BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780901|ref|YP_003065314.1| single-stranded-DNA-specific
exonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
         (600 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780901|ref|YP_003065314.1| single-stranded-DNA-specific exonuclease protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040578|gb|ACT57374.1| single-stranded-DNA-specific exonuclease protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 600

 Score = 1229 bits (3181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/600 (100%), Positives = 600/600 (100%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF
Sbjct: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS
Sbjct: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID
Sbjct: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS
Sbjct: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM
Sbjct: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT
Sbjct: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD
Sbjct: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID
Sbjct: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET
Sbjct: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK
Sbjct: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600


>gi|315122680|ref|YP_004063169.1| single-stranded-DNA-specific exonuclease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496082|gb|ADR52681.1| single-stranded-DNA-specific exonuclease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 596

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/596 (82%), Positives = 544/596 (91%), Gaps = 1/596 (0%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           MN QAFLGVE SISGFRW+SLLGQE INRALAITQKHAIPD+VARVLV R+VSID A++F
Sbjct: 1   MNYQAFLGVERSISGFRWLSLLGQEEINRALAITQKHAIPDLVARVLVGRHVSIDCAEEF 60

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           LNPSIR LMP+PL LTDCDKAARRIVQAIYNSEKI I GDYDVDGAASVALMMRF S+  
Sbjct: 61  LNPSIRSLMPNPLTLTDCDKAARRIVQAIYNSEKIAILGDYDVDGAASVALMMRFFSYYG 120

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           V++NMYIPDRI+DGYGPNP LM+K I+EGAQLIITVDCGSTS++ALQ+++NQGIDVIVID
Sbjct: 121 VDSNMYIPDRILDGYGPNPDLMKKIIDEGAQLIITVDCGSTSHEALQFSSNQGIDVIVID 180

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN-FDLL 239
           HHQ+K+EE PAYALVNPNR DDLSGQGHLCAAGVVFLVLV+I RIL+QDNK+P+  FDLL
Sbjct: 181 HHQMKTEETPAYALVNPNRSDDLSGQGHLCAAGVVFLVLVMICRILQQDNKIPIKYFDLL 240

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           SLLDLVALATVCDVVPLI LNRAYV KGL+V+R+QGNPGLKALIER+N+S+PITA+NLG+
Sbjct: 241 SLLDLVALATVCDVVPLIDLNRAYVTKGLLVSRKQGNPGLKALIERINLSAPITADNLGF 300

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           MIGP INAGGRIGE+NLGSRLLISDD QELE +AMKLDVLNQNRRLMESAMLEQAE +VL
Sbjct: 301 MIGPCINAGGRIGEANLGSRLLISDDPQELEAIAMKLDVLNQNRRLMESAMLEQAEVEVL 360

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            Q + +QQAS+IVV GD+WHPGIVGLLAARLKEKF RPSFAISF+E GKGIGSGRSIEGF
Sbjct: 361 AQYEHMQQASIIVVAGDQWHPGIVGLLAARLKEKFDRPSFAISFDESGKGIGSGRSIEGF 420

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           DIGKMVSFA EEGIL+KGGGHAMAAGLTVERVNF RL DFFQ FA+  + +L++ PV KI
Sbjct: 421 DIGKMVSFAFEEGILLKGGGHAMAAGLTVERVNFNRLRDFFQAFANKRMSSLVSMPVLKI 480

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG LNASAVNI LI+MLESAGPYG+GNP PVFAFP+HKL+++R+V L HLQMTF+SQDSE
Sbjct: 481 DGALNASAVNIKLIEMLESAGPYGSGNPRPVFAFPSHKLENVRIVKLNHLQMTFKSQDSE 540

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
            LQ IAFRVYGTPLGEFLMQS GK MHV GHLCVN+WRGSKR QLRVLDA+PVE H
Sbjct: 541 VLQGIAFRVYGTPLGEFLMQSHGKWMHVIGHLCVNHWRGSKRAQLRVLDAAPVENH 596


>gi|222085813|ref|YP_002544343.1| single-stranded-DNA-specific exonuclease protein [Agrobacterium
           radiobacter K84]
 gi|221723261|gb|ACM26417.1| single-stranded-DNA-specific exonuclease protein [Agrobacterium
           radiobacter K84]
          Length = 604

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/588 (58%), Positives = 441/588 (75%), Gaps = 1/588 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S+SG RWVS L Q G NRALA+ Q H +PD++ARVL  R V +D A  FL+P
Sbjct: 14  RAFLGVERSVSGNRWVSRLDQAGQNRALAMAQTHGLPDLIARVLAGRGVGVDEAMAFLDP 73

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP +LTDC+KAA R+++A+   E + IFGDYDVDGAAS AL+ RFL+H  V A
Sbjct: 74  TIRSLMPDPYLLTDCEKAAGRLLRAVKTGETVAIFGDYDVDGAASSALLYRFLTHFGVPA 133

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           ++YIPDRI +GYGPNP+ + + I+ GA LI+TVDCGSTS+++L+ A  + IDV+VIDHHQ
Sbjct: 134 SIYIPDRIFEGYGPNPAAINQLIDNGATLIVTVDCGSTSFESLEAAKARNIDVVVIDHHQ 193

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL-NFDLLSLL 242
           V  E    +ALVNPNR DDLSGQGHLCAAGVVFLVLV   R LR+   V +   DLL+ L
Sbjct: 194 VAHELPHCHALVNPNREDDLSGQGHLCAAGVVFLVLVAALRQLREAGDVRVRTIDLLTWL 253

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR QGNPGL AL  +  +  P++  + G++IG
Sbjct: 254 DIVALATVCDVVPLKGLNRAYVVKGLIAARHQGNPGLAALFRKAGLGGPVSPYHFGFLIG 313

