-------LFLMTP  131 (158)
T ss_dssp             TTEEEEECSSEETTTTEECSSCCCHHHHHHHHHHTTCCCSEECSSEE-------EEECCT
T ss_pred             CCEEEEEECCCCCCCCCHHHCCCCHHHHHHHHHHCCCEEEECCCCEE-------EEEECC
T ss_conf             86259984787766652555187589999999987993785689839-------999767


No 405
>>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} (A:119-300)
Probab=32.04  E-value=27  Score=13.93  Aligned_cols=89  Identities=8%  Similarity=-0.006  Sum_probs=48.4

Q ss_pred             HHHHHHHH--HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECC
Q ss_conf             99999999--9779979999407886152899999999976994799807874336688978988742026868999648
Q gi|254780901|r   81 AARRIVQA--IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        81 A~~ri~~a--i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~  158 (600)
                      |..-+.+.  ++.+++|+|+|   +-|. ....+...++..|++|.....         +++..+.+++.+.+.++..+.
T Consensus        15 a~~~l~~~~~i~~g~~VlI~G---a~~~-~G~~aiqla~~~g~~V~~~~~---------~~~~~~~~~~~~~~~~~~~~~   81 (182)
T 1v3u_A           15 AYFGLLEVCGVKGGETVLVSA---AAGA-VGSVVGQIAKLKGCKVVGAAG---------SDEKIAYLKQIGFDAAFNYKT   81 (182)
T ss_dssp             HHHHHHTTSCCCSSCEEEEES---TTBH-HHHHHHHHHHHTTCEEEEEES---------SHHHHHHHHHTTCSEEEETTS
T ss_pred             EEEEHEECCCCCCCCEEEECC---CCCC-CHHHHHHHHHHCCCEEEEECC---------CCCCCCCHHCCCCCCCCCCCC
T ss_conf             101020213543110475047---5554-103334467634988866258---------742111100156521112222


Q ss_pred             CCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             8762345555541798279961544
Q gi|254780901|r  159 GSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       159 Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      . ...+++......+-..+|.|.--
T Consensus        82 ~-~~~~~~~~~~~~~~~d~v~d~~g  105 (182)
T 1v3u_A           82 V-NSLEEALKKASPDGYDCYFDNVG  105 (182)
T ss_dssp             C-SCHHHHHHHHCTTCEEEEEESSC
T ss_pred             C-CCCCEEEECCCCCCCCEEEECCC
T ss_conf             2-22101221014887428996476


No 406
>>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics, protein structure initiative; 2.89A {Clostridium difficile 630} (A:)
Probab=31.94  E-value=27  Score=13.91  Aligned_cols=77  Identities=13%  Similarity=0.176  Sum_probs=39.7

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHH---HH
Q ss_conf             979999407886152899999999976994799807874336688978988742026868999648876234555---55
Q gi|254780901|r   93 EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQ---YA  169 (600)
Q Consensus        93 ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~---~a  169 (600)
                      .+|+|.-    |-.+...++...|+..|.+|...-     .    ..++++.+.+..++++| +|.+....+..+   .+
T Consensus         5 ~rVLiVd----Dd~~~~~~l~~~L~~~g~~v~~a~-----~----~~~al~~l~~~~~dlii-lD~~lp~~dG~el~~~i   70 (136)
T 2qzj_A            5 TKILIID----GDKDNCQKLKGFLEEKGISIDLAY-----N----CEEAIGKIFSNKYDLIF-LEIILSDGDGWTLCKKI   70 (136)
T ss_dssp             CEEEEEC----SCHHHHHHHHHHHHTTTCEEEEES-----S----HHHHHHHHHHCCCSEEE-EESEETTEEHHHHHHHH
T ss_pred             CEEEEEE----CCHHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHCCCCCEEE-EECCCCCCCHHHHHHHH
T ss_conf             7699998----999999999999998799999982-----4----88999986066986898-62133675035577675


Q ss_pred             HHC-CCCEEE-ECCCC
Q ss_conf             417-982799-61544
Q gi|254780901|r  170 TNQ-GIDVIV-IDHHQ  183 (600)
Q Consensus       170 ~~~-GidvIV-tDHH~  183 (600)
                      ++. .+-||+ |.+..
T Consensus        71 r~~~~~PiI~lt~~~~   86 (136)
T 2qzj_A           71 RNVTTCPIVYXTYINE   86 (136)
T ss_dssp             HTTCCCCEEEEESCCC
T ss_pred             HCCCCCEEEEEECCCC
T ss_conf             3168775999913799


No 407
>>1i6p_A Carbonic anhydrase; metalloenzyme, zinc coordination, PH- dependent activity, MAD phasing, lyase; 2.00A {Escherichia coli} (A:27-220)
Probab=31.92  E-value=24  Score=14.38  Aligned_cols=22  Identities=27%  Similarity=0.386  Sum_probs=12.0

Q ss_pred             CHHHHHHH-HHCCCCEEEECCCC
Q ss_conf             23455555-41798279961544
Q gi|254780901|r  162 SYDALQYA-TNQGIDVIVIDHHQ  183 (600)
Q Consensus       162 ~~e~i~~a-~~~GidvIVtDHH~  183 (600)
                      ....++|| ..+|++.||.=+|.
T Consensus        51 ~~~sle~av~~l~v~~ivV~GHt   73 (194)
T 1i6p_A           51 CLSVVQYAVDVLEVEHIIICGHY   73 (194)
T ss_dssp             HHHHHHHHHHTSCCSEEEEEEET
T ss_pred             HHHHHHHHHHHCCCCEEEEECCC
T ss_conf             68999999986288469992797


No 408
>>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} (A:1-109)
Probab=31.90  E-value=27  Score=13.91  Aligned_cols=26  Identities=19%  Similarity=0.253  Sum_probs=14.5

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             62345555541798279961544765
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                      +..++++.+.+.-.|+|++|-+.|..
T Consensus        36 ~g~eal~~~~~~~~dlillD~~mP~~   61 (109)
T 1dz3_A           36 NGQDCLQMLEEKRPDILLLDIIMPHL   61 (109)
T ss_dssp             SHHHHHHHHHHHCCSEEEEESCCSSS
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             99999999982699999995578999


No 409
>>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, transcription regulation, redox poise, DNA-binding, NAD, NADH; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* (A:86-215)
Probab=31.77  E-value=27  Score=13.89  Aligned_cols=84  Identities=11%  Similarity=0.077  Sum_probs=45.7

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHH--HCCCCEEEEE-CCCCCCC---CCCCHHHHHHHHHCCCCEEEEECCCCCC--HHH
Q ss_conf             799994078861528999999999--7699479980-7874336---6889789887420268689996488762--345
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLS--HCSVNANMYI-PDRIVDG---YGPNPSLMEKFINEGAQLIITVDCGSTS--YDA  165 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~--~~g~~v~~~I-P~R~~eG---YGl~~~~i~~~~~~g~~LiItvD~Gi~~--~e~  165 (600)
                      +++|||   +.+ ++.. +.+++.  ..|.++.-++ ++....|   .|+..-...+....--..+|+..+....  .+-
T Consensus         2 ~vlI~G---ag~-~g~~-l~~~l~~~~~g~~vvGfiDd~~~~~g~~i~g~~Vl~~~~~~~~i~~v~ia~~~~~~~~~~~i   76 (130)
T 2vt3_A            2 DVILIG---VGN-LGTA-FLHYNFTKNNNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSI   76 (130)
T ss_dssp             CEEEEC---CSH-HHHH-HHHCC------CCEEEEEESCTTTTTCEETTEEEEEGGGHHHHCSSCCEEEECSCHHHHHHH
T ss_pred             EEEEEC---CCH-HHHH-HHHHHHCCCCCCEEEEEEECCHHHCCCEECCCCCCCHHHHHHHHHHCCCEEEEECHHHHHHH
T ss_conf             399986---888-9999-99876324899679999808868759995574154288999999973955998251778999


Q ss_pred             HHHHHHCCCCEEEECCC
Q ss_conf             55554179827996154
Q gi|254780901|r  166 LQYATNQGIDVIVIDHH  182 (600)
Q Consensus       166 i~~a~~~GidvIVtDHH  182 (600)
                      ++.|.+.|+++++.=+.
T Consensus        77 ~~~l~~~gv~v~~~p~~   93 (130)
T 2vt3_A           77 TDRLVALGIKGILNFTP   93 (130)
T ss_dssp             HHHHHHTTCCEEEECSS
T ss_pred             HHHHHHHCCCEEEECCC
T ss_conf             99999819756622376


No 410
>>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE; 1.76A {Sinorhizobium medicae WSM419} (A:)
Probab=31.75  E-value=27  Score=13.89  Aligned_cols=73  Identities=11%  Similarity=0.137  Sum_probs=30.7

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHC-CCCEEEEECC---C-CCCHHHH
Q ss_conf             997999940788615289999999997699479980787433668897898874202-6868999648---8-7623455
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE-GAQLIITVDC---G-STSYDAL  166 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~-g~~LiItvD~---G-i~~~e~i  166 (600)
                      +.+|+|.-    |--.-..++...|+..|.++...-     .    ..++++.+.+. .++++|+ |.   | .+..+-+
T Consensus         5 ~~~ILiVd----D~~~~~~~l~~~L~~~g~~v~~a~-----~----~~eal~~l~~~~~~dlvi~-D~~lp~~~dG~el~   70 (132)
T 2rdm_A            5 AVTILLAD----DEAILLLDFESTLTDAGFLVTAVS-----S----GAKAIEXLKSGAAIDGVVT-DIRFCQPPDGWQVA   70 (132)
T ss_dssp             SCEEEEEC----SSHHHHHHHHHHHHHTTCEEEEES-----S----HHHHHHHHHTTCCCCEEEE-ESCCSSSSCHHHHH
T ss_pred             CCEEEEEE----CCHHHHHHHHHHHHHCCCEEEEEC-----C----HHHHHHHHHHCCCCCEEEE-EECCCCCCCHHHHH
T ss_conf             99999997----999999999999998799999989-----8----8999999983899779998-40268987799999


Q ss_pred             HHHHHC--CCCEEE
Q ss_conf             555417--982799
Q gi|254780901|r  167 QYATNQ--GIDVIV  178 (600)
Q Consensus       167 ~~a~~~--GidvIV  178 (600)
                      ..+++.  .+.+|+
T Consensus        71 ~~ir~~~~~~pii~   84 (132)
T 2rdm_A           71 RVAREIDPNXPIVY   84 (132)
T ss_dssp             HHHHHHCTTCCEEE
T ss_pred             HHHHHHCCCCCEEE
T ss_conf             99998599995899


No 411
>>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Enterococcus faecalis V583} (A:149-227,A:382-421)
Probab=31.43  E-value=12  Score=16.69  Aligned_cols=53  Identities=11%  Similarity=0.132  Sum_probs=28.3

Q ss_pred             HCCCCEEEEECCCCCC----HHHHHHHHHCCCCEEEECC----------CCCCCCCCCCEEEECCCC
Q ss_conf             0268689996488762----3455555417982799615----------447655567256523788
Q gi|254780901|r  147 NEGAQLIITVDCGSTS----YDALQYATNQGIDVIVIDH----------HQVKSEEIPAYALVNPNR  199 (600)
Q Consensus       147 ~~g~~LiItvD~Gi~~----~e~i~~a~~~GidvIVtDH----------H~~~~~~p~a~aivNP~~  199 (600)
                      ..|.+++.|-|.+-..    ..........|+|++|+|=          |..++++-....-+||++
T Consensus        31 ~~g~~VvYtGD~~~~~~~~~~~~~~~~~~~~~DlLI~Est~~~~~~~~~h~~~~~~~~~~~~~~~~~   97 (119)
T 2az4_A           31 TPDHFITYTGDLRLHGHNREETLAFCEKAKHTELLMMEGVSISFPEREPHAIPEDLDKIIALIEPQV   97 (119)
T ss_dssp             ETTEEEEECCSCCSSSTTHHHHHHHHHHHTTCSEEEEECCGGGSCCCCCSCCHHHHHHHHHHHCCSE
T ss_pred             CCCCEEEECCCEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHCCCE
T ss_conf             2574688636500168876411445676432565533440012013457989999999999839999


No 412
>>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, 4Fe-4S, iron-sulfur, metal-binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} (A:210-268,A:344-406)
Probab=31.34  E-value=28  Score=13.84  Aligned_cols=93  Identities=16%  Similarity=0.159  Sum_probs=55.3

Q ss_pred             HHHHHHHHHCCCCEEEEE-----------CCCC-CHHHHHHHHHHHHHHCCCCEEEEECCCCCC-CCCCCHHHHHHHHHC
Q ss_conf             999999997799799994-----------0788-615289999999997699479980787433-668897898874202
Q gi|254780901|r   82 ARRIVQAIYNSEKIMIFG-----------DYDV-DGAASVALMMRFLSHCSVNANMYIPDRIVD-GYGPNPSLMEKFINE  148 (600)
Q Consensus        82 ~~ri~~ai~~~ekI~I~g-----------DyD~-DGitstail~~~L~~~g~~v~~~IP~R~~e-GYGl~~~~i~~~~~~  148 (600)
                      ++.+.+|+.+.+|++|.-           .|-. -|..++.-|+.+|+++|.+..|-.|.+..- .-|....-=.++.. 
T Consensus         2 ~~~v~~al~~~~k~vV~q~APavRval~e~fgl~~g~~~~~k~~~alr~lGfd~VfDtp~~i~~VsImPC~AKK~Ea~R-   80 (122)
T 3c8y_A            2 MDRVKNALNAPEKHVIVAMAPSVRASIGELFNMGFGVDVTGKIYTALRQLGFDKIFDIPKNVFTVTVMPCTSKKFEADR-   80 (122)
T ss_dssp             HHHHHHHHHCTTCEEEEEECGGGGGTGGGGGTCCSSCCCHHHHHHHHHHHTCSEEEEHGGGEEEEEEESCSHHHHHHTC-
T ss_pred             HHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEECCCEEEEEEEECCCCHHHHHCC-
T ss_conf             9999854217780599985402687678873998315579999999998499899964330899999543002345418-


Q ss_pred             CCCEEE----EECCCCCCHHHHHHHHHCCCCE
Q ss_conf             686899----9648876234555554179827
Q gi|254780901|r  149 GAQLII----TVDCGSTSYDALQYATNQGIDV  176 (600)
Q Consensus       149 g~~LiI----tvD~Gi~~~e~i~~a~~~Gidv  176 (600)
                       .++--    -||+=++..|-..+.++.|||.
T Consensus        81 -~e~~~~~~~dVD~VLTt~EL~~lik~~gId~  111 (122)
T 3c8y_A           81 -PQMEKDGLRDIDAVITTRELAKMIKDAKIPF  111 (122)
T ss_dssp             -TTSEETTEESCSEEEEHHHHHHHHHHTTCCG
T ss_pred             -CCCCCCCCCCCCEEEEHHHHHHHHHHCCCCH
T ss_conf             -4445468886277851999999999759993


No 413
>>1zq1_A Glutamyl-tRNA(Gln) amidotransferase subunit D; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} (A:304-438)
Probab=31.30  E-value=28  Score=13.84  Aligned_cols=87  Identities=9%  Similarity=0.139  Sum_probs=52.1

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCC-----HHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECC-CCCCCCCCCCCH
Q ss_conf             889789887420268689996488762-----34555554179827996154476555672565237-888864334430
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGSTS-----YDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNP-NRLDDLSGQGHL  209 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi~~-----~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP-~~~~~~~p~~~l  209 (600)
                      |++...++.+.+.+++=||.--.|..+     .++++.+.++|+-|+++-+-.-....+.-+..-+- .+.+.- +-.+|
T Consensus        12 G~~~~~l~~~~~~~~~GiVl~~~G~Gn~p~~~~~~l~~a~~~gi~VV~~Sqc~~G~v~~~~y~~g~~l~~~G~I-~~g~l   90 (135)
T 1zq1_A           12 GISSEIIDFLVDKGYKGIVIEGTGLGHTPNDIIPSIERAVEEGVAVCXTSQCIYGRVNLNVYSTGRKLLKAGVI-PCEDX   90 (135)
T ss_dssp             TCCTHHHHHHHHTTCSEEEEEEBTTTBCCGGGHHHHHHHHHTTCEEEEEESSSBSCCCCSSSHHHHHHHHTTCE-ECTTC
T ss_pred             CCCHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHHHHCCEE-ECCCC
T ss_conf             77999999997366867999867788898899999999997797799945789788277765444778869988-88998


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             47889999999999
Q gi|254780901|r  210 CAAGVVFLVLVLIY  223 (600)
Q Consensus       210 ~gaGvaf~l~~al~  223 (600)
                      +..-.--||+.+|.
T Consensus        91 t~ekArikL~~~L~  104 (135)
T 1zq1_A           91 LPETAYVKLXWVLG  104 (135)
T ss_dssp             CHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHC
T ss_conf             99999999999984


No 414
>>1dd9_A DNA primase, DNAG; toprim, 3-helix bundle, DNA-binding protein, RNA polymerase, replication protein; HET: DNA; 1.60A {Escherichia coli} (A:146-285)
Probab=31.23  E-value=28  Score=13.83  Aligned_cols=30  Identities=10%  Similarity=0.160  Sum_probs=17.1

Q ss_pred             CCCCCHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             668897898874202686899964887623
Q gi|254780901|r  134 GYGPNPSLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus       134 GYGl~~~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      |-+++...++.+...+.+++|..|+.-...
T Consensus        46 ~~~~~~~~~~~l~~~~~~i~i~~D~D~~G~   75 (140)
T 1dd9_A           46 GTSTTADHIQLLFRATNNVICCYDGDRAGR   75 (140)
T ss_dssp             C-CCCHHHHHHHHHHCSEEEEEEESSHHHH
T ss_pred             HCCCHHHHHHHHHHCCCCEEEEECCCCHHH
T ss_conf             102117899998740774578753662021


No 415
>>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} (A:1-54,A:195-289,A:461-507)
Probab=31.19  E-value=28  Score=13.82  Aligned_cols=30  Identities=17%  Similarity=0.147  Sum_probs=16.3

Q ss_pred             ECCCCCCHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             648876234555554179827996154476
Q gi|254780901|r  156 VDCGSTSYDALQYATNQGIDVIVIDHHQVK  185 (600)
Q Consensus       156 vD~Gi~~~e~i~~a~~~GidvIVtDHH~~~  185 (600)
                      +--|++-.....++.+.|.+|+|.|.+...
T Consensus        17 iG~g~~g~~~a~~~~~~g~~v~~~e~~~~~   46 (196)
T 1coy_A           17 IGSGYGGAVAALRLTQAGIPTQIVEMGRSW   46 (196)
T ss_dssp             ECCSHHHHHHHHHHHHTTCCEEEECSSCCS
T ss_pred             ECCCHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             787689999999996682969999788898


No 416
>>1zcc_A Glycerophosphodiester phosphodiesterase; NYSGXRC, agrobacterium tumefaciens STR. C58, structural genomics, PSI; 2.50A {Agrobacterium tumefaciens str} (A:)
Probab=31.17  E-value=28  Score=13.82  Aligned_cols=28  Identities=25%  Similarity=0.348  Sum_probs=17.1

