HHsearch results for GI: 254780901 and protein with PDBid: 1iuk_A

>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A
Probab=93.27  E-value=0.35  Score=27.46  Aligned_cols=95  Identities=11%  Similarity=0.105  Sum_probs=53.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCCCH-HHHHHHHHCCCCEEEEECCCC
Q ss_conf             9999999779979999407886152899999999976994799807874-33668897-898874202686899964887
Q gi|254780901|r   83 RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI-VDGYGPNP-SLMEKFINEGAQLIITVDCGS  160 (600)
Q Consensus        83 ~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~-~eGYGl~~-~~i~~~~~~g~~LiItvD~Gi  160 (600)
                      +.|.+-+.+-++|.|+|--+--+-.|-.++ ++|+..|.++..+-|+.. .+..|... ..+.++ .+.+++++.+=...
T Consensus         4 ~~i~~~L~~pksIAVVGaS~~~~k~g~~v~-~~L~~~g~~~~~v~p~~~~~~i~g~~~~~sl~di-p~~vDlv~i~vp~~   81 (140)
T 1iuk_A            4 QELRAYLSQAKTIAVLGAHKDPSRPAHYVP-RYLREQGYRVLPVNPRFQGEELFGEEAVASLLDL-KEPVDILDVFRPPS   81 (140)
T ss_dssp             HHHHHHHHHCCEEEEETCCSSTTSHHHHHH-HHHHHTTCEEEEECGGGTTSEETTEECBSSGGGC-CSCCSEEEECSCHH
T ss_pred             HHHHHHHHCCCEEEEEEECCCCCCCHHHHH-HHHHHCCCCEEEECCCCCCCEECCEEECCCHHHC-CCCCCEEEEEECHH
T ss_conf             999999857896999810699998399999-9999789933887877765355682720656764-89873899980889


Q ss_pred             CCHHHHHHHHHCCCCEEEE
Q ss_conf             6234555554179827996
Q gi|254780901|r  161 TSYDALQYATNQGIDVIVI  179 (600)
Q Consensus       161 ~~~e~i~~a~~~GidvIVt  179 (600)
                      ...+.++.+.+.|+..++.
T Consensus        82 ~v~~~v~e~~~~g~~~v~~  100 (140)
T 1iuk_A           82 ALMDHLPEVLALRPGLVWL  100 (140)
T ss_dssp             HHTTTHHHHHHHCCSCEEE
T ss_pred             HHHHHHHHHHHCCCCEEEE
T ss_conf             9999999999629898998