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LG+RLL   D+ E E++A KLD LN+ R+ ME+AML++AEA+ L + 
Sbjct: 314 PRINAGGRIGDAALGARLLTLADTSEAEIIAEKLDELNRERQAMEAAMLQEAEAEALAEY 373

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            +   ASVIV   + WHPGIVGL+A+RLK+KF RP+FAI+F+  GKG GSGRSI GFD+G
Sbjct: 374 GNGDGASVIVTARENWHPGIVGLIASRLKDKFRRPAFAIAFDPMGKGTGSGRSINGFDMG 433

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+ G+LVKGGGHAMAAGLTVER N G+L  FF + A   VP L+     KIDG 
Sbjct: 434 RMVRAAVDAGLLVKGGGHAMAAGLTVERGNLGKLRAFFTEKAERQVPGLVANETLKIDGA 493

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L AS   + LID LE+AGPYG+G+P P+FA P+H+L+  R+V  +H+++T E+QD   L 
Sbjct: 494 LGASGATVDLIDQLETAGPYGSGHPQPIFALPSHRLRDSRLVGQSHIKITLEAQDGGRLD 553

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            IAFR   TPLGE LM SRG ++HV G L  ++W+G++R QLRV DA+
Sbjct: 554 GIAFRAAETPLGELLMSSRGSQVHVAGTLGADHWQGNRRVQLRVTDAA 601


>gi|327190809|gb|EGE57877.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           CNPAF512]
          Length = 600

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/591 (58%), Positives = 435/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q + +PD++ARVL  R V +D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQVYGLPDLIARVLAGRGVPVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R++ AI   E + IFGDYDVDGAAS ALM RFLSH  V A
Sbjct: 70  TIRSLMPDPHTLTDCEKAATRLMSAIERGENVAIFGDYDVDGAASSALMFRFLSHFGVKA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDRI +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRIFEGYGPNPAAINQLIDNGARLIVTVDCGSTSHEALASAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR   NK  L  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRILALDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEAEIIAQRLDELNRERQAMEAVMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGLLAARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLLAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  FF + A   V  L+     KIDG 
Sbjct: 430 RMVRAAVDEGLLVKGGGHAMAAGLTVERADLGRLRTFFTEKAARTVANLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTLEAMDGTRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L  ++++G++R Q+RV DA+P +
Sbjct: 550 GIAFRAADTALGNLLVNSRGASLHVAGTLGADHYQGARRIQMRVCDAAPAK 600


>gi|209549146|ref|YP_002281063.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534902|gb|ACI54837.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 600

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/591 (57%), Positives = 435/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V+ D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQIHGMPDLIARVLAGRGVTADEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP ILTDC++AA R+V AI   E + IFGDYDVDGAAS ALM RFL+H  V A
Sbjct: 70  TIRGLMPDPHILTDCERAATRLVSAIERGENVAIFGDYDVDGAASSALMFRFLTHFGVKA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDR+ +GYGPNP+ M + I+ GA+LI+TVDCGSTS++AL+ A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRVFEGYGPNPAAMNQLIDNGARLIVTVDCGSTSHEALEAAAARSIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD-NKVPLNFDLLSLL 242
           V  E    +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR   NK  L  DLL  L
Sbjct: 190 VTHELPHCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRASGNKGILALDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDTGEAEVIAQRLDELNRERQAMEAIMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  FF + +   V  L+     KIDG 
Sbjct: 430 RMVRAAVDEGLLVKGGGHAMAAGLTVERADLGRLRTFFTEKSARTVANLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTMEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L   +++G++R QLRV DA+P +
Sbjct: 550 GIAFRAADTALGNLLINSRGASLHVAGALGAEHYQGARRIQLRVCDAAPAK 600


>gi|86357505|ref|YP_469397.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           CFN 42]
 gi|86281607|gb|ABC90670.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           CFN 42]
          Length = 600

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/591 (58%), Positives = 435/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA+ Q H +PD++ARVL  R V +D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMAQVHGLPDLIARVLAGRGVRVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R+V+AI   E + IFGDYDVDGAAS ALM RFLSH  V A
Sbjct: 70  TIRSLMPDPHTLTDCEKAATRLVRAIERGESVAIFGDYDVDGAASSALMFRFLSHFGVKA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDRI +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRIFEGYGPNPAAINQLIDNGARLIVTVDCGSTSHEALAAAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR   NK  +  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRIMALDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEAEVIAQRLDELNRERQAMEAMMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + AS+IV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASIIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AVEEGILVKGGGHAMAAGLTVER + GRL  FF + A   V +L+     KIDG 
Sbjct: 430 RMVRAAVEEGILVKGGGHAMAAGLTVERADLGRLRTFFTEKAARTVASLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTLEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L   +++G++R QLRV DA+P +
Sbjct: 550 GIAFRAADTGLGNLLINSRGASLHVAGSLGAEHYQGARRIQLRVCDAAPAK 600


>gi|241204470|ref|YP_002975566.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858360|gb|ACS56027.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 600

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/591 (58%), Positives = 438/591 (74%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V++D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQIHGLPDLIARVLAGRGVTVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R+++AI   E + IFGDYDVDGAAS ALM RFLSH  V A
Sbjct: 70  TIRSLMPDPHKLTDCEKAANRLLRAIERGESVAIFGDYDVDGAASSALMFRFLSHFGVRA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDR+ +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 TIYIPDRVFEGYGPNPAAINQLIDNGAELIVTVDCGSTSHEALAAAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR   NK  L  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRILAIDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E +++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEADVIAQRLDELNRERQAMEAIMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  FF + A   V +L+     KIDG 
Sbjct: 430 RMVRAAVDEGLLVKGGGHAMAAGLTVERTDLGRLRTFFTEKAERTVASLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+L+  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAIPAHRLRDARLVGEKHVKVTLEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   TPLG  L+ SRG  +HV G L  ++++G++R QLRV DA+P +
Sbjct: 550 GIAFRAADTPLGNLLINSRGANLHVAGSLGADHYQGARRIQLRVCDAAPAK 600