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             6234555554179827996154476555
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      ++.++...|.+.|.|.|=+|=|.-.+..
T Consensus        17 NT~~a~~~A~~~Ga~~iE~DV~~TkDg~   44 (248)
T 1zcc_A           17 NTFAAADLALQQGADYIELDVRESADGV   44 (248)
T ss_dssp             SSHHHHHHHHHTTCSEEEEEEEECTTCC
T ss_pred             CHHHHHHHHHHCCCCEEEEEEEEECCCC
T ss_conf             2899999999849898999889915998


No 417
>>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} (A:1-183)
Probab=31.12  E-value=28  Score=13.82  Aligned_cols=67  Identities=13%  Similarity=0.200  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHC-CCCEEEEECCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             289999999997699479980787433668897898874202-6868999648876234555554179827996
Q gi|254780901|r  107 ASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE-GAQLIITVDCGSTSYDALQYATNQGIDVIVI  179 (600)
Q Consensus       107 tstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~-g~~LiItvD~Gi~~~e~i~~a~~~GidvIVt  179 (600)
                      |..-.+.++|++.|.+..+-+|.-      -+...++.+.++ +...+.+.+.+...+-+..+++..|.-++++
T Consensus         4 t~~~~ia~~L~~~Gv~~vfg~pg~------~~~~~~~~~~~~~~~~~v~~~~E~~A~~~A~g~~~~~g~~~~~~   71 (183)
T 2vbi_A            4 TVGMYLAERLVQIGLKHHFAVAGD------YNLVLLDQLLLNKDMKQIYCCNELNCGFSAEGYARSNGAAAAVV   71 (183)
T ss_dssp             BHHHHHHHHHHHHTCSEEEECCCT------TTHHHHHHHHTCTTSEEEECSSHHHHHHHHHHHHHHHSCEEEEE
T ss_pred             CHHHHHHHHHHHCCCCEEEEECCC------CHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCEEEEE
T ss_conf             599999999998799999997881------48999999865699849904888999999999999869969999


No 418
>>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreductase, structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} (A:1-122,A:268-335)
Probab=31.06  E-value=28  Score=13.81  Aligned_cols=50  Identities=16%  Similarity=0.291  Sum_probs=37.1

Q ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEEC
Q ss_conf             202686899964887623455555417982799615447655567256523
Q gi|254780901|r  146 INEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVN  196 (600)
Q Consensus       146 ~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivN  196 (600)
                      .....++|| +-.|.+-..+..+|.+.|.+|+|+|.+..++.....-.+.+
T Consensus        11 ~~~~~DViV-IGaGpAGl~aA~~la~~G~~V~viE~~~~~Gg~~~~~~~~~   60 (190)
T 2a87_A           11 HHPVRDVIV-IGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVEN   60 (190)
T ss_dssp             CCCCEEEEE-ECCHHHHHHHHHHHHHTTCCCEEECCSSCSCGGGSCSCBCC
T ss_pred             CCCCCCEEE-ECCCHHHHHHHHHHHHCCCCEEEECCCCCCCEEEECCCCCC
T ss_conf             798887999-89879999999999988996899867985865565167288


No 419
>>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} (A:180-307)
Probab=30.99  E-value=9.6  Score=17.44  Aligned_cols=93  Identities=9%  Similarity=0.019  Sum_probs=47.1

Q ss_pred             HHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             999977997999940788615289999999997699479980787--433668897898874202686899964887623
Q gi|254780901|r   86 VQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSY  163 (600)
Q Consensus        86 ~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~  163 (600)
                      .+.+++-++-+|+..+.+----+...+.++.+.+|+-|......|  +.+.+-+.......  -..++|+|++.|  .-.
T Consensus         6 ~~~l~~A~rPvii~G~g~~~~~a~~~l~~lae~~g~pv~~t~~~~g~~~~~hp~~~g~~g~--~~~aDlil~iG~--~~~   81 (128)
T 1efp_A            6 DRPELTSARRVVSGGRGLGSKESFAIIEELADKLGAAVGASRAAVDSGYAPNDWQVGQTGK--VVAPELYVAVGI--SGA   81 (128)
T ss_dssp             CSCCTTTCSEEEEECGGGCSSSTTHHHHHHHHHHTCEEEECHHHHHTTSSCGGGBBSSSSB--CCCCSEEEEESC--CCC
T ss_pred             CCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCEEEECHHHCCCCCCCHHHHCCCCCC--CCCCCEEEEEEE--ECC
T ss_conf             4544245748998577446888999999999986994786076506899996886477785--027889999823--226


Q ss_pred             HHHHHHHHCCCCEEEECCC
Q ss_conf             4555554179827996154
Q gi|254780901|r  164 DALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       164 e~i~~a~~~GidvIVtDHH  182 (600)
                      +....-....-.+|.+|-+
T Consensus        82 ~~~~~~~~~~~~ii~Id~d  100 (128)
T 1efp_A           82 IQHLAGMKDSKVIVAINKD  100 (128)
T ss_dssp             HHHHTTTTTCSEEEEEESC
T ss_pred             HHHHCCCCCCCEEEEEECC
T ss_conf             6775478989879997688


No 420
>>2etv_A Iron(III) ABC transporter, periplasmic iron- binding protein, putative; TM0189, structural genomics; HET: MLY; 1.70A {Thermotoga maritima MSB8} (A:1-175)
Probab=30.98  E-value=28  Score=13.80  Aligned_cols=39  Identities=18%  Similarity=0.297  Sum_probs=18.1

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             88742026868999648876234555554179827996154
Q gi|254780901|r  142 MEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       142 i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH  182 (600)
                      +|.+.+-+++|+|.-+.+  ..+.++.+++.|+.+++.+..
T Consensus        89 ~E~i~~l~PDlvi~~~~~--~~~~~~~l~~~gip~v~~~~~  127 (175)
T 2etv_A           89 LESLITLQPDVVFITYVD--RXTAXDIQEXTGIPVVVLSYG  127 (175)
T ss_dssp             HHHHHHHCCSEEEEESCC--HHHHHHHHHHHTSCEEEECCC
T ss_pred             HHHHHCCCCCEEEECCCC--CCHHHHHHHHCCCCEEEECCC
T ss_conf             999962799799857887--402566654138877984145


No 421
>>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- terminal domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} (A:126-227)
Probab=30.97  E-value=28  Score=13.80  Aligned_cols=85  Identities=15%  Similarity=0.103  Sum_probs=54.9

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHH----HHHHC
Q ss_conf             56148799999999999779979999407886152899999999976994799807874336688978988----74202
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLME----KFINE  148 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~----~~~~~  148 (600)
                      |.++.++.+ +++.+.++..++|.|+|    =|.++.- +...|...|.+|..+.++.--=++.+.++.-+    .+.+.
T Consensus         3 ~~~r~~~d~-~~i~~~~~~~k~i~IvG----gG~iGlE-~A~~l~~~g~~Vtlv~~~~~~l~~~~~~~~~~~~~~~l~~~   76 (102)
T 3klj_A            3 FSLYSYDDA-LKIKDECKNKGKAFIIG----GGILGIE-LAQAIIDSGTPASIGIILEYPLERQLDRDGGLFLKDKLDRL   76 (102)
T ss_dssp             ECCSSHHHH-HHHHHHHHHHSCEEEEC----CSHHHHH-HHHHHHHHTCCEEEECSSSSSCTTTSCHHHHHHHHHHHHTT
T ss_pred             CCCCCHHHH-HHHHHHHHCCCEEEEEC----CCHHHHH-HHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             133779999-87655440497699997----8605678-99999962992799996153112335789999999987627


Q ss_pred             CCCEEEEECCCCCCHHH
Q ss_conf             68689996488762345
Q gi|254780901|r  149 GAQLIITVDCGSTSYDA  165 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~  165 (600)
                      |++++  .++.+++.+.
T Consensus        77 gv~i~--~~~~v~~i~~   91 (102)
T 3klj_A           77 GIKIY--TNSNFEEMGD   91 (102)
T ss_dssp             TCEEE--CSCCGGGCHH
T ss_pred             CEEEE--ECCEEEECCC
T ss_conf             75999--5879986574


No 422
>>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} (A:146-268)
Probab=30.88  E-value=28  Score=13.79  Aligned_cols=78  Identities=10%  Similarity=0.106  Sum_probs=50.6

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             79979999407886152899999999976994799807874336688978988742026868999648876234555554
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYAT  170 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~  170 (600)
                      ++.||++.||--- |-|.- -+..+|..+|.++.+..|..    |-+..+.+.+  ..+.++.+|-|.-    +++    
T Consensus         3 ~g~kia~vGD~~~-~rv~~-Sl~~~l~~~g~~v~~~~p~~----~~~~~~~~~~--~~~~~~~~~~d~~----ea~----   66 (123)
T 1pg5_A            3 DGLVFALLGDLKY-ARTVN-SLLRILTRFRPKLVYLISPQ----LLRARKEILD--ELNYPVKEVENPF----EVI----   66 (123)
T ss_dssp             TTCEEEEEECCSS-CHHHH-HHHHHGGGSCCSEEEEECCG----GGCCCHHHHT--TCCSCEEEESCGG----GTG----
T ss_pred             CCCEEEEEECCCC-CHHHH-HHHHHHHHCCCCEEECCCHH----HCCCHHHHHH--HHCCCCCCCCCHH----HHH----
T ss_conf             5665899726872-04675-69999987399646426736----4065177776--5256422246888----872----


Q ss_pred             HCCCCEEEECCCCCC
Q ss_conf             179827996154476
Q gi|254780901|r  171 NQGIDVIVIDHHQVK  185 (600)
Q Consensus       171 ~~GidvIVtDHH~~~  185 (600)
                       .|.|||.||-....
T Consensus        67 -~~aDvvy~~~~~~~   80 (123)
T 1pg5_A           67 -NEVDVLYVTRIQKE   80 (123)
T ss_dssp             -GGCSEEEEECCCST
T ss_pred             -CCCCEEEEECCCCC
T ss_conf             -45535764034434


No 423
>>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} (A:127-275)
Probab=30.82  E-value=28  Score=13.78  Aligned_cols=77  Identities=9%  Similarity=0.156  Sum_probs=32.4

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             97799799994078861528999999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ++.+++++|+|   +-|..+.+ +....+..|+++....-+         .+-.+.+++.|.+.+|...-.....+..+.
T Consensus        16 ~~~g~~Vli~G---a~g~vG~~-~~~la~~~g~~vi~~~~~---------~~~~~~~~~~ga~~~i~~~~~~~~~~~~~~   82 (149)
T 3gms_A           16 LQRNDVLLVNA---CGSAIGHL-FAQLSQILNFRLIAVTRN---------NKHTEELLRLGAAYVIDTSTAPLYETVMEL   82 (149)
T ss_dssp             CCTTCEEEESS---TTSHHHHH-HHHHHHHHTCEEEEEESS---------STTHHHHHHHTCSEEEETTTSCHHHHHHHH
T ss_pred             CCCCCEEEEEE---CCCCCCCC-CCHHCCCCCCCCCCCCCC---------CCCCCHHHHHHHHHCCCCCCCCHHHHHHHH
T ss_conf             45532689840---57641001-100012354321111233---------222100122100010246765799999997


Q ss_pred             HHHCCCCEEE
Q ss_conf             5417982799
Q gi|254780901|r  169 ATNQGIDVIV  178 (600)
Q Consensus       169 a~~~GidvIV  178 (600)
                      ....|.|+++
T Consensus        83 ~~~~g~dvvi   92 (149)
T 3gms_A           83 TNGIGADAAI   92 (149)
T ss_dssp             TTTSCEEEEE
T ss_pred             HCCCCCEEEE
T ss_conf             2899857998


No 424
>>2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} (X:152-335,X:532-565)
Probab=30.81  E-value=28  Score=13.78  Aligned_cols=125  Identities=14%  Similarity=0.189  Sum_probs=59.9

Q ss_pred             CCCCCHHHHHHHHHCCCCEEEEECCCCCCHH-------HHHHHHHCCCCEEEECCCCCCCC-CCCCEEEECCCCCCCCCC
Q ss_conf             6688978988742026868999648876234-------55555417982799615447655-567256523788886433
Q gi|254780901|r  134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYD-------ALQYATNQGIDVIVIDHHQVKSE-EIPAYALVNPNRLDDLSG  205 (600)
Q Consensus       134 GYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e-------~i~~a~~~GidvIVtDHH~~~~~-~p~a~aivNP~~~~~~~p  205 (600)
                      |+|-....++++.+  .++|+.+  |++..+       .+..++++|..|||+|.-..+.. .-+-...|.|   +.+  
T Consensus         2 G~g~~~~~~~Di~n--ad~IL~~--G~N~~~s~p~~~~~l~~ar~~GakvVvIdPr~t~ta~~AD~~l~vrP---GtD--   72 (218)
T 2iv2_X            2 GNGAMSNAINEIDN--TDLVFVF--GYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKN---GSN--   72 (218)
T ss_dssp             SCCSCSSCGGGGGG--CSEEEEE--SCCHHHHCHHHHHHHHHHHHTTCEEEEECSSCCHHHHTCSEEECCCT---TCH--
T ss_pred             CCCCCCCCCCCCCC--CCEEEEC--CCCCHHHCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHCCCCC---CCH--
T ss_conf             57877886321102--4246867--81804411126677789986799899957642057888655135566---868--


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCCCHH------HHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             4430478899999999999702148876407------79999999877542011114441189999878877516887
Q gi|254780901|r  206 QGHLCAAGVVFLVLVLIYRILRQDNKVPLNF------DLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP  277 (600)
Q Consensus       206 ~~~l~gaGvaf~l~~al~~~l~~~~~~~~~~------~l~~~ldlvaiGTvaD~vpL~~eNR~lvk~GL~~l~~~~~~  277 (600)
                            +    .|+.+|.+.+-+.+.....+      ...++.+.+.=-|.+.+....|..+--+++=-+.+.+.++.
T Consensus        73 ------~----al~~al~~~ii~~g~~d~~fv~~~t~g~~~~~~~~~~~t~~~~a~~tGv~~~~i~~lA~~~a~a~~~  140 (218)
T 2iv2_X           73 ------I----ALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSA  140 (218)
T ss_dssp             ------H----HHHHHHHHHHHHTTCSCHHHHHHHEECHHHHHHHHHTCCSGGGHHHHCCCHHHHHHHHHHHHHSSSE
T ss_pred             ------H----HHHHHHHHHHHHCCCCCHHHHHHCCCCCCCHHHHHHHCCHHHHHHHCCCCHHHHHHHHHHHHCCCCC
T ss_conf             ------9----9997656666766883644565324673100244431002456765287488888889987403542


No 425
>>1wsa_A Asparaginase, asparagine amidohydrolase; signal, periplasmic; 2.20A {Wolinella succinogenes} (A:206-330)
Probab=30.79  E-value=28  Score=13.78  Aligned_cols=49  Identities=22%  Similarity=0.253  Sum_probs=36.5

Q ss_pred             CCCCHHHHHHHHHCCCCEEEEECCCCCC-----HHHHHHHHHCCCCEEEECCCC
Q ss_conf             6889789887420268689996488762-----345555541798279961544
Q gi|254780901|r  135 YGPNPSLMEKFINEGAQLIITVDCGSTS-----YDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       135 YGl~~~~i~~~~~~g~~LiItvD~Gi~~-----~e~i~~a~~~GidvIVtDHH~  183 (600)
                      =|++.+.++.+.+.+++=||.--.|..+     .++++.+.++|+-|+++-.-.
T Consensus        20 pG~~~~~i~~~~~~~~~GiVi~~~G~G~~p~~~~~~l~~a~~~gi~vV~~sr~~   73 (125)
T 1wsa_A           20 PDDTDVLVNAALQAGAKGIIHAGMGNGNPFPLTQNALEKAAKSGVVVARSSRVG   73 (125)
T ss_dssp             SSCCSHHHHHHHHTTCSEEEEEEBTTTBCCHHHHHHHHHHHHTTCEEEEEESSS
T ss_pred             CCCCHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             999999999998679967999655799988899999999976797799986679


No 426
>>3dla_A Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis} (A:1-322)
Probab=30.77  E-value=28  Score=13.78  Aligned_cols=57  Identities=9%  Similarity=0.074  Sum_probs=26.2

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCH-------------------HH-HHHHHHCCCCEEEECCCCCCCCCCCCEEEECC
Q ss_conf             98874202686899964887623-------------------45-55554179827996154476555672565237
Q gi|254780901|r  141 LMEKFINEGAQLIITVDCGSTSY-------------------DA-LQYATNQGIDVIVIDHHQVKSEEIPAYALVNP  197 (600)
Q Consensus       141 ~i~~~~~~g~~LiItvD~Gi~~~-------------------e~-i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP  197 (600)
                      .++.+++.|++||+..-+.++..                   ++ .+.|++.++-+++--........-.+..++++
T Consensus        37 ~i~~A~~~gadlivfPE~~l~gy~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~i~iv~g~~~~~~~~~~~~~~~~~~  113 (322)
T 3dla_A           37 MARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDAVEDALLDLVTESADLLPVLVVGAPLRHRHRIYNTAVVIHR  113 (322)
T ss_dssp             HHHHHHHTTCSEEECCTTTTTCGGGGGGGGCHHHHHHHHHHHHHHHHHGGGCCSEEEEEEEEEETTEEEEEEEEEET
T ss_pred             HHHHHHHCCCCEEECCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCEEEEEEEEEEC
T ss_conf             99999988897999688830369966760188899999999999999705168599999999689949999999989


No 427
>>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} (A:122-286)
Probab=30.76  E-value=28  Score=13.77  Aligned_cols=45  Identities=13%  Similarity=0.318  Sum_probs=33.2

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             89887420268689996488762345555541798279961544765
Q gi|254780901|r  140 SLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       140 ~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                      ..+.+......+..|.++|  .+.+|+..|.+.|.|.|..||=.+..
T Consensus        77 ~~~~~~~~~~~~~~i~~~~--~t~~e~~~A~~~g~d~v~l~~~~~t~  121 (165)
T 3gnn_A           77 EALDAAFALNAEVPVQIEV--ETLDQLRTALAHGARSVLLDNFTLDM  121 (165)
T ss_dssp             HHHHHHHHHC--CCCEEEE--SSHHHHHHHHHTTCEEEEEESCCHHH
T ss_pred             CCCHHHHHCCCCCEEEEEE--CCHHHHHHHHHCCCCEEHHCCCCHHH
T ss_conf             1111233304650488751--66888899986288651115899999


No 428
>>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} (A:1-123,A:300-306)
Probab=30.70  E-value=12  Score=16.57  Aligned_cols=46  Identities=17%  Similarity=0.283  Sum_probs=24.5

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHC--CCC-EEEECCC
Q ss_conf             8897898874202686899964887623455555417--982-7996154
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQ--GID-VIVIDHH  182 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~--Gid-vIVtDHH  182 (600)
                      |-|...+....+.+-+.++ +|||.+..+....+...  .++ |++|-.|
T Consensus        19 ~~~~~~~~~~~~~~~~~~L-iD~G~~~~~~~~~~~~~~~~i~~I~iTH~H   67 (130)
T 2cbn_A           19 NVTAILLNLQHPTQSGLWL-FDCGEGTQHQLLHTAFNPGKLDKIFISHLH   67 (130)
T ss_dssp             CBCEEEEECCCSSCCCEEE-ECCCTTHHHHHHTSCCCTTTEEEEECSCCC
T ss_pred             CCCEEEEEEECCCCCCEEE-EECCHHHHHHHHHHCCCHHHCCEEEECCCC
T ss_conf             6388999970688995899-979758999999818997788589973445


No 429
>>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} (A:1-206,A:317-390,A:459-472)
Probab=30.69  E-value=28  Score=13.76  Aligned_cols=54  Identities=19%  Similarity=0.051  Sum_probs=39.1

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             999648876234555554179827996154476555672565237888864334
Q gi|254780901|r  153 IITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQ  206 (600)
Q Consensus       153 iItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~  206 (600)
                      ||.|-.|.+..-+.-.|.+.|.+|+|++.-.+.....-+---+|......++|.
T Consensus         2 ViVIG~G~AGl~AAi~aae~G~~VilieK~~~gg~s~~a~Ggi~~a~~~~Ds~e   55 (294)
T 2e5v_A            2 IYIIGSGIAGLSAGVALRRAGKKVTLISKRIDGGSTPIAKGGVAASVGSDDSPE   55 (294)
T ss_dssp             EEEECCSHHHHHHHHHHHHTTCCEEEECSSTTCSSGGGCCSCEECCCSTTCCHH
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHCCHHCEECCCCCCHH
T ss_conf             899968499999999999879908999579999854786704416069998999


No 430
>>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} (A:)
Probab=30.39  E-value=29  Score=13.73  Aligned_cols=53  Identities=19%  Similarity=0.177  Sum_probs=31.6

Q ss_pred             CCCHHHHHHHHHCCCCEE-EEE-------CCCC--------CC-HHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             889789887420268689-996-------4887--------62-34555554179827996154476555
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLI-ITV-------DCGS--------TS-YDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~Li-Itv-------D~Gi--------~~-~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      -..++-|+.+++.|.+.+ |-+       +-|.        .- .+.|+.|++.||.|||+=||.+....
T Consensus        73 ~~~~~Di~~ik~~G~n~vRipi~w~~~~~~~~~~~~~~~~~~~~d~~i~~~~~~gi~vii~lh~~~~~~~  142 (408)
T 1h4p_A           73 FYQEQDFANIASQGFNLVRIPIGYWAFQILDDDPYVSGLQESYLDQAIGWARNNSLKVWVDLHGAAGSQN  142 (408)
T ss_dssp             HSCHHHHHHHHHTTCCEEEEEEEGGGTCCCTTCCCCCSSHHHHHHHHHHHHHHTTCEEEEEEEECTTCSS
T ss_pred             CCCHHHHHHHHHCCCCEEEECCCHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             2889999999986998899656317744778886756268999999999999879989998158875556


No 431
>>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} (A:1-39,A:149-206,A:316-372)
Probab=30.35  E-value=29  Score=13.72  Aligned_cols=36  Identities=36%  Similarity=0.545  Sum_probs=21.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             6899964887623455555417982799615447655
Q gi|254780901|r  151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE  187 (600)
Q Consensus       151 ~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~  187 (600)
                      +++| +--|++-.-..-++.+.|++|.|+|-+.++..
T Consensus         4 dv~v-iG~G~~G~~~a~~l~~~g~~v~~~e~~~~~~~   39 (154)
T 2uzz_A            4 DLII-IGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQ   39 (154)
T ss_dssp             EEEE-SCTTHHHHHHHHHHHHTTCCEEEECSSCSSSS
T ss_pred             CEEE-ECCCHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             9999-99569999999999978995899938999850


No 432
>>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} (A:1-183)
Probab=30.18  E-value=29  Score=13.70  Aligned_cols=10  Identities=20%  Similarity=0.587  Sum_probs=3.9

Q ss_pred             HHHHCCCCCC
Q ss_conf             5420111144
Q gi|254780901|r  248 ATVCDVVPLI  257 (600)
Q Consensus       248 GTvaD~vpL~  257 (600)
                      |-++|++.+.
T Consensus       112 ~~vsdv~~~~  121 (183)
T 1efv_A          112 APISDIIAIK  121 (183)
T ss_dssp             CCEEEECEEE
T ss_pred             CCCCCEEEEC
T ss_conf             6106758960


No 433
>>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} (A:1-105,A:242-288)
Probab=30.14  E-value=29  Score=13.70  Aligned_cols=40  Identities=23%  Similarity=0.295  Sum_probs=15.6

Q ss_pred             HHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             9887420268689996488762345555541798279961544
Q gi|254780901|r  141 LMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       141 ~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      .++.+.+.+++-+|.+....   +....+...++.+++.|...
T Consensus        55 ~i~~li~~~VDGIIl~~~~~---~~~~~~~~~~IPvV~idr~~   94 (152)
T 2qu7_A           55 LIETFVSQNVSAIILVPVKS---KFQMKREWLKIPIMTLDREL   94 (152)
T ss_dssp             HHHHHHHTTEEEEEECCSSS---CCCCCGGGGGSCEEEESCCC
T ss_pred             HHHHHHHCCCCCCCCCCCHH---HHHHHHHHHHEEEEECCCCC
T ss_conf             99999745967221256213---56665543120000012343


No 434
>>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} (A:193-374)
Probab=30.11  E-value=29  Score=13.70  Aligned_cols=81  Identities=20%  Similarity=0.316  Sum_probs=41.8

Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCH-HHHHHHHHCCCCEE
Q ss_conf             14879999999999977997999940788615289999999997699479980787433668897-89887420268689
Q gi|254780901|r   75 LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNP-SLMEKFINEGAQLI  153 (600)
Q Consensus        75 l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~-~~i~~~~~~g~~Li  153 (600)
                      +..++.-+-.+..+.+++.+.+|+.+ |+||=.-+.++.+-++-.-.-+-...|     |||-+. +.++++.--.-.-+
T Consensus        35 i~~~~~ilp~Le~~~~~~~PLlIiAe-dv~~eaL~~li~N~l~g~~~v~aVkaP-----gfGd~rk~~L~DiAilTG~~v  108 (182)
T 1iok_A           35 LSSLQPMVPLLESVIQSQKPLLIVAE-DVEGEALATLVVNKLRGGLKIAAVKAP-----GFGDRRKAMLQDIAILTGGQV  108 (182)
T ss_dssp             BCCCCC-----------CCCCEEEES-CBC-----------------CEEEECS-----CCTTHHHHHHHHHHHHHTC--
T ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHH-HHHHHHHHHHHHHHHHCCCCEEEEECC-----CCHHHHHHHHHHHHHHHCCEE
T ss_conf             55043315999999971850789999-889999999999987543748999378-----853999999999888729898


Q ss_pred             EEECCCCC
Q ss_conf             99648876
Q gi|254780901|r  154 ITVDCGST  161 (600)
Q Consensus       154 ItvD~Gi~  161 (600)
                      |..|.|.+
T Consensus       109 i~~~~g~~  116 (182)
T 1iok_A          109 ISEDLGMK  116 (182)
T ss_dssp             --------
T ss_pred             ECHHHHCC
T ss_conf             33032046


No 435
>>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} (A:1-144)
Probab=30.09  E-value=29  Score=13.69  Aligned_cols=50  Identities=16%  Similarity=0.216  Sum_probs=25.9

Q ss_pred             CHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             978988742026868999648876234555554179827996154476555
Q gi|254780901|r  138 NPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       138 ~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      +...+.++.+......+ |++..+..++++.+.+.-.|+|++|-..|.-..
T Consensus        15 ~r~~l~~~L~~~g~~~~-v~~a~~~~~al~~~~~~~pDlvi~D~~mP~~dG   64 (144)
T 1a2o_A           15 MRQIMTEIINSHSDMEM-VATAPDPLVARDLIKKFNPDVLTLDVEMPRMDG   64 (144)
T ss_dssp             HHHHHHHHHHTSTTEEE-EEEESSHHHHHHHHHHHCCSEEEEECCCSSSCH
T ss_pred             HHHHHHHHHHHCCCEEE-EEEECCHHHHHHHHHHCCCCEEEEECCCCCCCH
T ss_conf             99999999985989489-999799999999997279999999797899998


No 436
>>1eo1_A Hypothetical protein MTH1175; mixed A/B protein, mixed beta sheet, strand order 321456; NMR {Methanothermobacterthermautotrophicus} (A:)
Probab=30.07  E-value=29  Score=13.69  Aligned_cols=48  Identities=17%  Similarity=0.279  Sum_probs=32.0

Q ss_pred             CCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             668897898874202686899964887623455555417982799615447
Q gi|254780901|r  134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       134 GYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      +.|-.....+.+...+++++|+-..|-.+.   ..+.+.||+|+.++==.+
T Consensus        50 ~~~~~~~~~~~l~~~~v~~vi~~~iG~~~~---~~l~~~gI~v~~~~~g~v   97 (124)
T 1eo1_A           50 SGGAGIRTAQIIANNGVKAVIASSPGPNAF---EVLNELGIKIYRATGTSV   97 (124)
T ss_dssp             SSSCSTTHHHHHHHTTCCEEEECCSSHHHH---HHHHHHTCEEEECCSCCH
T ss_pred             CCCCHHHHHHHHHHCCCCEEEECCCCHHHH---HHHHHCCCEEEECCCCCH
T ss_conf             776214679999976998999886798899---999987999997399799


No 437
>>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} (A:)
Probab=29.96  E-value=29  Score=13.68  Aligned_cols=86  Identities=12%  Similarity=0.212  Sum_probs=54.8

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC---CCCCC--------HHHHHHHHHC
Q ss_conf             999999999977997999940788615289999999997699479980787433---66889--------7898874202
Q gi|254780901|r   80 KAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD---GYGPN--------PSLMEKFINE  148 (600)
Q Consensus        80 ~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~e---GYGl~--------~~~i~~~~~~  148 (600)
                      .=|.+|.+.+.  .+.-+-+.       .|.=|.+.......+-.+.+|.+-.|   -.|++        .+.++++++.
T Consensus        84 ~Dv~~L~~~i~--~~lNlE~a-------~t~emi~ia~~~kP~~vtLVPEkr~ElTTegGlDv~~~~~~L~~~i~~Lk~~  154 (278)
T 3gk0_A           84 ADVRTLRPRVK--TRMNLECA-------VTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRAACKQLADA  154 (278)
T ss_dssp             HHHHHHHHHCS--SCEEEEEC-------SSHHHHHHHHHHCCSEEEECCCSGGGBCSSSSBCTTTTHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHCCC--CCCCCCCC-------CHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHC
T ss_conf             88888874035--56686656-------6388999898514038998325765312236454121787899999999872


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEE
Q ss_conf             68689996488762345555541798279
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVI  177 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvI  177 (600)
                      |+..=+++|-   ..++|+.|++.|.|.|
T Consensus       155 gIrVSLFiDP---~~~qi~~A~~~GAd~V  180 (278)
T 3gk0_A          155 GVRVSLFIDP---DEAQIRAAHETGAPVI  180 (278)
T ss_dssp             TCEEEEEECS---CHHHHHHHHHHTCSEE
T ss_pred             CCCEEEEECC---CHHHHHHHHHHCCCEE
T ss_conf             8727999645---3144778776166767


No 438
>>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A (A:1-117,A:314-364)
Probab=29.91  E-value=29  Score=13.67  Aligned_cols=42  Identities=21%  Similarity=0.396  Sum_probs=27.4

Q ss_pred             CCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             897898874202686899964887623455555417982799615
Q gi|254780901|r  137 PNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       137 l~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDH  181 (600)
                      ++.+.|+.+..  .++|+|+--|+..++ ++.|+++||.|.-+.|
T Consensus        74 it~e~L~~ap~--LKlI~taGvG~DhVD-l~AA~erGI~V~nvpg  115 (168)
T 2j6i_A           74 ITKERIDKAKK--LKLVVVAGVGSDHID-LDYINQTGKKISVLEV  115 (168)
T ss_dssp             BCHHHHHHCTT--CCEEEESSSCCTTBC-HHHHHHHTCCCEEEEC
T ss_pred             CCHHHHHCCCC--CCEEEEECCCCCCCC-HHHHHHHCCCEEEECC
T ss_conf             69999951899--639999088776658-9999974992057358


No 439
>>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* (A:1-121,A:252-323)
Probab=29.85  E-value=29  Score=13.66  Aligned_cols=68  Identities=21%  Similarity=0.207  Sum_probs=42.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             2686899964887623455555417982799615447655567256523788886433443047889999999999
Q gi|254780901|r  148 EGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIY  223 (600)
Q Consensus       148 ~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~  223 (600)
                      +..+++| +-.|-+-.++..++.++|.+|+|+|++......+...  +++.     .......+..+.-.+...+.
T Consensus        14 ~~~dVvI-IGgGpaGlsaA~~lar~G~~v~iie~~~~~~~~~~~~--~~~~-----~~~~~~~~~~l~~~~~~~~~   81 (193)
T 3f8d_A           14 EKFDVII-VGLGPAAYGAALYSARYMLKTLVIGETPGGQLTEAGI--VDDY-----LGLIEIQASDMIKVFNKHIE   81 (193)
T ss_dssp             CEEEEEE-ECCSHHHHHHHHHHHHTTCCEEEEESSTTGGGGGCCE--ECCS-----TTSTTEEHHHHHHHHHHHHH
T ss_pred             CEEEEEE-ECCCHHHHHHHHHHHHCCCCEEEEEECCCCEEEECCC--CCCC-----CCCCCCCHHHHHHHHHHHHH
T ss_conf             8246999-8988899999999997899899998068965774277--6882-----77755656999999875323


No 440
>>2ivf_A Ethylbenzene dehydrogenase alpha-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- bismgd enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Azoarcus SP} (A:221-331,A:412-482,A:781-806)
Probab=29.66  E-value=29  Score=13.64  Aligned_cols=59  Identities=25%  Similarity=0.203  Sum_probs=35.8

Q ss_pred             CCCCCHHHHHHHHHCCCCEEEEECCCCC-------CHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECC
Q ss_conf             6688978988742026868999648876-------234555554179827996154476555672565237
Q gi|254780901|r  134 GYGPNPSLMEKFINEGAQLIITVDCGST-------SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNP  197 (600)
Q Consensus       134 GYGl~~~~i~~~~~~g~~LiItvD~Gi~-------~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP  197 (600)
                      |+|-.....+++.  ++++||.+  |++       ....+..++++|..+||+|....+ .-..|+.-+.+
T Consensus        13 G~~~~~~~~~D~~--nad~il~~--G~N~~es~p~~~~~i~~ar~~GakiVvVdPr~t~-ta~~AD~wi~i   78 (208)
T 2ivf_A           13 GKMHMGYSADNLL--DAELIFMT--CSNWSYTYPSSYHFLSEARYKGAEVVVIAPDFNP-TTPAADLHVPV   78 (208)
T ss_dssp             SCCCCBCCGGGGG--GCSEEEEE--SCCHHHHCTTTHHHHHHHHHHTCEEEEECSSCCT-TGGGCSEEECC
T ss_pred             CCCCCCCCHHHHH--HCCEEEEE--CCCCHHCCCHHHHHHHHHHHCCCEEEEECCCCCC-HHHHHCCCCCC
T ss_conf             6887788977886--28839995--1570010206789999998679869998588785-57761525787


No 441
>>1cdo_A Alcohol dehydrogenase; oxidoreductase; HET: NAD; 2.05A {Gadus callarias} (A:169-322)
Probab=29.61  E-value=29  Score=13.63  Aligned_cols=83  Identities=17%  Similarity=0.130  Sum_probs=52.1

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH-H
Q ss_conf             977997999940788615289999999997699479980787433668897898874202686899964887623455-5
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL-Q  167 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i-~  167 (600)
                      ++.++.|+|+|   +=|+  +.+....++.+|....+.+-        .+.+..+.+++.|..-.|..+.-....+++ +
T Consensus        22 v~~g~~VlI~G---ag~~--g~~~~~~~~~~g~~~vi~~~--------~~~~~~~~~~~~ga~~~i~~~~~~~~~~~~~~   88 (154)
T 1cdo_A           22 VEPGSTCAVFG---LGAV--GLAAVMGCHSAGAKRIIAVD--------LNPDKFEKAKVFGATDFVNPNDHSEPISQVLS   88 (154)
T ss_dssp             CCTTCEEEEEC---CSHH--HHHHHHHHHHTTCSEEEEEC--------SCGGGHHHHHHTTCCEEECGGGCSSCHHHHHH
T ss_pred             CCCCCEEEEEC---CCHH--HHHHHHHHHHCCCCEEEEEE--------CCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHE
T ss_conf             99979999989---8889--99999999983998799996--------88798445786197421354233312444310


Q ss_pred             HHHHCCCCEEEECCCCC
Q ss_conf             55417982799615447
Q gi|254780901|r  168 YATNQGIDVIVIDHHQV  184 (600)
Q Consensus       168 ~a~~~GidvIVtDHH~~  184 (600)
                      .....|.|++|.+-..+
T Consensus        89 ~~~~~g~~~vi~~~~~~  105 (154)
T 1cdo_A           89 KMTNGGVDFSLECVGNV  105 (154)
T ss_dssp             HHHTSCBSEEEECSCCH
T ss_pred             EECCCCEEEEEECCCCH
T ss_conf             01258717999645788


No 442
>>3dnf_A ISPH, LYTB, 4-hydroxy-3-methylbut-2-ENYL diphosphate reductase; trilobal strucure, open alpha/beta, 3Fe-4S, iron, iron- sulfur; 1.65A {Aquifex aeolicus} (A:11-96)
Probab=29.59  E-value=29  Score=13.63  Aligned_cols=66  Identities=15%  Similarity=0.206  Sum_probs=35.0

Q ss_pred             CHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEE----------EEECCCCCCCCCCCHHHHHHH
Q ss_conf             879999999999977-997999940788615289999999997699479----------980787433668897898874
Q gi|254780901|r   77 DCDKAARRIVQAIYN-SEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN----------MYIPDRIVDGYGPNPSLMEKF  145 (600)
Q Consensus        77 dm~~A~~ri~~ai~~-~ekI~I~gDyD~DGitstail~~~L~~~g~~v~----------~~IP~R~~eGYGl~~~~i~~~  145 (600)
                      +..+|++...++.+. +++|.++|+-     .---...+-|+..|..+.          ..|+     -||.+++..+++
T Consensus         5 GV~rAi~~~~~~~~~~~~~iy~lG~l-----VHN~~vv~~L~~~GV~~id~~e~~~~~~Viir-----AHGv~~~~~~~~   74 (86)
T 3dnf_A            5 GVKRAVKLAEESLKESQGKVYTLGPI-----IHNPQEVNRLKNLGVFPSQGEEFKEGDTVIIR-----SHGIPPEKEEAL   74 (86)
T ss_dssp             HHHHHHHHHHHHTTTCCSCEEESSCS-----SSCHHHHHHHHHHTEEECCSSCCCTTCEEEEC-----TTCCCHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEECCC-----CCCHHHHHHHHHCCCEECCHHHCCCCCEEEEH-----HCCCCHHHHHHH
T ss_conf             59999999999997459989985867-----68989999999689986353325665458862-----219988999999