>gi|325292975|ref|YP_004278839.1| single-stranded-DNA-specific exonuclease [Agrobacterium sp. H13-3]
 gi|325060828|gb|ADY64519.1| single-stranded-DNA-specific exonuclease [Agrobacterium sp. H13-3]
          Length = 602

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/588 (57%), Positives = 432/588 (73%), Gaps = 1/588 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFL VE S +  RWVS L Q   NRALA++Q HAIP+++ARVL  R V +D A  FL+P
Sbjct: 12  RAFLSVERSATEQRWVSRLDQAAQNRALAMSQIHAIPELIARVLAGRGVGVDEALAFLDP 71

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP +LTDC+KAA R+V+AI   EK+ IFGDYDVDGAAS ALM RFL+H  +  
Sbjct: 72  TIRSLMPDPHMLTDCEKAAERLVRAIETGEKVAIFGDYDVDGAASSALMYRFLAHFGLTP 131

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP+ M++    GA LI+TVDCGSTS+++L  A + G DV+VIDHHQ
Sbjct: 132 KIYIPDRIFEGYGPNPAAMQQLAANGATLILTVDCGSTSHESLNAAKDAGTDVVVIDHHQ 191

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-QDNKVPLNFDLLSLL 242
           V SE  PA ALVNPNR DDLSGQGHLCAAGVVFLVLV   R+L+ + N+     DLL+LL
Sbjct: 192 VGSELPPAVALVNPNREDDLSGQGHLCAAGVVFLVLVATLRLLKDRRNRQAFTIDLLALL 251

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR   N GL AL  +  +  P+T  + G++IG
Sbjct: 252 DIVALATVCDVVPLKGLNRAYVVKGLIAARHMNNAGLAALFRKAGLGGPVTPYHFGFLIG 311

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DDS + +++A KLD LN+ R+ ME+ ML +AEA+ L + 
Sbjct: 312 PRINAGGRIGDAALGSRLLTLDDSSQADVIAEKLDELNRERQAMEAVMLAEAEAEALYEY 371

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D   A VIV   + WHPGIVGLLA+RLK++F RP+FAI+F+  GKG GSGRSI GFD+G
Sbjct: 372 GDGSGAGVIVTARENWHPGIVGLLASRLKDRFRRPAFAIAFDPSGKGTGSGRSINGFDMG 431

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+ G+LVKGGGHAMAAGLTVER N G+L  FF++ A   V  L+ + V KIDG 
Sbjct: 432 RMVRAAVDAGLLVKGGGHAMAAGLTVERANLGKLRTFFEEAAAKTVSELVESSVLKIDGA 491

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + L+D LE AGPYG+G+  P+FA P H+L+ +R+V  +H+++T E+ D   L 
Sbjct: 492 IGASGATLQLVDQLEQAGPYGSGHSQPIFAVPAHRLRDVRLVGTSHVKITLEAMDGSRLD 551

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            IAFR    PLG+ L+ +RG+ +HV G +  + W+G +R QLRVLDA+
Sbjct: 552 GIAFRAAEAPLGQMLLNARGRSIHVAGTVGADLWQGQRRVQLRVLDAA 599


>gi|190891568|ref|YP_001978110.1| single-stranded-DNA-specific exonuclease [Rhizobium etli CIAT 652]
 gi|190696847|gb|ACE90932.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           CIAT 652]
          Length = 600

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/591 (58%), Positives = 435/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V +D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQVHGLPDLIARVLAGRGVPVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R+V AI   E + IFGDYDVDGAAS ALM RFLSH  V A
Sbjct: 70  TIRSLMPDPHTLTDCEKAATRLVSAIERGENVAIFGDYDVDGAASSALMFRFLSHFGVKA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDRI +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRIFEGYGPNPAAINQLIDNGARLIVTVDCGSTSHEALAAAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR   NK  L  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRILALDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEAELIAQRLDELNRERQAMEAMMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  FF + A   V  L+     KIDG 
Sbjct: 430 RMVRAAVDEGLLVKGGGHAMAAGLTVERADLGRLRTFFTEKAARTVANLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTLEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L  ++++G++R Q+RV DA+P +
Sbjct: 550 GIAFRAADTALGNLLVNSRGASLHVAGTLGADHYQGARRIQMRVCDAAPAK 600


>gi|15888900|ref|NP_354581.1| single-stranded-DNA-specific exonuclease [Agrobacterium tumefaciens
           str. C58]
 gi|15156672|gb|AAK87366.1| single-stranded-DNA-specific exonuclease [Agrobacterium tumefaciens
           str. C58]
          Length = 602

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/588 (58%), Positives = 435/588 (73%), Gaps = 1/588 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFL VE S +  RWVS L Q G NRALA++Q HAIP+++ARVL  R V +D A  FL+P
Sbjct: 12  RAFLSVERSATEQRWVSRLDQAGQNRALAMSQIHAIPELIARVLAGRGVGVDDALAFLDP 71

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP +LTDC+KAA R+V+AI   EK+ IFGDYDVDGAAS AL  RFL+H  +  
Sbjct: 72  TIRSLMPDPHMLTDCEKAAERLVRAIETGEKVAIFGDYDVDGAASSALTYRFLAHFGLTP 131

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP+ M++    GA LI+TVDCGSTS+++LQ A + G DV+VIDHHQ
Sbjct: 132 EIYIPDRIFEGYGPNPAAMQQLAANGATLIVTVDCGSTSHESLQAAKDAGTDVVVIDHHQ 191