Q ss_pred             HHCCCCE
Q ss_conf             2026868
Q gi|254780901|r  146 INEGAQL  152 (600)
Q Consensus       146 ~~~g~~L  152 (600)
                      .+.|..+
T Consensus        75 ~~~g~~i   81 (86)
T 3dnf_A           75 RKKGLKV   81 (86)
T ss_dssp             HHTTCEE
T ss_pred             HHCCCEE
T ss_conf             9709919


No 443
>>1req_B Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichiisubsp} (B:475-637)
Probab=29.58  E-value=29  Score=13.63  Aligned_cols=115  Identities=8%  Similarity=0.030  Sum_probs=66.1

Q ss_pred             CHHHHHHHHHHHHHC---CCCEEEEECC-CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCE
Q ss_conf             879999999999977---9979999407-886152899999999976994799807874336688978988742026868
Q gi|254780901|r   77 DCDKAARRIVQAIYN---SEKIMIFGDY-DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQL  152 (600)
Q Consensus        77 dm~~A~~ri~~ai~~---~ekI~I~gDy-D~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~L  152 (600)
                      -+..+.+.+.....+   +-+|++..=- |..=--+..++..+|+.-|.+|.+.-       .....+.++.+.+.++++
T Consensus        17 r~~~~~e~lr~~~~~~~~~~~v~l~~~~~~~~H~~g~~~~~~~l~~~G~~v~~lg-------~~~p~~~~~a~~~~~~d~   89 (163)
T 1req_B           17 RDSEVFEQLMDRSTSVSERPKVFLACLGTRRDFGGREGFSSPVWHIAGIDTPQVE-------GGTTAEIVEAFKKSGAQV   89 (163)
T ss_dssp             CTTHHHHHHHHHHHHSSSCCBCEEEECSCHHHHHHHHHHHHHHHHHTTCBCCEEE-------CCCHHHHHHHHHHHTCSE
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCC-------CCCHHHHHHHHHHCCCCE
T ss_conf             0199999999868861578176887058633210478888879984484203588-------899899999998659988


Q ss_pred             EEEECC-CC---CCHHHHHHHHHCCCCEEE-ECCCCCCCCCC-----CCEEEECCC
Q ss_conf             999648-87---623455555417982799-61544765556-----725652378
Q gi|254780901|r  153 IITVDC-GS---TSYDALQYATNQGIDVIV-IDHHQVKSEEI-----PAYALVNPN  198 (600)
Q Consensus       153 iItvD~-Gi---~~~e~i~~a~~~GidvIV-tDHH~~~~~~p-----~a~aivNP~  198 (600)
                      |..+.+ ..   ...+-++.+++.|.++.| .=...++....     -++.++.|.
T Consensus        90 i~ls~~~~~~~~~~~~~i~~lr~~~~~~~vi~GG~~~~~~~~~~~~~G~D~~~~~~  145 (163)
T 1req_B           90 ADLCSSAKVYAQQGLEVAKALKAAGAKALYLSGAFKEFGDDAAEAEKLIDGRLFMG  145 (163)
T ss_dssp             EEEECCHHHHHHHHHHHHHHHHHTTCSEEEEESCGGGGGGGHHHHHHHCCCEECTT
T ss_pred             EEEECCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHCCCCEEECCC
T ss_conf             99957861068889999999996699859997278874235689970876050189


No 444
>>1ym3_A Carbonic anhydrase (carbonate dehydratase) (carbonic dehydratase); Zn protein, structural proteomics in europe, spine; 1.75A {Mycobacterium tuberculosis H37RV} PDB: 2a5v_A (A:)
Probab=29.56  E-value=29  Score=13.63  Aligned_cols=20  Identities=30%  Similarity=0.521  Sum_probs=10.2

Q ss_pred             HHHHHH-HHCCCCEEEECCCC
Q ss_conf             455555-41798279961544
Q gi|254780901|r  164 DALQYA-TNQGIDVIVIDHHQ  183 (600)
Q Consensus       164 e~i~~a-~~~GidvIVtDHH~  183 (600)
                      ..++|+ ..+|++.||.=+|.
T Consensus        93 asieyav~~L~v~~IvV~GHt  113 (215)
T 1ym3_A           93 GSIEYAVTVLNVPLIVVLGHD  113 (215)
T ss_dssp             HHHHHHHHTSCCCEEEEEEES
T ss_pred             EEEEEEEECCCCCEEEEECCC
T ss_conf             156886412786789997686


No 445
>>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} (A:)
Probab=29.42  E-value=30  Score=13.61  Aligned_cols=83  Identities=17%  Similarity=0.248  Sum_probs=53.4

Q ss_pred             HHCCCHHHHHHHHHHHHHCC--CCEEEEECCCCCHHHHH---------HHHHHHHHHCCCCEEEEECCCC-CCCCCCCHH
Q ss_conf             56148799999999999779--97999940788615289---------9999999976994799807874-336688978
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNS--EKIMIFGDYDVDGAASV---------ALMMRFLSHCSVNANMYIPDRI-VDGYGPNPS  140 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~--ekI~I~gDyD~DGitst---------ail~~~L~~~g~~v~~~IP~R~-~eGYGl~~~  140 (600)
                      .+-+......+++.+.++..  .+|.|.|+-|..|....         .-...+|...|..     ++|+ ..|||-+..
T Consensus        64 ~l~~~~~~~L~~la~~l~~~p~~~i~I~Ghtd~~g~~~~n~~LS~~RA~aV~~~L~~~Gi~-----~~ri~~~g~G~~~p  138 (169)
T 3ldt_A           64 RLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNVGSRSHKRKLSQAQAETXXTFLWANGIA-----AKRLKAEGYGDKNA  138 (169)
T ss_dssp             HHHHHHCHHHHHHHHHHTTCTTSCEEEEEECTTSCCC--CHHHHHHHHHHHHHHHHHTTCC-----TTTEEECCTTCTTS
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC-----HHHEEEEEECCCCC
T ss_conf             2698899999999999997899579999972898976675779999999999999985999-----89989999756676


Q ss_pred             HHHH------HHHCCCCEEEEECCCC
Q ss_conf             9887------4202686899964887
Q gi|254780901|r  141 LMEK------FINEGAQLIITVDCGS  160 (600)
Q Consensus       141 ~i~~------~~~~g~~LiItvD~Gi  160 (600)
                      ....      ....-+.+.|..+.+.
T Consensus       139 ~~~~~~~~~~~~NRRVei~i~~~~~~  164 (169)
T 3ldt_A          139 ISDNAIIHGSAQNRRIEIQWFTSEGH  164 (169)
T ss_dssp             CCCTTTSCGGGGTSEEEEEEECCCC-
T ss_pred             CCCCCCHHHHHHCCCEEEEEEECCCC
T ss_conf             79992978998549889999968986


No 446
>>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus HB8} PDB: 2yri_A* (A:1-17,A:252-353)
Probab=29.27  E-value=30  Score=13.59  Aligned_cols=55  Identities=22%  Similarity=0.265  Sum_probs=33.2

Q ss_pred             EEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCC--------CEEECCCCHHHHHHHHHHHHH
Q ss_conf             9986489861888888530335301156532223--------146422215889999999998
Q gi|254780901|r  411 GSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAA--------GLTVERVNFGRLCDFFQKFAH  465 (600)
Q Consensus       411 GS~RSi~g~~l~~~l~~~~~~~ll~~~GGH~~Aa--------G~ti~~~~l~~f~~~l~~~~~  465 (600)
                      -+.+.++|+|.-++.+.+.++++.+..|..+.+.        |..+..+.+..+.+.|.+..+
T Consensus        55 Tav~~P~gid~~~l~~~L~e~gi~I~~G~g~l~~~~fRIghMG~~i~~~di~~~l~aL~~aL~  117 (119)
T 2yrr_A           55 LVVRPPEGVDADRLVRALYAEGVAVAGGIGPTRGQVLRLGLMGEGARREAYQAFLKALDRALA  117 (119)
T ss_dssp             EEEECCTTCCHHHHHHHHHHTTEECEECCGGGTTTCEEEECSGGGSCHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHCCEEEECCCHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             999799998999999999978919990664325999998288588989999999999999983


No 447
>>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genomics; 1.85A {Pyrococcus horikoshii OT3} (A:1-69,A:202-263)
Probab=29.25  E-value=30  Score=13.59  Aligned_cols=87  Identities=8%  Similarity=0.114  Sum_probs=43.4

Q ss_pred             CCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHC
Q ss_conf             89955614879999999999977997999940788615289999999997699479980787433668897898874202
Q gi|254780901|r   69 MPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE  148 (600)
Q Consensus        69 ~~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~  148 (600)
                      +.+...+++..++.+++   -+.+-+++|.....   ..+..-+.+.|+.+|.++.                 .+.+.-.
T Consensus        13 ~~~~~~~~~a~e~l~~L---~~~G~~~~ivTN~~---~~~~~~~~~~L~~lg~~~~-----------------~~~i~~s   69 (131)
T 1zjj_A           13 YRGNRAIPGVRELIEFL---KERGIPFAFLTNNS---TKTPEMYREKLLKMGIDVS-----------------SSIIITS   69 (131)
T ss_dssp             EETTEECTTHHHHHHHH---HHHTCCEEEEESCC---SSCHHHHHHHHHTTTCCCC-----------------GGGEEEH
T ss_pred             EECCCCCCCHHHHHHHH---HHCCCCEEEEECCC---CCCHHHHHHHHHHCCCCCC-----------------CCEEECH
T ss_conf             88999584499999999---97799689994899---9999999999997699888-----------------1547511


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             686899964887623455555417982799615
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDH  181 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDH  181 (600)
                       ++=.+.|  |-+-...+.-|+..|+..|-..+
T Consensus        70 -p~~~~~V--GD~~~~Di~~A~~aG~~ti~v~~   99 (131)
T 1zjj_A           70 -GEELWMV--GDRLDTDIAFAKKFGMKAIMVLT   99 (131)
T ss_dssp             -TCEEEEE--ESCTTTHHHHHHHTTCEEEEESS
T ss_pred             -CCEEEEE--CCCHHHHHHHHHHCCCCEEEECC
T ss_conf             -4307997--68817789999987996999888


No 448
>>1ea5_A Acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} (A:1-326,A:414-516)
Probab=29.08  E-value=30  Score=13.57  Aligned_cols=13  Identities=0%  Similarity=-0.350  Sum_probs=7.3

Q ss_pred             HHHCEEEEEEECC
Q ss_conf             4201079988637
Q gi|254780901|r  393 KFGRPSFAISFEE  405 (600)
Q Consensus       393 ~y~kP~iv~s~~~  405 (600)
                      .-++|+++-...+
T Consensus       314 ~~~vp~i~G~~~~  326 (429)
T 1ea5_A          314 FKKTQILLGVNKD  326 (429)
T ss_dssp             SCCSCEEEEEETB
T ss_pred             CCCCCEEECCCCC
T ss_conf             7643123024467


No 449
>>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} (A:)
Probab=29.00  E-value=30  Score=13.56  Aligned_cols=26  Identities=12%  Similarity=0.092  Sum_probs=10.2

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             56148799999999999779979999
Q gi|254780901|r   73 LILTDCDKAARRIVQAIYNSEKIMIF   98 (600)
Q Consensus        73 ~~l~dm~~A~~ri~~ai~~~ekI~I~   98 (600)
                      .....++++++.+..++.++++++|+
T Consensus        78 ~~~~~~~~~~~~i~~~~~~~~~VlVH  103 (188)
T 2esb_A           78 RLCDFFDPIADHIHSVEMKQGRTLLH  103 (188)
T ss_dssp             CGGGGHHHHHHHHHHHHHTTCCEEEE
T ss_pred             CHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             68999999999888766157517998


No 450
>>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} (A:)
Probab=28.96  E-value=30  Score=13.55  Aligned_cols=78  Identities=19%  Similarity=0.232  Sum_probs=45.3

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCC---CCHHHHH
Q ss_conf             7997999940788615289999999997699479980787433668897898874202686899964887---6234555
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS---TSYDALQ  167 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi---~~~e~i~  167 (600)
                      .+.+|+|.-|    --+....+.+.|+..|.++...     ..    ..++++.+.+.-+++|| +|-..   +..+-+.
T Consensus         6 ~~~~vLiVdd----~~~~~~~~~~~L~~~g~~v~~~-----~~----~~~al~~l~~~~~dlii-lD~~lp~~~G~el~~   71 (130)
T 3eod_A            6 VGKQILIVED----EQVFRSLLDSWFSSLGATTVLA-----AD----GVDALELLGGFTPDLMI-CDIAMPRMNGLKLLE   71 (130)
T ss_dssp             TTCEEEEECS----CHHHHHHHHHHHHHTTCEEEEE-----SC----HHHHHHHHTTCCCSEEE-ECCC-----CHHHHH
T ss_pred             CCCEEEEEEC----CHHHHHHHHHHHHHCCCEEEEE-----CC----HHHHHHHHHCCCCCEEE-EECCCCCCCHHHHHH
T ss_conf             8998999949----8999999999999879999997-----22----77789998535667565-101369998789999


Q ss_pred             HHHHC--CCCEEEECCC
Q ss_conf             55417--9827996154
Q gi|254780901|r  168 YATNQ--GIDVIVIDHH  182 (600)
Q Consensus       168 ~a~~~--GidvIVtDHH  182 (600)
                      .+++.  .+.+|+.-.|
T Consensus        72 ~ir~~~~~~piI~lt~~   88 (130)
T 3eod_A           72 HIRNRGDQTPVLVISAT   88 (130)
T ss_dssp             HHHHTTCCCCEEEEECC
T ss_pred             HHHHHCCCCCEEEEECC
T ss_conf             99983899969998089


No 451
>>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} (A:1-102,A:300-333)
Probab=28.96  E-value=30  Score=13.55  Aligned_cols=41  Identities=12%  Similarity=0.237  Sum_probs=24.3

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEE
Q ss_conf             889789887420268689996488762345555541798279
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVI  177 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvI  177 (600)
                      .++.+.++.+..-+.++|.+.-.|..+++ +++|+++||.|.
T Consensus        57 ~i~~~~L~~l~~p~LKlI~~~gvG~DnID-i~aa~e~GI~V~   97 (136)
T 1j4a_A           57 DYIAETLQALADNGITKMSLRNVGVDNID-MAKAKELGFQIT   97 (136)
T ss_dssp             CBCHHHHHHHHHTTCCEEEESSSCCTTBC-HHHHHHTTCEEE
T ss_pred             CCCHHHHHHCCCCCCEEEEECCCCCCHHH-HHHHHHCCCEEE
T ss_conf             88999998556179559998875456324-999997895899


No 452
>>1ow3_A RHO-GTPase-activating protein 1; complex, GTPase, GAP, transition state, gene regulation/signaling protein complex; HET: GDP; 1.80A {Homo sapiens} (A:61-131)
Probab=28.66  E-value=30  Score=13.52  Aligned_cols=47  Identities=9%  Similarity=0.044  Sum_probs=36.9

Q ss_pred             CHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC
Q ss_conf             9556148799999999999779979999407886152899999999976
Q gi|254780901|r   71 DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC  119 (600)
Q Consensus        71 dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~  119 (600)
                      .-|...+-..-+..+.++++++.......+||+  .+.+++|.+||+.+
T Consensus        22 GIFR~~g~~~~i~~l~~~l~~~~~~~~~~~~~~--~~va~~LK~flr~L   68 (71)
T 1ow3_A           22 GIFRRSANTQVVREVQQKYNMGLPVDFDQYNEL--HLPAVILKTFLREL   68 (71)
T ss_dssp             TTTTSCCCHHHHHHHHHHHHTTCCCCGGGSSCT--HHHHHHHHHHHHHS
T ss_pred             CCEECCCCHHHHHHHHHHHCCCCCCCCCCCCCH--HHHHHHHHHHHHHC
T ss_conf             976617879999999999707999883446648--89999999999868


No 453
>>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein; 1.55A {Shewanella oneidensis mr-1} (A:141-254)
Probab=28.65  E-value=30  Score=13.57  Aligned_cols=31  Identities=10%  Similarity=0.294  Sum_probs=12.1

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             997999940788615289999999997699479980
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI  127 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~I  127 (600)
                      +++|+|+|   +-|+-..+  ...++..|+++....
T Consensus         3 G~~VlI~G---aG~vG~~a--~q~ak~~G~~vi~~~   33 (114)
T 3goh_A            3 QREVLIVG---FGAVNNLL--TQXLNNAGYVVDLVS   33 (114)
T ss_dssp             CCEEEEEC---CSHHHHHH--HHHHHHHTCEEEEEC
T ss_pred             CCCEEEEE---CCCCCCCC--CCCCCCCCCCEEEEE
T ss_conf             32114740---01211111--011333220001210


No 454
>>2ef0_A Ornithine carbamoyltransferase; TTHA1199, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus HB8} (A:152-270)
Probab=28.63  E-value=30  Score=13.51  Aligned_cols=71  Identities=17%  Similarity=0.331  Sum_probs=42.0

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             79979999407886152899999999976994799807874336688978988742026868999648876234555554
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYAT  170 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~  170 (600)
                      ++.+|++.||+   +=+.-| +..++..+|.++...-|.    +|-+.....+.     .++.+|-     +.++    .
T Consensus         2 ~glkv~~vGd~---~~v~~S-~~~~~~~~g~~v~~~~P~----~~~~~~~~~~g-----~~v~~~~-----d~~~----a   59 (119)
T 2ef0_A            2 AGLEVAWVGDG---NNVLNS-LLEVAPLAGLKVRVATPK----GYEPDPGLLKR-----ANAFFTH-----DPKE----A   59 (119)
T ss_dssp             TTCEEEEESCC---CHHHHH-HHHHHHHHTCEEEEECCT----TCCCCHHHHHH-----HTCEEES-----CHHH----H
T ss_pred             CCCEEEEEECC---CCCHHH-HHHHHHHCCCCEEEECCC----HHHHHHHHCCC-----CCCCCCC-----CHHH----H
T ss_conf             78604665133---440887-876776449742452252----04442111113-----4554236-----7888----6


Q ss_pred             HCCCCEEEECCCC
Q ss_conf             1798279961544
Q gi|254780901|r  171 NQGIDVIVIDHHQ  183 (600)
Q Consensus       171 ~~GidvIVtDHH~  183 (600)
                      -.|.|||.||--.
T Consensus        60 ~~~aDvvy~~~w~   72 (119)
T 2ef0_A           60 ALGAHALYTDVWT   72 (119)
T ss_dssp             HTTCSEEEECCCC
T ss_pred             HCCCCEEEEEEHH
T ss_conf             4588868874287


No 455
>>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* (A:159-278)
Probab=28.59  E-value=31  Score=13.51  Aligned_cols=96  Identities=17%  Similarity=0.180  Sum_probs=51.1

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHH----HHHCCCCEEEEECCCCCCHHH
Q ss_conf             7799799994078861528999999999769947998078743366889789887----420268689996488762345
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEK----FINEGAQLIITVDCGSTSYDA  165 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~----~~~~g~~LiItvD~Gi~~~e~  165 (600)
                      .-.++++|+|-    |.++ .=+..+|.+.|.+|....+...--+..+.+...+.    +.+.|+++.  .+..+++.+.
T Consensus        18 ~~~k~v~VvGg----G~iG-~e~A~~l~~~G~~Vtli~~~~~~~~~~~~~~~~~~l~~~l~~~gV~~~--~~~~v~~i~~   90 (120)
T 1zmd_A           18 KVPEKMVVIGA----GVIG-VELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFK--LNTKVTGATK   90 (120)
T ss_dssp             SCCSEEEEECC----SHHH-HHHHHHHHHTTCEEEEECSSSSSSCSSCCHHHHHHHHHHHHHTTCEEE--CSEEEEEEEE
T ss_pred             HCCCEEEEECC----CHHH-HHHHHHHHHCCCCHHEEEECCHHHCCCCHHHHHHHHHHHHHHCCCCCC--CCEEEEEEEE
T ss_conf             16976999996----8999-999999986353101034332110133369999999999997599641--2300466654


Q ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCCEEEE
Q ss_conf             555541798279961544765556725652
Q gi|254780901|r  166 LQYATNQGIDVIVIDHHQVKSEEIPAYALV  195 (600)
Q Consensus       166 i~~a~~~GidvIVtDHH~~~~~~p~a~aiv  195 (600)
                      -   ......+.+.+-..-.....+++.++
T Consensus        91 ~---~~~~~~v~~~~~~~~~~~~i~~D~vi  117 (120)
T 1zmd_A           91 K---SDGKIDVSIEAASGGKAEVITCDVLL  117 (120)
T ss_dssp             C---TTSCEEEEEEETTSCCCEEEEESEEE
T ss_pred             E---CCCCEEEEEEECCCCCEEEEECCEEE
T ss_conf             0---33313799998779904899879999


No 456
>>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide formyl transferase; purine ribonucleotide biosynthesis, PURT; HET: ADP; 1.70A {Pyrococcus horikoshii OT3} PDB: 2czg_A* (A:1-108)
Probab=28.57  E-value=31  Score=13.51  Aligned_cols=79  Identities=15%  Similarity=0.101  Sum_probs=35.3

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC----------CCCCCCHHHHHHHHHC-CCCEEEEECCCC
Q ss_conf             99799994078861528999999999769947998078743----------3668897898874202-686899964887
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV----------DGYGPNPSLMEKFINE-GAQLIITVDCGS  160 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~----------eGYGl~~~~i~~~~~~-g~~LiItvD~Gi  160 (600)
                      ..||+|.|-    |.. ..-|.++.+.+|.++..+-+++-.          .+=-++.+.+.++.++ +++.| |...+-
T Consensus        19 ~~kilIlG~----Gql-a~~l~~aa~~lG~~~~~~d~~~~~pa~~~ad~~~~~~~~D~~~i~~~a~~~~~D~I-~~e~e~   92 (108)
T 2dwc_A           19 AQKILLLGS----GEL-GKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAI-IPEIEA   92 (108)
T ss_dssp             CCEEEEESC----SHH-HHHHHHHHHHTTCEEEEEESSTTCHHHHHSSEEEESCTTCHHHHHHHHHHHCCSEE-EECSSC
T ss_pred             CCEEEEECC----CHH-HHHHHHHHHHCCCEEEEEECCCCCCHHHHCCEEEECCCCCHHHHHHHHHHCCCCEE-EECCCC
T ss_conf             889999997----899-99999999987998999979898857774565897899999999999987399999-968887


Q ss_pred             CCHHHHHHHHHCCCCE
Q ss_conf             6234555554179827
Q gi|254780901|r  161 TSYDALQYATNQGIDV  176 (600)
Q Consensus       161 ~~~e~i~~a~~~Gidv  176 (600)
                      .+.+.++.+.+.|+.|
T Consensus        93 i~~~~~~~~e~~Gi~v  108 (108)
T 2dwc_A           93 INLDALFEFEKDGYFV  108 (108)
T ss_dssp             SCHHHHHHHHHTTCCB
T ss_pred             CCHHHHHHHHHHCCCC
T ss_conf             5789999998616624


No 457
>>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix-turn-helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} (A:1-124)
Probab=28.48  E-value=31  Score=13.49  Aligned_cols=24  Identities=21%  Similarity=0.267  Sum_probs=10.5

Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             345555541798279961544765
Q gi|254780901|r  163 YDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       163 ~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                      .++++.+++.-.|+|++|.+.|..
T Consensus        36 ~~al~~l~~~~~dlil~D~~mP~~   59 (124)
T 1kgs_A           36 EEGXYXALNEPFDVVILDIXLPVH   59 (124)
T ss_dssp             HHHHHHHHHSCCSEEEEESCCSSS
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             999999972899899994677654


No 458
>>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics, NPPSFA; HET: PLP; 1.15A {Thermus thermophilus HB8} (A:33-276)
Probab=28.41  E-value=31  Score=13.49  Aligned_cols=107  Identities=13%  Similarity=0.050  Sum_probs=64.5

Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEE
Q ss_conf             14879999999999977997999940788615289999999997699479980787433668897898874202686899
Q gi|254780901|r   75 LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLII  154 (600)
Q Consensus        75 l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiI  154 (600)
                      +.+-..|......+..+...-.++.+.+.-+..++....... ..+..+..+.++  .+.+.+..+.+++...+...+++
T Consensus        59 ~~~g~~a~~~~~~~~~~~~d~v~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~--~~~~~~d~~~l~~~i~~~t~~v~  135 (244)
T 2dkj_A           59 PHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFS-GKLYKVVSYGVR--PDTELIDLEEVRRLALEHRPKVI  135 (244)
T ss_dssp             CSSHHHHHHHHHHHHCCTTCEEEEECGGGTCCGGGTCTTSHH-HHHSEEEEECCC--TTTSSCCHHHHHHHHHHHCCSEE
T ss_pred             CCCCHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCC-CEEEEEEECCCC--CCCCCCCHHHHHHHHHHCCCCEE
T ss_conf             323317999999997389987874156677764446666655-415421243666--66774489999999986399989


Q ss_pred             -EECCCC---CCHHHH-HHHHHCCCCEEEECCCCC
Q ss_conf             -964887---623455-555417982799615447
Q gi|254780901|r  155 -TVDCGS---TSYDAL-QYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       155 -tvD~Gi---~~~e~i-~~a~~~GidvIVtDHH~~  184 (600)
                       ++-+.+   ...++| +.|++.|+-++|=.=|..
T Consensus       136 ~~~~~~~G~~~~i~~i~~la~~~g~~l~vD~a~a~  170 (244)
T 2dkj_A          136 VAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFA  170 (244)
T ss_dssp             EECCSSCCSCCCHHHHHHHHHHHTCEEEEECTTTH
T ss_pred             EECCCCCCCCCCHHHHHHHHHHCCCEEECCHHHHH
T ss_conf             82554565555789999876311857871223244


No 459
>>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA; 2.30A {Thermus thermophilus HB8} (A:149-293)
Probab=28.04  E-value=31  Score=13.44  Aligned_cols=82  Identities=9%  Similarity=0.078  Sum_probs=48.1

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             97799799994078861528999999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ++.+++|+|+|   + |-....+.....+..|.++.....         +++..+.+.+.|++.+|..+.. ...+++..
T Consensus        16 ~~~g~~vlV~G---a-g~~~g~~~~~la~~~g~~vi~~~~---------~~~~~~~~~~~ga~~~i~~~~~-~~~~~~~~   81 (145)
T 2eih_A           16 VRPGDDVLVMA---A-GSGVSVAAIQIAKLFGARVIATAG---------SEDKLRRAKALGADETVNYTHP-DWPKEVRR   81 (145)
T ss_dssp             CCTTCEEEECS---T-TSTTHHHHHHHHHHTTCEEEEEES---------SHHHHHHHHHHTCSEEEETTST-THHHHHHH
T ss_pred             CCCCCEEEEEC---C-CHHHHHHHHHHHHHCCCEEEEEEC---------CHHHHHHHHHCCCCEEEECCCC-CHHHHHHH
T ss_conf             89969999989---9-649999999999987998999979---------9999999996599899979999-99999999


Q ss_pred             HHHCCCCEEEECCCCC
Q ss_conf             5417982799615447
Q gi|254780901|r  169 ATNQGIDVIVIDHHQV  184 (600)
Q Consensus       169 a~~~GidvIVtDHH~~  184 (600)
                      +...+...+|.|+..+
T Consensus        82 ~~~~~~~~vv~~~~~~   97 (145)
T 2eih_A           82 LTGGKGADKVVDHTGA   97 (145)
T ss_dssp             HTTTTCEEEEEESSCS
T ss_pred             HHCCCCCEEEEEECCC
T ss_conf             8489874699960212


No 460
>>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} (A:141-319)
Probab=28.00  E-value=29  Score=13.65  Aligned_cols=75  Identities=11%  Similarity=0.179  Sum_probs=37.1

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH-H
Q ss_conf             977997999940788615289999999997699479980787433668897898874202686899964887623455-5
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL-Q  167 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i-~  167 (600)
                      ++.+++|+|+|   +-|..+. ......+..|++|.....         +.+..+.+.+.|++.+|..  ......+. +
T Consensus        21 l~~g~~VlI~G---a~~~vG~-~a~qla~~~g~~vi~~~~---------~~~~~~~~~~~ga~~vi~~--~~~~~~~~~~   85 (179)
T 2c0c_A           21 LSEGKKVLVTA---AAGGTGQ-FAMQLSKKAKCHVIGTCS---------SDEKSAFLKSLGCDRPINY--KTEPVGTVLK   85 (179)
T ss_dssp             CCTTCEEEETT---TTBTTHH-HHHHHHHHTTCEEEEEES---------SHHHHHHHHHTTCSEEEET--TTSCHHHHHH
T ss_pred             CCCCCCCEEEE---CCCCCCC-CCHHHCCCCCCEEEEEEC---------CHHHHHHHHHCCCCEEECC--CCCCCCEEEE
T ss_conf             22578616976---7876554-220100357988999989---------9999999997599656514--3442000332


Q ss_pred             HHHHCCCCEEE
Q ss_conf             55417982799
Q gi|254780901|r  168 YATNQGIDVIV  178 (600)
Q Consensus       168 ~a~~~GidvIV  178 (600)
                      .....|.|+++
T Consensus        86 ~~~~~~~dvv~   96 (179)
T 2c0c_A           86 QEYPEGVDVVY   96 (179)
T ss_dssp             HHCTTCEEEEE
T ss_pred             ECCCCCEEEEE
T ss_conf             00247704997


No 461
>>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG, PSI; HET: DTY; 2.80A {Geobacillus stearothermophilus} (A:122-293)
Probab=27.85  E-value=31  Score=13.42  Aligned_cols=54  Identities=11%  Similarity=0.177  Sum_probs=22.4

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             9779979999407886152899999999976994799807874336688978988742026868999
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIIT  155 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiIt  155 (600)
                      ++.++.|+|+|   +-|..+ .+.....+..|.+|.....+.         +-.+.+.+.|.+-+|.
T Consensus        26 ~~~g~~Vli~g---ag~~vG-~~a~~~ak~~g~~vi~~~~~~---------~~~~~~~~~Ga~~vi~   79 (172)
T 1xa0_A           26 TPERGPVLVTG---ATGGVG-SLAVSXLAKRGYTVEASTGKA---------AEHDYLRVLGAKEVLA   79 (172)
T ss_dssp             CGGGCCEEESS---TTSHHH-HHHHHHHHHTTCCEEEEESCT---------TCHHHHHHTTCSEEEE
T ss_pred             CCCCCEEEEEC---CCCCCC-CCCCCCCCCCCCEEEEEECCC---------HHHHHHHCCCCCCCCC
T ss_conf             78876499935---757665-444323124785035530551---------2566543022222222


No 462
>>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NADP-binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* (A:128-283)
Probab=27.80  E-value=31  Score=13.41  Aligned_cols=37  Identities=11%  Similarity=0.118  Sum_probs=22.9

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             97799799994078861528999999999769947998078
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD  129 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~  129 (600)
                      ++.+++|+|+|   +.|..+.+ ....++..|+++..-...
T Consensus        35 ~~~g~~VlV~G---a~g~vG~~-~~qla~~~g~~~i~~~~~   71 (156)
T 3gqv_A           35 HSKPVYVLVYG---GSTATATV-TMQMLRLSGYIPIATCSP   71 (156)
T ss_dssp             CSSCCEEEEES---TTSHHHHH-HHHHHHHTTCEEEEEECG
T ss_pred             CCCCCEEEEEC---CCCCCCCC-CCHHHHCCCCCEEEEECC
T ss_conf             67883799844---77774322-210121257630133024


No 463
>>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.62A {Jannaschia SP} (A:1-195)
Probab=27.77  E-value=31  Score=13.41  Aligned_cols=88  Identities=14%  Similarity=0.146  Sum_probs=51.8

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC----CCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH
Q ss_conf             799799994078861528999999999769947998078743----3668897898874202686899964887623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV----DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~----eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i  166 (600)
                      ++.+|.|+|   +-.++ ..-+.+.|+..|.+|.+|=+++-.    ...|......+++.++ +++||.+ +....++.+
T Consensus        10 ~~~~I~iiG---~G~m~-G~~lA~~l~~~G~~V~~~dr~~~~~~~~~~~g~~~~~~~e~~~~-adiIi~~-vp~~~~~~v   83 (195)
T 3c24_A           10 GPKTVAILG---AGGKX-GARITRKIHDSAHHLAAIEIAPEGRDRLQGXGIPLTDGDGWIDE-ADVVVLA-LPDNIIEKV   83 (195)
T ss_dssp             CCCEEEEET---TTSHH-HHHHHHHHHHSSSEEEEECCSHHHHHHHHHTTCCCCCSSGGGGT-CSEEEEC-SCHHHHHHH
T ss_pred             CCCEEEEEC---CCCHH-HHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCCHHHHHHH-CHHCCCC-CCHHHHHHH
T ss_conf             799999999---89789-99999999978995999948889999999769935889999973-4130345-877789999


Q ss_pred             H--HHHHCCCCEEEECCCCC
Q ss_conf             5--55417982799615447
Q gi|254780901|r  167 Q--YATNQGIDVIVIDHHQV  184 (600)
Q Consensus       167 ~--~a~~~GidvIVtDHH~~  184 (600)
                      .  .+..+.-+.||+|-...
T Consensus        84 ~~~~~~~l~~g~iii~~~~~  103 (195)
T 3c24_A           84 AEDIVPRVRPGTIVLILDAA  103 (195)
T ss_dssp             HHHHGGGSCTTCEEEESCSH
T ss_pred             HHHHHHCCCCCCEEEECCCC
T ss_conf             99998308999999986885


No 464
>>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive protein, jasmonic acid pathway; HET: LLP 15P; 2.35A {Solanum lycopersicum} (A:88-185)
Probab=27.66  E-value=32  Score=13.39  Aligned_cols=76  Identities=14%  Similarity=0.127  Sum_probs=48.9

Q ss_pred             HHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC
Q ss_conf             9999999997799-799994078861528999999999769947998078743366889789887420268689996488
Q gi|254780901|r   81 AARRIVQAIYNSE-KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG  159 (600)
Q Consensus        81 A~~ri~~ai~~~e-kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G  159 (600)
                      |...|..+++.++ +..|..   -+|-++.|+-+- -+.+|.++..++|..      .++.-++.+..-|.+++.+   +
T Consensus         8 a~~~i~~~~~~g~~~~vv~a---SsGN~g~a~A~~-a~~~G~~~~i~~p~~------~~~~k~~~l~~~GA~Vi~~---~   74 (98)
T 3iau_A            8 AYNMMSNLSREELDKGVITA---SAGNHAQGVALA-GQRLNCVAKIVMPTT------TPQIKIDAVRALGGDVVLY---G   74 (98)
T ss_dssp             HHHHHHTSCHHHHHHCEEEE---CSSHHHHHHHHH-HHHTTCCEEEEECTT------CCHHHHHHHHHTTCEEEEC---C
T ss_pred             HHHHHHHHHHCCCCCEEEEE---CCCHHHHHHHHH-HHHHCCCCEEECCCC------CCHHHHHHHHHHCCCEEEC---C
T ss_conf             99999999875998779996---876899999999-998199852435888------8799999999717761221---4


Q ss_pred             CCCHHHHHHH
Q ss_conf             7623455555
Q gi|254780901|r  160 STSYDALQYA  169 (600)
Q Consensus       160 i~~~e~i~~a  169 (600)
                      .+-.+.++.+
T Consensus        75 ~~~~~~~~~~   84 (98)
T 3iau_A           75 KTFDEAQTHA   84 (98)
T ss_dssp             SSHHHHHHHH
T ss_pred             CCHHHHHHHH
T ss_conf             5547799999


No 465
>>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} (A:)
Probab=27.59  E-value=32  Score=13.38  Aligned_cols=25  Identities=20%  Similarity=0.438  Sum_probs=13.7

Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             8876234555554179827996154
Q gi|254780901|r  158 CGSTSYDALQYATNQGIDVIVIDHH  182 (600)
Q Consensus       158 ~Gi~~~e~i~~a~~~GidvIVtDHH  182 (600)
                      ||+++.++++.+.+.|.|.+=.|+.
T Consensus         7 cGl~~~~~~~~~~~~Gad~lg~~~~   31 (205)
T 1nsj_A            7 CGITNLEDALFSVESGADAVGFVFY   31 (205)
T ss_dssp             CCCCSHHHHHHHHHHTCSEEEEECC
T ss_pred             CCCCCHHHHHHHHHCCCCEEEEECC
T ss_conf             1899699999999679998978546


No 466
>>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} (A:97-353,A:521-572)
Probab=27.55  E-value=32  Score=13.38  Aligned_cols=41  Identities=20%  Similarity=0.438  Sum_probs=32.6

Q ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             202686899964887623455555417982799615447655
Q gi|254780901|r  146 INEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE  187 (600)
Q Consensus       146 ~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~  187 (600)
                      .+..+|+|| |--|.+-.-+.-.|.+.|.+|+|++.+.....
T Consensus        27 ~~~~~DViV-IGgG~AGl~aA~~la~~G~~V~viEk~~~~gg   67 (309)
T 1d4d_A           27 VKETTDVVI-IGSGGAGLAAAVSARDAGAKVILLEKEPIPGG   67 (309)
T ss_dssp             CCEECSEEE-ECCSHHHHHHHHHHHSSSCCEEEECSSSSSCT
T ss_pred             CCCCCCEEE-ECCCHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             898857799-89579999999999988995899978998996