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-QDNKVPLNFDLLSLL 242
           V +E  PA ALVNPNR DDLSGQGHLCAAGVVFLV+V   R+L+ + N+     DLLSLL
Sbjct: 192 VGTELPPAVALVNPNREDDLSGQGHLCAAGVVFLVMVATLRLLKDRRNRQAFTLDLLSLL 251

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR   N GL AL ++  +  P+T  + G++IG
Sbjct: 252 DIVALATVCDVVPLKGLNRAYVVKGLIAARHMNNAGLAALFKKAGLGGPVTPYHFGFLIG 311

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A KLD LN+ R+ ME+AML +AEA+ L + 
Sbjct: 312 PRINAGGRIGDAALGSRLLTIDDTTEAEVIAEKLDELNRERQAMEAAMLAEAEAEALYEY 371

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D   A VIV   + WHPGIVGLLA+RLK++F RP+FAI+F+  GKG GSGRSI GFD+G
Sbjct: 372 GDGSGAGVIVTARENWHPGIVGLLASRLKDRFRRPAFAIAFDPSGKGTGSGRSINGFDMG 431

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AVE G+LVKGGGHAMAAGLTVER N G+L  FF++ A   V  L+ + V KIDG 
Sbjct: 432 RMVRAAVETGLLVKGGGHAMAAGLTVERANLGKLRTFFEEAAAKTVNELVESSVLKIDGA 491

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + L+D LE AGPYG+G+  P+FA P H+L+ +R+V  AH+++T E+ D   L 
Sbjct: 492 IGASGATLQLVDQLEQAGPYGSGHSQPIFAVPAHRLRDVRLVGTAHVKITLEAMDGSRLD 551

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            IAFR    PLG+ L+ +RG+ +HV G +  + W+G +R QLRVLDA+
Sbjct: 552 GIAFRAAEAPLGQMLLNARGRNIHVAGTVGADLWQGQRRVQLRVLDAA 599


>gi|116251859|ref|YP_767697.1| single-stranded-DNA-specific exonuclease [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115256507|emb|CAK07591.1| putative single-stranded-DNA-specific exonuclease [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 586

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/578 (58%), Positives = 430/578 (74%), Gaps = 1/578 (0%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILT 76
           RWV+ L Q G NRALA++Q H +PD++ARVL  R V++D A +FL+P+IR LMPDP  LT
Sbjct: 9   RWVARLDQAGQNRALAMSQIHGLPDLIARVLAGRGVTVDEAIEFLDPTIRSLMPDPHKLT 68

Query: 77  DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYG 136
           DC+KAA R+++AI   E + IFGDYDVDGAAS ALM RFLSH  V A +YIPDR+ +GYG
Sbjct: 69  DCEKAATRLLRAIERGESVAIFGDYDVDGAASSALMFRFLSHFGVRATIYIPDRVFEGYG 128

Query: 137 PNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVN 196
           PNP+ + + ++ GAQLI+TVDCGSTS++AL  A  + IDV+VIDHHQV  E  P +ALVN
Sbjct: 129 PNPAAINQLVDNGAQLIVTVDCGSTSHEALAAAAARNIDVVVIDHHQVTHELPPCHALVN 188

Query: 197 PNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLLDLVALATVCDVVP 255
           PNR DDLSGQGHLCAAGVVF+VLV   R+LR   NK  L  DLL  LD+VALATVCDVVP
Sbjct: 189 PNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRILAIDLLQWLDIVALATVCDVVP 248

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           L GLNRAYVVKGL+ AR Q N GL AL+ +  ++ P+T  + G++IGP INAGGRIG++ 
Sbjct: 249 LKGLNRAYVVKGLVAARHQSNAGLAALLRKAGLAGPVTPYHFGFLIGPRINAGGRIGDAA 308

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
           LGSRLL  DD+ E +++A +LD LN+ R+ ME+ ML++AEA+ L +  D + ASVIV   
Sbjct: 309 LGSRLLTLDDAGEADVIAQRLDELNRERQAMEAIMLQEAEAEALAEYGDGEGASVIVTAH 368

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G+MV  AV+EG+LV
Sbjct: 369 EKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMGRMVRAAVDEGLLV 428

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           KGGGHAMAAGLTVER N GRL  FF + A   V  L+     KIDG + AS   + LID 
Sbjct: 429 KGGGHAMAAGLTVERANLGRLRTFFTEKAERTVAGLVANETLKIDGAIGASGATLELIDR 488

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGE 555
           LE+AGPYG+G+  P+FA P H+L+  R+V   H+++T E+ D   L  IAFR   TPLG 
Sbjct: 489 LEAAGPYGSGHAQPLFAVPAHRLRDARLVGEKHVKVTLEAMDGSRLDGIAFRAADTPLGN 548

Query: 556 FLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            L+ SRG  +HV G L  ++++G++R QLRV DA+P +
Sbjct: 549 LLINSRGASLHVAGSLGADHYQGARRIQLRVCDAAPAK 586


>gi|218463397|ref|ZP_03503488.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           Kim 5]
          Length = 600

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/591 (58%), Positives = 432/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V +D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQVHGLPDLIARVLAGRGVPVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R+++AI   E + IFGDYDVDGAAS ALM RFLSH  V  
Sbjct: 70  TIRSLMPDPHTLTDCEKAATRLMRAIERGESVAIFGDYDVDGAASSALMFRFLSHFGVKT 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDRI +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRIFEGYGPNPAAINQLIDNGARLIVTVDCGSTSHEALAAAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR   NK  L  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKGILAIDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E EM+A +LD LN+ R+ M++ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEAEMIAQRLDELNRERQAMDAVMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           KMV  AV+EG+LV GGGHAMAAGLTVER + GRL  FF + A   V  L      KIDG 
Sbjct: 430 KMVRAAVDEGLLVTGGGHAMAAGLTVERADLGRLRTFFTEKAARTVANLAANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTLEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L   +++G++R QLRV DA+P +
Sbjct: 550 GIAFRAADTALGNLLVNSRGASLHVAGTLGAEHYQGARRLQLRVCDAAPAK 600