No 467
>>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,, transport protein; HET: BGC; 0.92A {Escherichia coli} (A:1-112,A:258-309)
Probab=27.54  E-value=32  Score=13.38  Aligned_cols=73  Identities=8%  Similarity=0.084  Sum_probs=44.4

Q ss_pred             HHHHHHC-CCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCC-CHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9999976-994799807874336688978988742026868999648876-234555554179827996154476555
Q gi|254780901|r  113 MRFLSHC-SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST-SYDALQYATNQGIDVIVIDHHQVKSEE  188 (600)
Q Consensus       113 ~~~L~~~-g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~-~~e~i~~a~~~GidvIVtDHH~~~~~~  188 (600)
                      .+.++.. |..+...-...-.+   -....++.+...+++-||..=...+ ..+.++.|++.||-||..|...+....
T Consensus        25 ~~~a~~~~g~~l~~~~~~~d~~---~q~~~i~~li~~~vDgIIi~~~d~~~~~~~i~~a~~agIPvV~vn~~~~~~~~   99 (164)
T 2fvy_A           25 EQDAKAAPDVQLLMNDSQNDQS---KQNDQIDVLLAKGVKALAINLVDPAAAGTVIEKARGQNVPVVFFNKEPSRKAL   99 (164)
T ss_dssp             HHHHHTCTTEEEEEEECTTCHH---HHHHHHHHHHHTTCSEEEECCSSGGGHHHHHHHHHTTTCCEEEESSCCCHHHH
T ss_pred             HHHHHHCCCCEEEEECCCCCHH---HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEECCCCCCCCCCC
T ss_conf             9999876993799975999999---99999999997599889971321013699999998459630003654444323


No 468
>>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* (A:137-268)
Probab=27.52  E-value=32  Score=13.37  Aligned_cols=80  Identities=13%  Similarity=0.064  Sum_probs=47.6

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             97799799994078861528999999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ++.+++|+|+|   +.|-.+ .+...+++..|++|.....         +.+..+.+.+.|++-+|.. ......+++..
T Consensus         2 v~~G~~Vli~g---a~g~vG-~~~iqlak~~g~~vi~~~~---------~~~~~~~~~~~ga~~~i~~-~~~~~~~~i~~   67 (132)
T 3jyn_A            2 VKPGEIILFHA---AAGGVG-SLACQWAKALGAKLIGTVS---------SPEKAAHAKALGAWETIDY-SHEDVAKRVLE   67 (132)
T ss_dssp             CCTTCEEEESS---TTSHHH-HHHHHHHHHHTCEEEEEES---------SHHHHHHHHHHTCSEEEET-TTSCHHHHHHH
T ss_pred             CCCCCEEEEEC---CCHHHH-HHHHHHHHHCCCEEEEEEC---------CHHHHHHHHHCCCCEEEEC-CCCCHHHHHHH
T ss_conf             79989999989---950999-9999999986998999938---------7788999997599899979-99889999999


Q ss_pred             HH-HCCCCEEEECCC
Q ss_conf             54-179827996154
Q gi|254780901|r  169 AT-NQGIDVIVIDHH  182 (600)
Q Consensus       169 a~-~~GidvIVtDHH  182 (600)
                      +. ..|.|+++.=..
T Consensus        68 ~~~~~~~d~v~d~~g   82 (132)
T 3jyn_A           68 LTDGKKCPVVYDGVG   82 (132)
T ss_dssp             HTTTCCEEEEEESSC
T ss_pred             HHCCCCCCEEEECCC
T ss_conf             718999538998978


No 469
>>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolution, signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A (A:)
Probab=27.43  E-value=32  Score=13.37  Aligned_cols=81  Identities=15%  Similarity=0.191  Sum_probs=49.7

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCC----CCCHHHH
Q ss_conf             799799994078861528999999999769947998078743366889789887420268689996488----7623455
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG----STSYDAL  166 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~G----i~~~e~i  166 (600)
                      ...+|+|.=    |--+...++...|+..|.+|...     ..    -.++++.+.+..++++|. |..    .+.++-+
T Consensus         4 ~~~~ILiVD----dd~~~~~~l~~~L~~~g~~v~~a-----~~----~~~al~~l~~~~~d~iil-D~~lp~~~dG~~l~   69 (127)
T 2gkg_A            4 MSKKILIVE----SDTALSATLRSALEGRGFTVDET-----TD----GKGSVEQIRRDRPDLVVL-AVDLSAGQNGYLIC   69 (127)
T ss_dssp             --CEEEEEC----SCHHHHHHHHHHHHHHTCEEEEE-----CC----HHHHHHHHHHHCCSEEEE-ESBCGGGCBHHHHH
T ss_pred             CCCCEEEEE----CCHHHHHHHHHHHHHCCCEEEEE-----CC----HHHHHHHHHHCCCCEEEE-EECCCCCCCHHHHH
T ss_conf             488589998----99999999999999879999998-----68----499999998179979974-30013456577999


Q ss_pred             HHHHH----CCCCEEEECCCCCC
Q ss_conf             55541----79827996154476
Q gi|254780901|r  167 QYATN----QGIDVIVIDHHQVK  185 (600)
Q Consensus       167 ~~a~~----~GidvIVtDHH~~~  185 (600)
                      +.+++    ..+.+|++-++...
T Consensus        70 ~~lr~~~~~~~ipii~~s~~~~~   92 (127)
T 2gkg_A           70 GKLKKDDDLKNVPIVIIGNPDGF   92 (127)
T ss_dssp             HHHHHSTTTTTSCEEEEECGGGH
T ss_pred             HHHHHCCCCCCCCEEEEECCCHH
T ss_conf             99984777799819999789608


No 470
>>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* 2vmr_A* 2vms_A* 2vmt_A* 2vmu_A* 2vmq_A* ... (A:33-275)
Probab=27.38  E-value=32  Score=13.36  Aligned_cols=108  Identities=11%  Similarity=0.043  Sum_probs=70.0

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCC-E
Q ss_conf             614879999999999977997999940788615289999999997699479980787433668897898874202686-8
Q gi|254780901|r   74 ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ-L  152 (600)
Q Consensus        74 ~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~-L  152 (600)
                      ....-..+...+..+..+.....+..+.+..+..++....... ..+..+....++  .+...+..+.+++...+... +
T Consensus        58 ~~~~g~~a~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~--~~~~~~d~~~l~~~i~~~~~~~  134 (243)
T 2vi8_A           58 QPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFS-GVQYNFVAYGVD--PETHVIDYDDVREKARLHRPKL  134 (243)
T ss_dssp             CCSSHHHHHHHHHHHHCCTTCEEEEECGGGTCCTTTTCTTSHH-HHHSEEEEECBC--TTTCSBCHHHHHHHHHHHCCSE
T ss_pred             ECCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCC-CEEEEEEEECCH--HHCCCCCHHHHHHHHHHHCCCE
T ss_conf             2577706889999984289997985155656764666643446-468887772451--5225211899999998625634


Q ss_pred             EEEECCCCC---CHHHH-HHHHHCCCCEEEECCCCC
Q ss_conf             999648876---23455-555417982799615447
Q gi|254780901|r  153 IITVDCGST---SYDAL-QYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       153 iItvD~Gi~---~~e~i-~~a~~~GidvIVtDHH~~  184 (600)
                      ++++-+...   +.++| +.|++.|+.++|=.=|..
T Consensus       135 ~~~~~~~~G~~~dl~~i~~ia~~~g~~~~vD~a~~~  170 (243)
T 2vi8_A          135 IVAAAAAYPRIIDFAKFREIADEVGAYLMVDMAHIA  170 (243)
T ss_dssp             EEECCSSCCSCCCHHHHHHHHHHHTCEEEEECTTTH
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHHCCEEEHHHHHHH
T ss_conf             653134678766899999877651959873033345


No 471
>>1mw9_X DNA topoisomerase I; decatenase enzyme, toprim domain; HET: DNA; 1.67A {Escherichia coli} (X:1-32,X:89-156)
Probab=27.38  E-value=32  Score=13.36  Aligned_cols=63  Identities=13%  Similarity=0.147  Sum_probs=44.7

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC---CEEEEECCCCCCCCCCCHHHHHHHHHC
Q ss_conf             879999999999977997999940788615289999999997699---479980787433668897898874202
Q gi|254780901|r   77 DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV---NANMYIPDRIVDGYGPNPSLMEKFINE  148 (600)
Q Consensus        77 dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~---~v~~~IP~R~~eGYGl~~~~i~~~~~~  148 (600)
                      +-.+-.+.|.+.+++-..|.+.+|+|-.|-.   |-++.++.++.   ++. .+  +|.   .++++.|.+..++
T Consensus        32 ~~kk~l~~Ikkl~k~ad~IIiATD~DREGE~---Ia~eI~~~~~~~~k~vk-Rl--~fs---slT~~~I~~A~~n   97 (100)
T 1mw9_X           32 GKEKVVSELKQLAEKADHIYLATDLDREGEA---IAWHLREVIGGDDARYS-RV--VFN---EITKNAIRQAFNK   97 (100)
T ss_dssp             SCHHHHHHHHHHHHTCSEEEECCCSSHHHHH---HHHHHHHHHCSCGGGEE-EC--CCS---SCSHHHHHHHHHS
T ss_pred             CHHHHHHHHHHHHHCCCEEEECCCCCCCHHH---HHHHHHHHHCCCCCCEE-EE--EEC---CCCHHHHHHHHHC
T ss_conf             7799999999998459999988898733539---99999999668998659-99--966---6899999999748


No 472
>>1o89_A YHDH, B3253, YHDH; structural genomics, unknown function, possible NADPH-dependent quinone oxidoreductase; 2.25A {Escherichia coli} (A:140-311)
Probab=27.30  E-value=31  Score=13.43  Aligned_cols=10  Identities=20%  Similarity=0.388  Sum_probs=4.0

Q ss_pred             HCCCCEEEEE
Q ss_conf             7799799994
Q gi|254780901|r   90 YNSEKIMIFG   99 (600)
Q Consensus        90 ~~~ekI~I~g   99 (600)
                      ..+++++|+|
T Consensus        27 ~~g~~VlI~G   36 (172)
T 1o89_A           27 PQDGEIVVTG   36 (172)
T ss_dssp             GGGCEEEESS
T ss_pred             CCCCEEEEEC
T ss_conf             8999999998


No 473
>>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii OT3} PDB: 2z0c_A 3a4i_A (A:1-189)
Probab=27.27  E-value=32  Score=13.34  Aligned_cols=103  Identities=16%  Similarity=0.127  Sum_probs=50.8

Q ss_pred             CHHHHHHHHHHHH---HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCCCCCCCCCCHHHHHHHHHC-CCC
Q ss_conf             8799999999999---7799799994078861528999999999769947998-0787433668897898874202-686
Q gi|254780901|r   77 DCDKAARRIVQAI---YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY-IPDRIVDGYGPNPSLMEKFINE-GAQ  151 (600)
Q Consensus        77 dm~~A~~ri~~ai---~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~-IP~R~~eGYGl~~~~i~~~~~~-g~~  151 (600)
                      ||++-++...+.+   ..+++++|-=   -=|.=|+++++.+.+.++.++... +.+-..+ ..-....++++.+. |..
T Consensus         2 d~~~~~~~~i~~~~~~~~~~~vvi~~---SGG~DS~~~l~ll~~~~~~~~~~v~~~~~~~~-~~~~~~~~~~~~~~~~~~   77 (189)
T 2dpl_A            2 DWGRFVEEKVREIRETVGDSKAIIAL---SGGVDSSTAAVLAHKAIGDRLHAVFVNTGFLR-KGEPEFVVKTFRDEFGMN   77 (189)
T ss_dssp             CHHHHHHHHHHHHHHHHTTSCEEEEC---CSSHHHHHHHHHHHHHHGGGEEEEEEECSCCC-TTHHHHHHHHHTTTTCCE
T ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEEE---CCCHHHHHHHHHHHHHHCCCEEEEEECCCCCC-CCHHHHHHHHHHHCCCCC
T ss_conf             87999999999999983899899990---68899999999999975887799995898788-538999999654125742


Q ss_pred             EEEEECCC-----------CC-----------CHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             89996488-----------76-----------23455555417982799615447
Q gi|254780901|r  152 LIITVDCG-----------ST-----------SYDALQYATNQGIDVIVIDHHQV  184 (600)
Q Consensus       152 LiItvD~G-----------i~-----------~~e~i~~a~~~GidvIVtDHH~~  184 (600)
                      +. ++|.-           ..           .....+.+++.|+++++|-|+.-
T Consensus        78 ~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~i~~g~~~~  131 (189)
T 2dpl_A           78 LH-YVDAQDRFFSALKGVTDPEEKRKIIGRVFIEVFEEVAKKIGAEYLIQGTIAP  131 (189)
T ss_dssp             EE-EEECHHHHHHHTTTCCCHHHHHHHHHHHHHHHHHHHHHHHTCSEEECCCCCC
T ss_pred             EE-EEEHHHHHHHHHCCCCCHHHHHHHCCCHHHHHHHHHHHHHCCCEECCCEEEC
T ss_conf             48-9730455545431789968974340850577899999984996240330211


No 474
>>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} (A:1-224,A:375-459)
Probab=27.11  E-value=32  Score=13.32  Aligned_cols=42  Identities=17%  Similarity=0.231  Sum_probs=33.0

Q ss_pred             HCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             0268689996488762345555541798279961544765556
Q gi|254780901|r  147 NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI  189 (600)
Q Consensus       147 ~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p  189 (600)
                      ...++.+| |--|++-.-...++.+.|.+|+|+|-+..+....
T Consensus         3 ~~~~DViV-IGaG~aGlsaA~~La~~G~~V~viEk~~~~gg~~   44 (309)
T 2bs2_A            3 VQYCDSLV-IGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHS   44 (309)
T ss_dssp             EEECSEEE-ECCSHHHHHHHHHHHTTTCCEEEECSSCGGGSGG
T ss_pred             CEECCEEE-ECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCHH
T ss_conf             22544899-9977999999999997799689996889999827


No 475
>>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding, purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A (A:1-97)
Probab=27.01  E-value=32  Score=13.31  Aligned_cols=67  Identities=19%  Similarity=0.382  Sum_probs=37.6

Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHH-HHHHHC
Q ss_conf             7999940788615289999999997699479980787433668897898874202686899964887623455-555417
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDAL-QYATNQ  172 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i-~~a~~~  172 (600)
                      ||+|+|    .|---.||.+...+.-..+-.|..|-.        .. +..+.+       .++..+++++++ ++|+++
T Consensus         2 kVLviG----sGgREhAla~~L~~s~~~~~v~~~pgN--------~G-~~~~~~-------~~~i~~~d~~~i~~~a~~~   61 (97)
T 2yw2_A            2 KVLVVG----NGGREHAIAWKVAQSPLVKELYVAKGN--------AG-IWEIAK-------RVDISPTDVEKLAEFAKNE   61 (97)
T ss_dssp             EEEEEE----SSHHHHHHHHHHTTCTTCSEEEEEECC--------TT-GGGTSE-------EECSCTTCHHHHHHHHHHH
T ss_pred             EEEEEC----CCHHHHHHHHHHHHCCCCCEEEEECCC--------HH-HHHHCC-------EEEECCCCHHHHHHHHHHH
T ss_conf             899989----588999999999748998889997998--------88-986443-------3876889999999999985


Q ss_pred             CCCEEEEC
Q ss_conf             98279961
Q gi|254780901|r  173 GIDVIVID  180 (600)
Q Consensus       173 GidvIVtD  180 (600)
                      +||.+|+-
T Consensus        62 ~iDlvviG   69 (97)
T 2yw2_A           62 GVDFTIVG   69 (97)
T ss_dssp             TCSEEEEC
T ss_pred             CCCEEEEC
T ss_conf             98999989


No 476
>>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.70A {Thermus thermophilus HB8} PDB: 2eg3_A (A:110-230)
Probab=26.94  E-value=32  Score=13.30  Aligned_cols=33  Identities=24%  Similarity=0.314  Sum_probs=17.1

Q ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             7799799994078861528999999999769947998
Q gi|254780901|r   90 YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY  126 (600)
Q Consensus        90 ~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~  126 (600)
                      ....+|.+|   +.+|..| +.....|..+|.+|.++
T Consensus        73 ~~~~~ii~~---c~~g~rs-~~~a~~l~~~G~~v~~l  105 (121)
T 2eg4_A           73 QPGQEVGVY---CHSGARS-AVAFFVLRSLGVRARNY  105 (121)
T ss_dssp             CTTCEEEEE---CSSSHHH-HHHHHHHHHTTCEEEEC
T ss_pred             CCCCEEEEE---CCCCHHH-HHHHHHHHHCCCCEEEC
T ss_conf             999969998---8985899-99999999869986991


No 477
>>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer; HET: NAI UGA; 1.80A {Streptococcus pyogenes} (A:307-402)
Probab=26.89  E-value=33  Score=13.29  Aligned_cols=39  Identities=10%  Similarity=0.200  Sum_probs=30.0

Q ss_pred             CCCCEEEEEC---CCCC--HHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             7997999940---7886--1528999999999769947998078
Q gi|254780901|r   91 NSEKIMIFGD---YDVD--GAASVALMMRFLSHCSVNANMYIPD  129 (600)
Q Consensus        91 ~~ekI~I~gD---yD~D--Gitstail~~~L~~~g~~v~~~IP~  129 (600)
                      ++.+|+|+|=   -++|  =-|.+.-+++.|...|++|.+|=|.
T Consensus         2 ~g~~I~vlGlafK~nt~D~R~Spa~~i~~~L~~~g~~V~~~DP~   45 (96)
T 1dlj_A            2 PVKVVGVYRLIMKSNSDNFRESAIKDVIDILKSKDIKIIIYEPM   45 (96)
T ss_dssp             SSCEEEEECCCSSTTCSCCTTCHHHHHHHHHHTSSCEEEEECTT
T ss_pred             CCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCC
T ss_conf             45314898530478899722685999999999789989999998


No 478
>>2fuv_A Phosphoglucomutase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, isomerase; HET: MSE; 2.00A {Salmonella typhimurium LT2} (A:210-323,A:409-444)
Probab=26.86  E-value=33  Score=13.29  Aligned_cols=32  Identities=16%  Similarity=0.080  Sum_probs=15.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             26868999648876234555554179827996
Q gi|254780901|r  148 EGAQLIITVDCGSTSYDALQYATNQGIDVIVI  179 (600)
Q Consensus       148 ~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVt  179 (600)
                      .+.++++.+-+|+++.-.-..++++|++++.+
T Consensus        21 ~~lkIVvD~~~Gag~~~~~~Ll~~LG~~vi~i   52 (150)
T 2fuv_A           21 AGLTLGVDPLGGSGIEYWKRIAEHYKLNLTLV   52 (150)
T ss_dssp             HTCCEEEECTTCTTHHHHHHHHHHTTCCEEES
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHCCCCEEEC
T ss_conf             79779985033310234555555327510100


No 479
>>4pga_A Glutaminase-asparaginase; bacterial amidohydrolase; 1.70A {Pseudomonas SP} (A:212-337)
Probab=26.83  E-value=33  Score=13.29  Aligned_cols=49  Identities=22%  Similarity=0.296  Sum_probs=37.9

Q ss_pred             CCCCHHHHHHHHHCCCCEEEEECCCCCC-----HHHHHHHHHCCCCEEEECCCC
Q ss_conf             6889789887420268689996488762-----345555541798279961544
Q gi|254780901|r  135 YGPNPSLMEKFINEGAQLIITVDCGSTS-----YDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       135 YGl~~~~i~~~~~~g~~LiItvD~Gi~~-----~e~i~~a~~~GidvIVtDHH~  183 (600)
                      =|++...++.+.+.|++=||.--.|..+     .+.++.+.++|+-|+++-.=.
T Consensus        20 pG~~~~~l~~~~~~g~~GiVi~~~G~Gn~p~~~~~~l~~a~~~gi~vV~~Sqc~   73 (126)
T 4pga_A           20 GNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKNGTQIIRSSHVN   73 (126)
T ss_dssp             TTCCSHHHHHHHHTTCSEEEEEEBTTTBCCTTTHHHHHHHHHTTCEEEEEESCC
T ss_pred             CCCCHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             999999999997579979999551798999899999999997798799985058


No 480
>>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} (A:241-452)
Probab=26.82  E-value=33  Score=13.28  Aligned_cols=129  Identities=14%  Similarity=0.051  Sum_probs=67.1

Q ss_pred             CCC-HHHHHHHCCC--CHHHCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             889-7898866196--6777189955614879999999999977997999940788615289999999997699479980
Q gi|254780901|r   51 NVS-IDYAKDFLNP--SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI  127 (600)
Q Consensus        51 gi~-~~~~~~fL~p--~l~~l~~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~I  127 (600)
                      |++ .++++.-+..  +.-.+...|...........+....+.+...+.++-+-+.+      ...+.+...|++....-
T Consensus        21 Gi~~~e~~~~~~~~G~~~i~~~~~~~~~~~~~~~~~~~i~~~~~~~~v~v~v~~~~~------~~~~~~~~~g~d~v~l~   94 (212)
T 1pii_A           21 GLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVMAAAPLQYVGVFRNHDIA------DVVDKAKVLSLAAVQLH   94 (212)
T ss_dssp             CCCSHHHHHHHHHHTCSEEEEECCTTCTTBCCHHHHHHHHHHCCCEEEEEESSCCHH------HHHHHHHHHTCSEEEEC
T ss_pred             CCCCHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCHH------HHHHHHHHCCCCEEEEC
T ss_conf             867748999998669988977468999886799999999974798747999379999------99999985599868988


Q ss_pred             CCCCCCCCCCCHHHHHHHHH---CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEEC
Q ss_conf             78743366889789887420---2686899964887623455555417982799615447655567256523
Q gi|254780901|r  128 PDRIVDGYGPNPSLMEKFIN---EGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVN  196 (600)
Q Consensus       128 P~R~~eGYGl~~~~i~~~~~---~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivN  196 (600)
                      .+       .....+..+..   .+....++++    ..+++..+.+.|.|.|..|+-.++...+.....+.
T Consensus        95 ~~-------~~~~~~~~l~~~~~~~~~~~~~~~----~~~~~~~a~~~~~D~il~~~~~~~~g~~~~~~~l~  155 (212)
T 1pii_A           95 GN-------EEQLYIDTLREALPAHVAIWKALS----VGETLPAREFQHVDKYVLDNGQGGSGQRFDWSLLN  155 (212)
T ss_dssp             SC-------CCHHHHHHHHHHSCTTSEEEEEEE----CSSSCCCCCCTTCCEEEEESCSCCSSCCCCGGGGT
T ss_pred             CC-------CCHHHHHHHHHHCCCCEEEEEECC----CCCCCCHHHHHHHHHHHCCCCCCCCCCEECHHHHC
T ss_conf             99-------988999999764676469998416----44531256674010644378969688786888836


No 481
>>1hwx_A GDH, glutamate dehydrogenase; allostery, abortive complex, oxidoreductase; HET: GLU GTP NAI; 2.50A {Bos taurus} (A:242-372)
Probab=26.80  E-value=33  Score=13.28  Aligned_cols=43  Identities=30%  Similarity=0.424  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHCEEEEEEECCCCEEEEEEECCCCCCHHHHHHHH
Q ss_conf             222222789988420107998863798379998648986188888853
Q gi|254780901|r  381 GIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA  428 (600)
Q Consensus       381 GViGIVAsrL~e~y~kP~iv~s~~~dg~~kGS~RSi~g~~l~~~l~~~  428 (600)
                      |-+|.-+.|+..+++--++.+++.     .|+....+|+|+.+++...
T Consensus        12 G~VG~~~a~~L~~~G~kvv~v~d~-----~G~i~~~~G~d~~~l~~~~   54 (131)
T 1hwx_A           12 GNVGLHSMRYLHRFGAKCVAVGES-----DGSIWNPDGIDPKELEDFK   54 (131)
T ss_dssp             SHHHHHHHHHHHHTTCEEEEEEET-----TEEECCTTCCCHHHHHHHH
T ss_pred             CHHHHHHHHHHHHCCCEEEEEECC-----CCCEECCCCCCHHHHHHHH
T ss_conf             715589997777357479999747-----8835447542326799999


No 482
>>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} (A:1-112,A:265-320)
Probab=26.78  E-value=33  Score=13.28  Aligned_cols=42  Identities=19%  Similarity=0.372  Sum_probs=34.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCE
Q ss_conf             8689996488762345555541798279961544765556725
Q gi|254780901|r  150 AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY  192 (600)
Q Consensus       150 ~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~  192 (600)
                      +|++| +-.|.+-..+.-+|..+|++|+|+|.+..........
T Consensus         6 yDViI-IGaGpAGl~aA~~lar~G~~v~viE~~~~~g~~~~~~   47 (168)
T 1trb_A            6 SKLLI-LGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTT   47 (168)
T ss_dssp             EEEEE-ECCSHHHHHHHHHHHTTTCCCEEECCSSTTGGGGGCS
T ss_pred             CCEEE-ECCCHHHHHHHHHHHHCCCCEEEEEECCCCCEEEECC
T ss_conf             55999-9987999999999997899889996048786688356


No 483
>>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial precursor; middle-chain acyl-COA synthetase, xenobiotic/medium-chain fatty acid-COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* (A:76-198)
Probab=26.73  E-value=33  Score=13.27  Aligned_cols=100  Identities=5%  Similarity=-0.041  Sum_probs=56.0

Q ss_pred             CCHHHHHHHHHHHHHC------CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH-C
Q ss_conf             4879999999999977------99799994078861528999999999769947998078743366889789887420-2
Q gi|254780901|r   76 TDCDKAARRIVQAIYN------SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN-E  148 (600)
Q Consensus        76 ~dm~~A~~ri~~ai~~------~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~-~  148 (600)
                      .++.+.+.++..++.+      +++|.|+..-..+    ..+.+-+.-..|+-....-|+       +..+-+..+.+ .
T Consensus         2 ~el~~~~~~~a~~L~~~~gi~~gd~V~i~~~n~~e----~~~~~~a~~~~G~v~vpl~~~-------~~~~~l~~~l~~s   70 (123)
T 3c5e_A            2 RELSENSQQAANVLSGACGLQRGDRVAVVLPRVPE----WWLVILGCIRAGLIFMPGTIQ-------MKSTDILYRLQMS   70 (123)
T ss_dssp             HHHHHHHHHHHHHHHTTTCCCTTCEEEEECCSCHH----HHHHHHHHHHHTCEEEECCTT-------CCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHH----HHHHHHHHHHHCCEEEECCCC-------CCHHHHHHHHHHC
T ss_conf             99999999999998880097999999999289699----999999999849199931877-------9999999999851


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             68689996488762345555541798279961544765
Q gi|254780901|r  149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       149 g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                      +++++||.+.-.....++......--.+|+.|-..++.
T Consensus        71 ~~~~ii~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~  108 (123)
T 3c5e_A           71 KAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDG  108 (123)
T ss_dssp             TCSEEEEETTTHHHHHHHGGGCTTCCEEEEESSSCCTT
T ss_pred             CCCEEEEECCCHHHHCCCCCCCCCCCEEEECCCCCCCC
T ss_conf             46489950110000000012133421010001222222


No 484
>>2z5b_A Protein YPL144W, DMP1; proteasome, chaperone; 1.96A {Saccharomyces cerevisiae} PDB: 2z5c_A (A:)
Probab=26.68  E-value=33  Score=13.27  Aligned_cols=52  Identities=13%  Similarity=0.189  Sum_probs=29.0

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCEEEEEEECCCCEEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             57858122222278998842010799886379837999864898618888885303
Q gi|254780901|r  375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE  430 (600)
Q Consensus       375 ~~~wh~GViGIVAsrL~e~y~kP~iv~s~~~dg~~kGS~RSi~g~~l~~~l~~~~~  430 (600)
                      ..+|-.-..--+|.-++++|+|||.|- ...++.   -.++...+|...++.+|-+
T Consensus        92 ~dd~IRD~~r~~atil~kKy~rPCYV~-~ss~~s---~~~~~~~~dqL~iikkCi~  143 (151)
T 2z5b_A           92 KDDRIRDMARHMATIISERFNRPCYVT-WSSLPS---EDPSMLVANHLYILKKCLD  143 (151)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHTSCEEEE-EEECTT---CCTHHHHHTHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCEEEE-EECCCC---CCCCCCCHHHHHHHHHHHH
T ss_conf             531889999999999997618970899-851687---8843222007999999999


No 485
>>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B (A:1-25,A:235-412)
Probab=26.68  E-value=33  Score=13.27  Aligned_cols=77  Identities=13%  Similarity=0.247  Sum_probs=50.5

Q ss_pred             CCHHHHHHHHHHHH--HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEE
Q ss_conf             48799999999999--7799799994078861528999999999769947998078743366889789887420268689
Q gi|254780901|r   76 TDCDKAARRIVQAI--YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLI  153 (600)
Q Consensus        76 ~dm~~A~~ri~~ai--~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~Li  153 (600)
                      ++-++-...+.+-+  ..++++.||    |.-...+-.|...|+..|..+.++-..--.+   --...++++.....++|
T Consensus        39 ~~~~~k~~~L~~ll~~~~~~k~iIF----~~~~~~~~~l~~~l~~~g~~~~~~hg~l~~~---eR~~~~~~F~~g~~~iL  111 (203)
T 3fht_A           39 SSRDEKFQALCNLYGAITIAQAMIF----CHTRKTASWLAAELSKEGHQVALLSGEMMVE---QRAAVIERFREGKEKVL  111 (203)
T ss_dssp             SSHHHHHHHHHHHHHHHSSSEEEEE----CSSHHHHHHHHHHHHHTTCCCEEECTTSCHH---HHHHHHHHHHTTSCSEE
T ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEE----EECCHHHHHHHHHHHHCCCEEEEEECCCHHH---HHHHHHHHHHHCCCEEE
T ss_conf             3457799999999983478848999----6566579999999986898599980783378---89999998750770699


Q ss_pred             EEECCC
Q ss_conf             996488
Q gi|254780901|r  154 ITVDCG  159 (600)
Q Consensus       154 ItvD~G  159 (600)
                      |+.|..
T Consensus       112 vaTd~~  117 (203)
T 3fht_A          112 VTTNVC  117 (203)
T ss_dssp             EECGGG
T ss_pred             EECCHH
T ss_conf             721221


No 486
>>3fem_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, synthase, biosynthetic protein, transferase; 3.02A {Saccharomyces cerevisiae} (A:)
Probab=26.57  E-value=33  Score=13.25  Aligned_cols=42  Identities=12%  Similarity=0.230  Sum_probs=24.3

Q ss_pred             CCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             8978988742026868999648876234555554179827996
Q gi|254780901|r  137 PNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI  179 (600)
Q Consensus       137 l~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVt  179 (600)
                      .+.+.|..+++. +++-|+.-.-+.+.+....+...++|.+..
T Consensus        61 ~~~~~Ik~ik~~-~~ipIig~~~~~~~~~~~~i~~t~~D~v~~  102 (297)
T 3fem_A           61 SDPKMIKDIMNS-VSIPVMAKVRIGHFVEAQIIEALEVDYIDE  102 (297)
T ss_dssp             CCHHHHHHHHTS-CSSCEEEEECTTCHHHHHHHHHHTCSEEEE
T ss_pred             CCHHHHHHHHHC-CCCCHHHCCCCCCHHHHHHHHHCCCCCCCC
T ss_conf             887999999862-655231234335199998898719997641


No 487
>>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} (A:)
Probab=26.55  E-value=33  Score=13.25  Aligned_cols=78  Identities=10%  Similarity=0.193  Sum_probs=47.1

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHH---HHH
Q ss_conf             99799994078861528999999999769947998078743366889789887420268689996488762345---555
Q gi|254780901|r   92 SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDA---LQY  168 (600)
Q Consensus        92 ~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~---i~~  168 (600)
                      +.+|+|.-    |--+....+...|+..|.++.+...+        ..++++.+.+..++++|+ |..-.....   +..
T Consensus         2 ~~riLiVD----D~~~~~~~l~~~L~~~g~~v~~~a~~--------~~~al~~~~~~~~dlii~-D~~lP~~~G~~l~~~   68 (120)
T 1tmy_A            2 GKRVLIVD----DAAFMRMMLKDIITKAGYEVAGEATN--------GREAVEKYKELKPDIVTM-DITMPEMNGIDAIKE   68 (120)
T ss_dssp             CCEEEEEC----SCHHHHHHHHHHHHHTTCEEEEEESS--------HHHHHHHHHHHCCSEEEE-ECSCGGGCHHHHHHH
T ss_pred             CCCEEEEE----CCHHHHHHHHHHHHHCCCEEEEEECC--------HHHHHHHHHHCCCCEEEE-ECCCCCCCHHHHHHH
T ss_conf             98699993----99999999999999879989999889--------999999998468988998-456899978999999


Q ss_pred             HHHCC--CCEEEECCC
Q ss_conf             54179--827996154
Q gi|254780901|r  169 ATNQG--IDVIVIDHH  182 (600)
Q Consensus       169 a~~~G--idvIVtDHH  182 (600)
                      +++.+  +.||++=.+
T Consensus        69 i~~~~~~~pvi~lt~~   84 (120)
T 1tmy_A           69 IMKIDPNAKIIVCSAM   84 (120)
T ss_dssp             HHHHCTTCCEEEEECT
T ss_pred             HHHHCCCCCEEEEECC
T ss_conf             9986889978999734


No 488
>>3l8m_A Probable thiamine pyrophosphokinase; thiamin diphosphate biosynthetic process, ATP binding, structural genomics, PSI-2; 2.40A {Staphylococcus saprophyticus} (A:)
Probab=26.53  E-value=33  Score=13.25  Aligned_cols=117  Identities=12%  Similarity=0.083  Sum_probs=55.9

Q ss_pred             CHHHCCCCHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHH
Q ss_conf             67771899556148799999999999779979999407886152899999999976994799807874336688978988
Q gi|254780901|r   64 SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLME  143 (600)
Q Consensus        64 ~l~~l~~dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~  143 (600)
                      .+..+... ..+-..+.+++++.++  .-.+-+|+||+|  .++..+  .++++..+..+.+---.-++|    ...+++
T Consensus        15 ~~~~~~~~-~~ii~aDgGa~~l~~~--gi~Pd~iiGDfD--Si~~~~--~~~~~~~~~~~~~~~~kd~TD----~e~Al~   83 (212)
T 3l8m_A           15 HILVEHKH-EHWIGIDRGTLILLES--GITPQFAVGDFD--SISDSE--RNFIQQQIEINPYNSEKDDTD----LALGID   83 (212)
T ss_dssp             THHHHTTT-SEEEEETHHHHHHHHT--TCCCSEEESCCC--CSCHHH--HHHHHHHTBCCCCC---CBCH----HHHHHH
T ss_pred             HHHHHCCC-CEEEEECHHHHHHHHC--CCCCCEEEECCC--CCCHHH--HHHHHCCCEEEEECCCCCHHH----HHHHHH
T ss_conf             99974349-8899987589999987--998598974688--998689--998626732998275656569----999999


Q ss_pred             HHHHCCCCEEEEE-CCCCC-CHHH-----HH--HHHHCCCCEEEECCCCCCCCCCCC
Q ss_conf             7420268689996-48876-2345-----55--554179827996154476555672
Q gi|254780901|r  144 KFINEGAQLIITV-DCGST-SYDA-----LQ--YATNQGIDVIVIDHHQVKSEEIPA  191 (600)
Q Consensus       144 ~~~~~g~~LiItv-D~Gi~-~~e~-----i~--~a~~~GidvIVtDHH~~~~~~p~a  191 (600)
                      .+.+.+++-|+.+ -.|-. +|.-     +.  .....++.+.+.|++..---+|+.
T Consensus        84 ~~~~~~~~~i~i~G~~GgR~DH~l~ni~~l~~~~~~~~~~~i~l~d~~~~~~~l~~g  140 (212)
T 3l8m_A           84 QAVKRGYRNIDVYGATGGRLDHFXGALQILEKPEYAKXNINIKLIDDTNEIQFIQKG  140 (212)
T ss_dssp             HHHHTTCCEEEEESCSSSCHHHHHHHHHHHTCHHHHTTTCEEEEECSSEEEEEECSE
T ss_pred             HHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCEEEEEEECC
T ss_conf             998679977999805779578899999999876654128877998299799999289


No 489
>>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; 2.60A {Homo sapiens} (A:)
Probab=26.51  E-value=33  Score=13.24  Aligned_cols=73  Identities=14%  Similarity=0.234  Sum_probs=48.2

Q ss_pred             HHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECC
Q ss_conf             9999999999-779979999407886152899999999976994799807874336688978988742026868999648
Q gi|254780901|r   80 KAARRIVQAI-YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDC  158 (600)
Q Consensus        80 ~A~~ri~~ai-~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~  158 (600)
                      .-.+.+.+.+ +.+.++.||    |+-...+-.+...|+..|..+.++--.--.+   --...++.+.......+|+.|+
T Consensus        41 ~k~~~l~~~l~~~~~~~lIF----~~~~~~~~~l~~~l~~~g~~~~~~~~~~~~~---~r~~~~~~f~~~~~~vLi~T~~  113 (191)
T 2p6n_A           41 AKMVYLLECLQKTPPPVLIF----AEKKADVDAIHEYLLLKGVEAVAIHGGKDQE---ERTKAIEAFREGKKDVLVATDV  113 (191)
T ss_dssp             GHHHHHHHHHTTSCSCEEEE----CSCHHHHHHHHHHHHHHTCCEEEECTTSCHH---HHHHHHHHHHHTSCSEEEECHH
T ss_pred             HHHHHHHHHHHHCCCCEEEE----ECCHHHHHHHHHHHHHCCCCCCCCCCCCCCC---CCCCCCCCCCCCCHHEEECCHH
T ss_conf             99999999997689989999----8877999999998764288633345554200---0002222122311120223012