>gi|222148683|ref|YP_002549640.1| single-stranded-DNA-specific exonuclease [Agrobacterium vitis S4]
 gi|221735669|gb|ACM36632.1| single-stranded-DNA-specific exonuclease [Agrobacterium vitis S4]
          Length = 600

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/591 (57%), Positives = 436/591 (73%), Gaps = 3/591 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           ++AFL VE S+SG RWVS L Q G+NR+LAI Q H IPD+VARVL  R V++  A+ FL+
Sbjct: 9   ERAFLNVETSVSGQRWVSRLDQAGLNRSLAIAQVHGIPDLVARVLAGRGVAVADAQAFLD 68

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+IR LMPDP  LTD DKAA R+V AI  SE++ IFGDYDVDGAAS AL+ RFL+H  + 
Sbjct: 69  PTIRDLMPDPSSLTDGDKAADRLVAAIMRSERVAIFGDYDVDGAASSALLWRFLAHFGIE 128

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPN   + + I  GAQLI+TVDCGSTS++AL+ A  +G+DV+VIDHH
Sbjct: 129 AEIYIPDRIFEGYGPNAVAIGQLIERGAQLIVTVDCGSTSHEALEEARRRGVDVVVIDHH 188

Query: 183 QVKSEEIPA-YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLS 240
           Q+  +++PA  ALVNPNR DDLSGQGHLCAAGVVF+VLV   R LR+  +    + DLL+
Sbjct: 189 QM-GQDLPACLALVNPNRSDDLSGQGHLCAAGVVFMVLVGTLRKLREAGHGAARSLDLLA 247

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL++   I  P+T  + G++
Sbjct: 248 WLDLVALATVCDVVPLKGLNRAYVVKGLIAARHQQNAGLAALLKIAGIGGPVTPYHFGFL 307

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG++ LGSRLL  DD+ E + +A +LD LN+ R+ ME+ ML +AEA+ + 
Sbjct: 308 VGPRINAGGRIGDAALGSRLLTLDDAAEADEIAAQLDDLNRQRQAMEAQMLAEAEAEAMA 367

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +    + A+VI+   + WHPGIVGLLAARLKE+F RP+FAI+F+  GKG GSGRSI GFD
Sbjct: 368 EYGTGENAAVILTAREGWHPGIVGLLAARLKERFQRPAFAIAFDGSGKGTGSGRSIAGFD 427

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GKMV  AV+ G+LVKGGGHAMAAGLTVER N G+L  FF + A   V AL      KID
Sbjct: 428 MGKMVRAAVDNGLLVKGGGHAMAAGLTVERGNLGKLRAFFDEQAQEKVMALSAIRALKID 487

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G + AS   +ALID+LE+AGPYG+G+  P+FA P H+++  R++  +H+++T E+ D   
Sbjct: 488 GAVGASGATLALIDLLETAGPYGSGHSQPIFAIPAHRIRDSRLIGTSHVKVTLEAPDGSR 547

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           +  IAFR   TPLG+ L+  RG  +HV G L    W+G++R Q+R+LDA+P
Sbjct: 548 IDGIAFRAKETPLGDLLLGRRGDAVHVAGCLGAELWQGTRRIQIRILDAAP 598


>gi|227821964|ref|YP_002825935.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium fredii
           NGR234]
 gi|227340964|gb|ACP25182.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium fredii
           NGR234]
          Length = 600

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/590 (57%), Positives = 438/590 (74%), Gaps = 3/590 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           ++AFLGVE SISG RWVS L Q G NRALAI+Q H   +++ARVL  R V +D A  FL+
Sbjct: 9   ERAFLGVERSISGQRWVSRLDQAGQNRALAISQVHGYSELIARVLAGRGVGLDDAAQFLD 68

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R LMPDP +LTDC KAA R+  AI + EK+ IFGDYDVDGAAS ALM+RFL H  + 
Sbjct: 69  PTLRALMPDPDVLTDCRKAAERLAHAIRHGEKVAIFGDYDVDGAASSALMLRFLRHFDIR 128

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPNP  +E+ I  GA LI++VDCGSTS+++L  A  +G+DV+VIDHH
Sbjct: 129 AEIYIPDRIFEGYGPNPQAIEQLIENGAGLIVSVDCGSTSHESLAVAAERGVDVVVIDHH 188

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFDLLS 240
           QV +   P +ALVNPNR DDLSGQGHLCAAGVV+LVLV   R+LR    VP   +FDLL+
Sbjct: 189 QVGATLPPCHALVNPNREDDLSGQGHLCAAGVVYLVLVNTLRVLRLAG-VPRAASFDLLA 247

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVALATVCDVVPL GLNRAYVVKGL+ AR  GN GL AL+ +  I  P+T  +LG++
Sbjct: 248 LLDLVALATVCDVVPLKGLNRAYVVKGLIAARHMGNNGLAALLRKAAIGGPVTPYHLGFL 307

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LGSRLL  DD+   E++A +LD LN+ R+ ME+AML +AEA+VL 
Sbjct: 308 IGPRINAGGRIGDAALGSRLLTLDDATAAEVIASQLDELNRERQAMEAAMLAEAEAEVLA 367

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +    + A+VI+   + WHPGIVGL+AAR+KEKF RP+FAI+F+ +G+G GSGRSI GFD
Sbjct: 368 EYGTGEGATVIITARENWHPGIVGLIAARIKEKFRRPAFAIAFDPNGRGTGSGRSIPGFD 427

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G++V  AV++G+LVKGGGHAMAAGLTVER   GRL  FF++ A + V  L+     K+D
Sbjct: 428 MGRLVRAAVDDGLLVKGGGHAMAAGLTVERAKLGRLRQFFEERAESAVRDLVAVETLKLD 487

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L A+   + L+D+L+ AGPYG+ +P PVFAFP H+L+  R V   H+++T E  D   
Sbjct: 488 GALAAAGATLDLVDLLDQAGPYGSAHPQPVFAFPQHRLRDSRQVGANHIKVTLEGHDGSR 547

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +  IAFR   TPLG+FL+ SRG  +HV G +  + W+G++R QLRV DA+
Sbjct: 548 VDGIAFRATETPLGDFLLGSRGSTVHVAGSVSADLWQGTRRVQLRVTDAA 597


>gi|150396665|ref|YP_001327132.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           medicae WSM419]
 gi|150028180|gb|ABR60297.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           medicae WSM419]
          Length = 600

 Score =  628 bits (1619), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 335/589 (56%), Positives = 439/589 (74%), Gaps = 3/589 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S+SG RWVS L Q G NRALAI+Q H   +++ARVL  R V +D A  FL+P
Sbjct: 10  RAFLGVERSVSGQRWVSRLDQAGQNRALAISQVHGYSELIARVLAGRGVGLDDAGAFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP ILTDC KAA R+  AI   EKI++FGDYDVDGAAS ALM+RFL H  +  
Sbjct: 70  TLRALMPDPDILTDCRKAAERLADAIRRREKIVVFGDYDVDGAASAALMVRFLRHFDLTT 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP  +E+ I+ GA+LI+TVDCGSTS+++   A  +G DV+V+DHHQ
Sbjct: 130 EIYIPDRIFEGYGPNPQAIEQLIDRGAELIVTVDCGSTSHESFAVAAERGTDVVVVDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR--QDNKVPLNFDLLSL 241
           V S   P +ALVNPNR DDLSGQGHLCAAGVV+LVLV   R+LR   D++V  +FDLLSL
Sbjct: 190 VGSTLPPCHALVNPNREDDLSGQGHLCAAGVVYLVLVNTLRVLRLKGDSRVA-SFDLLSL 248

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLV+LATVCDVVPL GLNRAYVVKGL+ AR  GN GL AL+ +  I  P+T  +LG+++
Sbjct: 249 LDLVSLATVCDVVPLKGLNRAYVVKGLIAARHMGNAGLAALLRKAAIGGPVTPYHLGFLL 308

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LGSRLL  DD+ E E++A +LD LN++R+ ME+AML +AEA+VL +
Sbjct: 309 GPRINAGGRIGDAALGSRLLTLDDAAEAEIIAGQLDELNRDRQAMEAAMLAEAEAEVLAE 368

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
               + ASVI+   + WHPGIVGL+AAR+KEKF RP+FAI+F+ +G+G GSGRSI GFD+
Sbjct: 369 YGTGEGASVIITARENWHPGIVGLIAARIKEKFRRPAFAIAFDPNGRGTGSGRSINGFDM 428

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G++V  AV+ G+L+KGGGHAMAAGLTVER   G+L  FF++ A   V  L+     K+DG
Sbjct: 429 GRLVRAAVDSGLLIKGGGHAMAAGLTVERGKLGQLRQFFEERAETAVRDLVAVQTLKVDG 488

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            + A+   + L+D+L+ AGPYG+G+P P+FAFP H+L+  R V   H+++T E QD   +
Sbjct: 489 AMAAAGATLDLVDLLDQAGPYGSGHPQPLFAFPQHRLRDSRQVGANHVKVTLEGQDGRRI 548

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + IAFR   TPLG FL+ +RG  +H  G +  + W+G+++ QLR+ DA+
Sbjct: 549 EGIAFRATETPLGAFLLGNRGATVHAAGSVSADLWQGTRKVQLRLTDAA 597


>gi|15965474|ref|NP_385827.1| single-stranded-DNA-specific exonuclease protein [Sinorhizobium
           meliloti 1021]
 gi|307302595|ref|ZP_07582351.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           meliloti BL225C]
 gi|307318442|ref|ZP_07597876.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           meliloti AK83]
 gi|15074655|emb|CAC46300.1| Probable single-stranded-DNA-specific exonuclease [Sinorhizobium
           meliloti 1021]
 gi|306895782|gb|EFN26534.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           meliloti AK83]
 gi|306902959|gb|EFN33550.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           meliloti BL225C]
          Length = 600