Q ss_pred             C
Q ss_conf             8
Q gi|254780901|r  159 G  159 (600)
Q Consensus       159 G  159 (600)
                      +
T Consensus       114 ~  114 (191)
T 2p6n_A          114 A  114 (191)
T ss_dssp             H
T ss_pred             H
T ss_conf             3


No 490
>>3lab_A Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) aldolase; unknown function, aldolase superfamily, class I aldolase, KDPG aldolase domain; 1.84A {Oleispira antarctica} (A:)
Probab=26.30  E-value=33  Score=13.22  Aligned_cols=46  Identities=9%  Similarity=0.038  Sum_probs=19.8

Q ss_pred             CCCHHHHHHHHHCCCCEEEEECCCC--CCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             8897898874202686899964887--62345555541798279961544
Q gi|254780901|r  136 GPNPSLMEKFINEGAQLIITVDCGS--TSYDALQYATNQGIDVIVIDHHQ  183 (600)
Q Consensus       136 Gl~~~~i~~~~~~g~~LiItvD~Gi--~~~e~i~~a~~~GidvIVtDHH~  183 (600)
                      |.|...++.+.+.  .|+...++..  ...+.++.+.+.|++++.+|-..
T Consensus         1 g~~~~~~~~l~~~--~l~~~~~~~~~~~~~~~~~~~~~~G~~~i~l~~~~   48 (217)
T 3lab_A            1 GXTQLDTWLANTK--PLIPVIVIDDLVHAIPXAKALVAGGVHLLEVTLRT   48 (217)
T ss_dssp             -CCHHHHHHTTSC--SEEEEECCSCGGGHHHHHHHHHHTTCCEEEEETTS
T ss_pred             CCCHHHHHHHHCC--CEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9446899997379--88999978999999999999998799889996899


No 491
>>3gux_A Putative Zn-dependent exopeptidase; YP_001298628.1, structural genomics, joint center for structural genomics, JCSG; 1.80A {Bacteroides vulgatus atcc 8482} (A:)
Probab=26.16  E-value=33  Score=13.20  Aligned_cols=49  Identities=10%  Similarity=-0.055  Sum_probs=28.6

Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHHHHHHHHHHCCCCEEE
Q ss_conf             5561487999999999997799799994078861-52899999999976994799
Q gi|254780901|r   72 PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDG-AASVALMMRFLSHCSVNANM  125 (600)
Q Consensus        72 P~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DG-itstail~~~L~~~g~~v~~  125 (600)
                      +..--+.+.+++.+.+-+.-+.+     -+...+ ..+...|...|+.+|.++..
T Consensus        20 ~~~~~~~~~~~~~l~~l~~i~~~-----~~~s~~e~~~~~~l~~~l~~~g~~~~~   69 (314)
T 3gux_A           20 KAPEFDADSAYQYIQVQADFGPR-----VPNTQAHKECGEYLAGQLEKFGAKVYN   69 (314)
T ss_dssp             CCCCCCHHHHHHHHHHHHTTCCC-----CTTSHHHHHHHHHHHHHHHHTTCEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCC-----CCCCHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             89872899999999998556993-----999999999999999999987996899


No 492
>>2gz1_A Aspartate beta-semialdehyde dehydrogenase; aspartate pathway, oxidoreductase; HET: NAP; 1.80A {Streptococcus pneumoniae} (A:1-126,A:328-366)
Probab=26.13  E-value=33  Score=13.20  Aligned_cols=133  Identities=17%  Similarity=0.172  Sum_probs=65.1

Q ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE-ECCCCCCCCCCC-------HHHHHHHHHCCCCEEEEECCCCCCHH
Q ss_conf             9799994078861528999999999769947998-078743366889-------78988742026868999648876234
Q gi|254780901|r   93 EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY-IPDRIVDGYGPN-------PSLMEKFINEGAQLIITVDCGSTSYD  164 (600)
Q Consensus        93 ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~-IP~R~~eGYGl~-------~~~i~~~~~~g~~LiItvD~Gi~~~e  164 (600)
                      -+|+|.|   +-|.+++.++...++.-...+.+. -.+|...|-.+.       .....+..-.++++++.+=-+-.+.+
T Consensus         3 mkVaIvG---ATG~vG~eLirlL~~~~~~~i~~~~~~s~~sag~~i~~~~~~~~~~~~~~~~~~~~DvVf~a~~~~~s~~   79 (165)
T 2gz1_A            3 YTVAVVG---ATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTETAFEGVDIALFSAGSSTSAK   79 (165)
T ss_dssp             EEEEEET---TTSHHHHHHHHHHHTCCSCEEEEEEEECGGGTTCEEEETTEEEEEEECCTTTTTTCSEEEECSCHHHHHH
T ss_pred             CEEEEEC---CCCHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCEECCCEEEEEECCHHHHHCCCEEEECCCCCHHHH
T ss_conf             7899999---7529999999999728999617999988887898744789612572278545302898998799731333


Q ss_pred             HHHHHHHCCCCEEEECCCCC---CCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             55555417982799615447---655567256523788886433443047889999999999970214887
Q gi|254780901|r  165 ALQYATNQGIDVIVIDHHQV---KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV  232 (600)
Q Consensus       165 ~i~~a~~~GidvIVtDHH~~---~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~  232 (600)
                      -+..+.+.|+.+|-  ---.   .++.|-...=+|+......- +-==|--|-||--++ +.+.|.+++.+
T Consensus        80 ~~~~l~~~G~~vID--lS~a~R~~~~v~ygiPEvn~~~i~~a~-~iVAnP~~~~~~~~~-~~~~~~~~~~~  146 (165)
T 2gz1_A           80 YAPYAVKAGVVVVD--NTSYFRQNPDVPLVVPEVNAHALDAHN-GIIACPKGAAWNSVQ-IAETLHERGLV  146 (165)
T ss_dssp             HHHHHHHTTCEEEE--CSSTTTTCTTSCBCCHHHHGGGGGGCC-SEEECCTTTHHHHHH-HHHHHHHTTCC
T ss_pred             HHHHHCCCCCEEEE--ECCCCCCCCCCEECCCCCCCHHCCCCC-CCCCCCHHHHHHHHH-HHHHHHHCCCC
T ss_conf             43354046828987--667200389720434443210001221-001355989999999-99999986998


No 493
>>1ddz_A Carbonic anhydrase; alpha-beta-alpha; 2.20A {Porphyridium cruentum} (A:67-320)
Probab=26.11  E-value=34  Score=13.19  Aligned_cols=22  Identities=27%  Similarity=0.317  Sum_probs=10.5

Q ss_pred             CHHHHHHHH-HCCCCEEEECCCC
Q ss_conf             234555554-1798279961544
Q gi|254780901|r  162 SYDALQYAT-NQGIDVIVIDHHQ  183 (600)
Q Consensus       162 ~~e~i~~a~-~~GidvIVtDHH~  183 (600)
                      ....++||- .+|+..||.=+|.
T Consensus        43 ~~asleyAV~~L~V~~IvV~GHt   65 (254)
T 1ddz_A           43 FLSVLQYAVQYLKVKHILVCGHY   65 (254)
T ss_dssp             HHHHHHHHHHTSCCSEEEEEEET
T ss_pred             HHHHHHHHHHHCCCCEEEEECCC
T ss_conf             78999999986188679993689


No 494
>>1toa_A Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} (A:1-195)
Probab=26.08  E-value=34  Score=13.19  Aligned_cols=99  Identities=12%  Similarity=0.052  Sum_probs=56.8

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHCC---CCEEEEECC-CCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHH-H
Q ss_conf             799799994078861528999999999769---947998078-74336688978988742026868999648876234-5
Q gi|254780901|r   91 NSEKIMIFGDYDVDGAASVALMMRFLSHCS---VNANMYIPD-RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYD-A  165 (600)
Q Consensus        91 ~~ekI~I~gDyD~DGitstail~~~L~~~g---~~v~~~IP~-R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e-~  165 (600)
                      ..+++.|+        ||+..++.+-++++   .+|.+.+|. .--+-|-+++.-+.++.+  .+|++++.-|.-... .
T Consensus        35 ~~~~~~Vv--------ts~~p~~~~v~~I~gd~~~V~~l~~~~~dpH~y~p~p~d~~~l~~--aDl~v~~G~~~e~~~~~  104 (195)
T 1toa_A           35 ADGKPLVV--------TTIGMIADAVKNIAQGDVHLKGLMGPGVDPHLYTATAGDVEWLGN--ADLILYNGLHLETKMGE  104 (195)
T ss_dssp             --CCCEEE--------ESSHHHHHHHHHHHGGGSEEEESCCTTCCTTTCCCCHHHHHHHHH--CSEEEECCTTCSTTCHH
T ss_pred             CCCCCEEE--------EECHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHC--CCEEEECCCCCCHHHHH
T ss_conf             06996799--------988699999999808825899805979796568689999999955--99999928987747799


Q ss_pred             HHHHHHCCCCEEEECCCCCCCCC-CCCEEEECCCC
Q ss_conf             55554179827996154476555-67256523788
Q gi|254780901|r  166 LQYATNQGIDVIVIDHHQVKSEE-IPAYALVNPNR  199 (600)
Q Consensus       166 i~~a~~~GidvIVtDHH~~~~~~-p~a~aivNP~~  199 (600)
                      +.........++..|+|...... ....--.||+.
T Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dpH~  139 (195)
T 1toa_A          105 VFSKLRGSRLVVAVSETIPVSQRLSLEEAEFDPHV  139 (195)
T ss_dssp             HHHHHTTSSEEEEGGGGSCGGGSCBSTTSCBCCCG
T ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             99864577765201444232112354422234202


No 495
>>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone, THDP, metal, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* (A:1-195)
Probab=26.08  E-value=34  Score=13.19  Aligned_cols=17  Identities=24%  Similarity=0.004  Sum_probs=9.8

Q ss_pred             CCEEEECCCHHHHHHHH
Q ss_conf             21002034258999999
Q gi|254780901|r  317 GSRLLISDDSQELEMLA  333 (600)
Q Consensus       317 av~lL~~~d~~~a~~la  333 (600)
                      .+++..+.++..|--.|
T Consensus        46 ~i~~i~~r~E~~A~~~A   62 (195)
T 3hww_A           46 AFIHHTHFDERGLGHLA   62 (195)
T ss_dssp             TCEEEECSCHHHHHHHH
T ss_pred             CCEEEEECCHHHHHHHH
T ss_conf             97699658789999999


No 496
>>1hi9_A Dciaa, dipeptide transport protein DPPA; hydrolase (protease), protease, D-aminopeptidase, decamer, SELF-compartmentalizing; 2.4A {Bacillus subtilis} (A:)
Probab=26.01  E-value=34  Score=13.18  Aligned_cols=30  Identities=30%  Similarity=0.393  Sum_probs=20.8

Q ss_pred             HHHHHHCCC-CEEEECCCCCC-----CCCCCCEEEE
Q ss_conf             555541798-27996154476-----5556725652
Q gi|254780901|r  166 LQYATNQGI-DVIVIDHHQVK-----SEEIPAYALV  195 (600)
Q Consensus       166 i~~a~~~Gi-dvIVtDHH~~~-----~~~p~a~aiv  195 (600)
                      |+-|.+.|. +|+|.|-|-+-     +++|+..-+|
T Consensus        43 iega~~aGa~eV~V~DsHg~~~Nll~e~L~~ra~li   78 (274)
T 1hi9_A           43 IAEAFNSGCTEVLVNDSHSKMNNLMVEKLHPEADLI   78 (274)
T ss_dssp             HHHHHHTTCSEEEEEECSTTSCCSCTTTSCTTSEEE
T ss_pred             HHHHHHCCCCEEEEECCCCCHHHCCHHHCCCCEEEE
T ss_conf             988872688289993364225432265579654898


No 497
>>2ez9_A Pyruvate oxidase; TPP enzyme, reaction intermediate analogue, oxidoreductase; HET: TDK FAD; 1.60A {Lactobacillus plantarum} (A:189-368,A:555-603)
Probab=26.00  E-value=34  Score=13.18  Aligned_cols=135  Identities=11%  Similarity=0.140  Sum_probs=73.8

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCC--CC------CC-CCC--CHHHHHHHH
Q ss_conf             79999999999977997999940788615289999999997699479980787--43------36-688--978988742
Q gi|254780901|r   78 CDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR--IV------DG-YGP--NPSLMEKFI  146 (600)
Q Consensus        78 m~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R--~~------eG-YGl--~~~~i~~~~  146 (600)
                      -+.+++.+.+.|.+-++.+|+.+..+.  .+.+-+.++...+|+.|...-..+  +.      -| ||.  +.. ..++.
T Consensus        10 ~~~~Ie~a~elL~~AkrPvIi~G~g~~--~a~~~l~~lae~~giPv~tt~~gkg~~pe~hP~~~G~~G~~~~~~-~~~~i   86 (229)
T 2ez9_A           10 DVQAVTRLTQTLLAAERPLIYYGIGAR--KAGKELEQLSKTLKIPLMSTYPAKGIVADRYPAYLGSANRVAQKP-ANEAL   86 (229)
T ss_dssp             CHHHHHHHHHHHHHCSSEEEEECGGGT--TCHHHHHHHHHHHTCCEEECGGGTTSSCTTCTTBCCCCSSSSCHH-HHHHH
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCHH--HHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCH-HHHCC
T ss_conf             999998887766533698533444265--899999999998699889740234334444333222322234313-33102


Q ss_pred             HCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             02686899964887623455555417982799615447655567256523788886433443047889999999999970
Q gi|254780901|r  147 NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRIL  226 (600)
Q Consensus       147 ~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l  226 (600)
                      ++ +++||.+.+-.+...-..+ ......+|.+|              +||...+-.|+ .+++=.|-+--++.+|.+.+
T Consensus        87 ~~-aDlIL~iG~~l~~~~t~~~-~~~~~k~I~Id--------------~dp~~i~~~~~-~d~~I~gD~~~~l~~L~e~l  149 (229)
T 2ez9_A           87 AQ-ADVVLFVGNNYPFAEVSKA-FKNTRYFLQID--------------IDPAKLGKRHK-TDIAVLADAQKTLAAILAQV  149 (229)
T ss_dssp             HH-CSEEEEESCCCTTTTTTTT-TTTCSEEEEEE--------------SCGGGTTSSSC-CSEEEESCHHHHHHHHHHTC
T ss_pred             CC-CCHHHHHHCCCCCCCCCCC-CCCCCCCCCCC--------------CCHHHHCCCCC-CCCCHHHHHHHHHHHHHHHH
T ss_conf             23-2023320011112332222-24555555788--------------99899455544-44111100799999999863


Q ss_pred             CCCCCC
Q ss_conf             214887
Q gi|254780901|r  227 RQDNKV  232 (600)
Q Consensus       227 ~~~~~~  232 (600)
                      ......
T Consensus       150 ~~~~~~  155 (229)
T 2ez9_A          150 SEREST  155 (229)
T ss_dssp             CCCCCC
T ss_pred             HCCCCC
T ss_conf             102333


No 498
>>2f7l_A 455AA long hypothetical phospho-sugar mutase; phosphomannomutase, phosphoglucomutase, isomerase; 2.80A {Sulfolobus tokodaii} (A:150-258,A:342-368)
Probab=25.98  E-value=34  Score=13.18  Aligned_cols=34  Identities=12%  Similarity=0.167  Sum_probs=17.7

Q ss_pred             HCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             0268689996488762345555541798279961
Q gi|254780901|r  147 NEGAQLIITVDCGSTSYDALQYATNQGIDVIVID  180 (600)
Q Consensus       147 ~~g~~LiItvD~Gi~~~e~i~~a~~~GidvIVtD  180 (600)
                      ..+.++++++-+|+++.-.-..++++|++++++.
T Consensus        21 ~~~lkIvvD~~~Ga~~~~~~~ll~~LG~~vi~in   54 (136)
T 2f7l_A           21 KKNYKVLIDPANSVGALSTPLVARALGCKIYTIN   54 (136)
T ss_dssp             HHCCEEEEECTTTGGGGTHHHHHHHTTCEEEEBS
T ss_pred             CCCCEEEEECCCCCCCCCCCHHHHHHHHCCCCCC
T ss_conf             1585499952433323356145665422012222


No 499
>>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} (A:181-363)
Probab=25.98  E-value=34  Score=13.18  Aligned_cols=77  Identities=16%  Similarity=0.212  Sum_probs=0.0

Q ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHH
Q ss_conf             97799799994078861528999999999769947998078743366889789887420268689996488762345555
Q gi|254780901|r   89 IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQY  168 (600)
Q Consensus        89 i~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~  168 (600)
                      ++.++.++|+|     +-....+....++..|+...+.+-.        +.+..+.+.+-|++.+|............+.
T Consensus        31 ~~~g~~VlI~G-----aG~vG~~a~q~a~~~g~~~V~~~~~--------~~~~~~~~~~lga~~~i~~~~~~~~~~~~~~   97 (183)
T 3ip1_A           31 IRPGDNVVILG-----GGPIGLAAVAILKHAGASKVILSEP--------SEVRRNLAKELGADHVIDPTKENFVEAVLDY   97 (183)
T ss_dssp             CCTTCEEEEEC-----CSHHHHHHHHHHHHTTCSEEEEECS--------CHHHHHHHHHHTCSEEECTTTSCHHHHHHHH
T ss_pred             CCCCCEEEEEC-----CCCCHHHHHHHHHHCCCCCCCCCCC--------CHHHHHHHHHHCCCCCCCCCCCCHHHHHCCC
T ss_conf             88989999989-----8751367999876327731112356--------3147777775076422344432234530123


Q ss_pred             HHHCCCCEEE
Q ss_conf             5417982799
Q gi|254780901|r  169 ATNQGIDVIV  178 (600)
Q Consensus       169 a~~~GidvIV  178 (600)
                      ....|.|+++
T Consensus        98 ~~~~g~d~v~  107 (183)
T 3ip1_A           98 TNGLGAKLFL  107 (183)
T ss_dssp             TTTCCCSEEE
T ss_pred             CCCCCCCCCC
T ss_conf             4686431000


No 500
>>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} (A:1-99,A:163-229,A:321-382)
Probab=25.92  E-value=34  Score=13.17  Aligned_cols=34  Identities=6%  Similarity=0.163  Sum_probs=0.0

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             9996488762345555541798279961544765
Q gi|254780901|r  153 IITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS  186 (600)
Q Consensus       153 iItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~  186 (600)
                      +|.|-.|++-....-++.+.|.+|+|.|.+....
T Consensus        20 ViIIGaG~aGl~~A~~La~~G~~V~iiE~~~~~g   53 (228)
T 1ryi_A           20 AVVIGGGIIGSAIAYYLAKENKNTALFESGTMGG   53 (228)
T ss_dssp             EEEECCSHHHHHHHHHHHHTTCCEEEECSSSTTT
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             9999942999999999998899589995999987


Done!