 Score =  618 bits (1593), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 335/588 (56%), Positives = 432/588 (73%), Gaps = 1/588 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S+SG RWVS L Q G NRALAI+Q H   +++ARVL  R V +D A  FL P
Sbjct: 10  RAFLGVERSVSGQRWVSRLDQAGQNRALAISQVHGYSELIARVLAGRGVGLDDAAAFLEP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP  LTD  KAA R+  AI   EK++IFGDYDVDGAAS ALM RFL H  + A
Sbjct: 70  TLRALMPDPDTLTDGRKAAERLADAIRRREKVVIFGDYDVDGAASSALMARFLRHFDITA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP  +++ I+ G++LI+TVDCGSTS++AL  A  +  DV+VIDHHQ
Sbjct: 130 EIYIPDRIFEGYGPNPQAIDQLIDRGSELIVTVDCGSTSHEALAVAAERRTDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-QDNKVPLNFDLLSLL 242
           V S   P +ALVNPNR DDLSGQGHLCAAGVV+LVLV   R+LR + +    +FDLLSLL
Sbjct: 190 VGSVLPPCHALVNPNREDDLSGQGHLCAAGVVYLVLVNTLRVLRLRGDPRAASFDLLSLL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATVCDVVPL GLNRAYVVKGL+ AR  GN GL AL+ +  I  P+T  +LG+++G
Sbjct: 250 DLVALATVCDVVPLKGLNRAYVVKGLLAARHMGNAGLAALLRKAAIGGPVTPYHLGFLLG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  D +   E +A +LD LN++R+ ME+AML +AEA+VL + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDVAAAAEAIASQLDELNRDRQAMEAAMLAEAEAEVLAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
              + ASVIV     WHPGIVGL+AAR+KEKF RP+FAI+F+ +G+G GSGRSI GFD+G
Sbjct: 370 GTGEGASVIVTARQNWHPGIVGLIAARIKEKFRRPAFAIAFDPNGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           ++V  AV+ G+LVKGGGHAMAAGLTVER   G+L  FF++ A   +  L+     K+DG 
Sbjct: 430 RLVRAAVDNGLLVKGGGHAMAAGLTVERGKLGQLRQFFEERAETAIRDLVAVQTLKVDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L A+   + L+D+L+ AGPYG+G+P P+FAFP H+L+  R V   H+++T E QD   ++
Sbjct: 490 LAAAGATLDLVDLLDQAGPYGSGHPQPLFAFPQHRLRDSRQVGANHVKVTLEGQDGSRME 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            IAFR   TPLG+FL+ +RG  +HV G +  + W+G+++ QLRV DA+
Sbjct: 550 GIAFRAAETPLGDFLLGNRGATVHVAGSVSADLWQGTRKVQLRVTDAA 597


>gi|110633344|ref|YP_673552.1| exonuclease RecJ [Mesorhizobium sp. BNC1]
 gi|110284328|gb|ABG62387.1| exonuclease RecJ [Chelativorans sp. BNC1]
          Length = 594

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 307/585 (52%), Positives = 394/585 (67%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV  S  G  W   L   G N AL I Q H +P+IVARVL  R V+++ A+ FL PSI
Sbjct: 8   FLGVRQSARGVSWEHRLDSRGENVALGIAQSHGVPEIVARVLAGRGVALEEAERFLTPSI 67

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R L+PDP  LTD +KAARRI  A++  E++ IFGDYDVDGA S A++ RFL+H  V A +
Sbjct: 68  RDLLPDPAGLTDMEKAARRIADAVHAGERVAIFGDYDVDGAVSSAILKRFLAHYGVTAEI 127

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDR+ +GYGPNP  M + I  GA+LI+TVDCG+ S  ++  A   G +V+V+DHHQV 
Sbjct: 128 YIPDRLFEGYGPNPDAMRELIRRGAKLIVTVDCGTNSAPSIAAANEMGAEVVVLDHHQVG 187

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
            +   A A+VNPNR DDLSGQGHLCAAGVVFL LV   RILR++ +     DLLS+LDLV
Sbjct: 188 GDLPEAVAIVNPNREDDLSGQGHLCAAGVVFLALVQTTRILREELRATPPPDLLSMLDLV 247

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALATVCDVVPL+G+NRA+V KGL+ AR+   PGL AL     I  P+   +LG+++GP I
Sbjct: 248 ALATVCDVVPLVGVNRAFVAKGLLAARQMRTPGLSALARVARIGEPLNCHHLGFLLGPRI 307

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG + LGS LL + +  E E +A  LD LNQ R+ ME+AML +A A+   +    
Sbjct: 308 NAGGRIGNAALGSLLLATVEPGEAESIAATLDRLNQERQAMETAMLAEARAEADAELMSG 367

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
              +V+V   D WHPGIVGL+A+RLK+   RP+FAI+F+ +G G GSGRSI GFD+G++V
Sbjct: 368 DGPAVLVTASDTWHPGIVGLIASRLKDHARRPTFAIAFDMNGMGTGSGRSITGFDLGRLV 427

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV EG+LVKGGGHAMAAG+TVER   G L  FF++ A   V  L  +   +ID  L+A
Sbjct: 428 RDAVSEGLLVKGGGHAMAAGITVERKKLGALRAFFEEKAAGAVSLLRQSESLRIDAALSA 487

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
               + L++ LE+AGPYG+G+P PV A P H+L   ++V   H++    S     LQAIA
Sbjct: 488 EGATLELLETLEAAGPYGSGHPAPVLALPRHRLADAKLVGNGHIRADLRSLSGARLQAIA 547

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           FR   T LG FL  SRG  +HV G L VN+W GS+  Q R+ DA+
Sbjct: 548 FRAAETDLGNFLFASRGASVHVAGTLAVNHWNGSRSVQFRITDAA 592


>gi|306844173|ref|ZP_07476766.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. BO1]
 gi|306275448|gb|EFM57185.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. BO1]
          Length = 594

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 318/587 (54%), Positives = 402/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIERRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSAPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLTLVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G+ +HV G+L +N+W GS   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGRSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254714329|ref|ZP_05176140.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M644/93/1]
 gi|254717228|ref|ZP_05179039.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M13/05/1]
 gi|261219046|ref|ZP_05933327.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M13/05/1]
 gi|261322106|ref|ZP_05961303.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M644/93/1]
 gi|260924135|gb|EEX90703.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M13/05/1]
 gi|261294796|gb|EEX98292.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M644/93/1]
          Length = 594

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 319/587 (54%), Positives = 402/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           D   ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 DGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|17987011|ref|NP_539645.1| single-stranded-DNA-specific exonuclease RECJ [Brucella melitensis
           bv. 1 str. 16M]
 gi|23502146|ref|NP_698273.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis 1330]
 gi|161619221|ref|YP_001593108.1| single-stranded-DNA-specific exonuclease RecJ [Brucella canis ATCC
           23365]
 gi|163843533|ref|YP_001627937.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis ATCC
           23445]
 gi|225852764|ref|YP_002732997.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           ATCC 23457]
 gi|254702006|ref|ZP_05163834.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 5
           str. 513]
 gi|254710333|ref|ZP_05172144.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis B2/94]
 gi|256031827|ref|ZP_05445441.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M292/94/1]
 gi|256044911|ref|ZP_05447815.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256113827|ref|ZP_05454620.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 3 str. Ether]
 gi|256160006|ref|ZP_05457715.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M490/95/1]
 gi|256255227|ref|ZP_05460763.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti B1/94]
 gi|256263751|ref|ZP_05466283.1| phosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369691|ref|YP_003107201.1| single-stranded-DNA-specific exonuclease RecJ [Brucella microti CCM
           4915]
 gi|260565488|ref|ZP_05835972.1| phosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260566210|ref|ZP_05836680.1| phosphoesterase [Brucella suis bv. 4 str. 40]
 gi|261222424|ref|ZP_05936705.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti B1/94]
 gi|261317897|ref|ZP_05957094.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis B2/94]
 gi|261752573|ref|ZP_05996282.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 5
           str. 513]
 gi|265988926|ref|ZP_06101483.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M292/94/1]
 gi|265991339|ref|ZP_06103896.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265995176|ref|ZP_06107733.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 3 str. Ether]
 gi|265998391|ref|ZP_06110948.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M490/95/1]
 gi|17982663|gb|AAL51909.1| single-stranded-DNA-specific exonuclease recj [Brucella melitensis
           bv. 1 str. 16M]
 gi|23348109|gb|AAN30188.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis 1330]
 gi|161336032|gb|ABX62337.1| single-stranded-DNA-specific exonuclease RecJ [Brucella canis ATCC
           23365]
 gi|163674256|gb|ABY38367.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis ATCC
           23445]
 gi|225641129|gb|ACO01043.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           ATCC 23457]
 gi|255999853|gb|ACU48252.1| single-stranded-DNA-specific exonuclease RecJ [Brucella microti CCM
           4915]
 gi|260151556|gb|EEW86650.1| phosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260155728|gb|EEW90808.1| phosphoesterase [Brucella suis bv. 4 str. 40]
 gi|260921008|gb|EEX87661.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti B1/94]
 gi|261297120|gb|EEY00617.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis B2/94]
 gi|261742326|gb|EEY30252.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 5
           str. 513]
 gi|262552859|gb|EEZ08849.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M490/95/1]
 gi|262766289|gb|EEZ12078.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 3 str. Ether]
 gi|263002123|gb|EEZ14698.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263093809|gb|EEZ17814.1| phosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|264661123|gb|EEZ31384.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M292/94/1]
 gi|326409291|gb|ADZ66356.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           M28]
 gi|326539002|gb|ADZ87217.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           M5-90]
          Length = 594

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 318/587 (54%), Positives = 401/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|306840265|ref|ZP_07473039.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. BO2]
 gi|306289792|gb|EFM60974.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. BO2]
          Length = 594

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 318/587 (54%), Positives = 401/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSAPSITAARQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLTLVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVLRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254704547|ref|ZP_05166375.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 3
           str. 686]
 gi|261755231|ref|ZP_05998940.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 3
           str. 686]
 gi|261744984|gb|EEY32910.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 3
           str. 686]
          Length = 594

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 318/587 (54%), Positives = 400/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPVFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254706557|ref|ZP_05168385.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M163/99/10]
 gi|261314016|ref|ZP_05953213.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M163/99/10]
 gi|261303042|gb|EEY06539.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M163/99/10]
          Length = 594

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 317/587 (54%), Positives = 400/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R  S++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGGSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254719319|ref|ZP_05181130.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. 83/13]
 gi|265984321|ref|ZP_06097056.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. 83/13]
 gi|306839094|ref|ZP_07471911.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. NF
           2653]
 gi|264662913|gb|EEZ33174.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. 83/13]
 gi|306405641|gb|EFM61903.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. NF
           2653]
          Length = 594

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 317/587 (54%), Positives = 401/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R L+PDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLLPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAVKGASLIVTVDCGTNSAPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLTLVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARIARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|62290177|ref|YP_221970.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           1 str. 9-941]
 gi|82700099|ref|YP_414673.1| phosphoesterase [Brucella melitensis biovar Abortus 2308]
 gi|189024412|ref|YP_001935180.1| phosphoesterase, RecJ-like protein [Brucella abortus S19]
 gi|237815686|ref|ZP_04594683.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus
           str. 2308 A]
 gi|254689482|ref|ZP_05152736.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 6 str.
           870]
 gi|254697619|ref|ZP_05159447.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730510|ref|ZP_05189088.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 4 str.
           292]
 gi|256257730|ref|ZP_05463266.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 9 str.
           C68]
 gi|260546721|ref|ZP_05822460.1| phosphoesterase [Brucella abortus NCTC 8038]
 gi|260755005|ref|ZP_05867353.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           6 str. 870]
 gi|260758221|ref|ZP_05870569.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           4 str. 292]
 gi|260762048|ref|ZP_05874391.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260884016|ref|ZP_05895630.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           9 str. C68]
 gi|297248569|ref|ZP_06932287.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           5 str. B3196]
 gi|62196309|gb|AAX74609.1| RecJ, single-stranded-DNA-specific exonuclease RecJ [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616200|emb|CAJ11246.1| Phosphoesterase, RecJ-like:Phosphoesterase, DHHA1:Bacterial RecJ
           exonuclease [Brucella melitensis biovar Abortus 2308]
 gi|189019984|gb|ACD72706.1| Phosphoesterase, RecJ-like protein [Brucella abortus S19]
 gi|237788984|gb|EEP63195.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus
           str. 2308 A]
 gi|260095771|gb|EEW79648.1| phosphoesterase [Brucella abortus NCTC 8038]
 gi|260668539|gb|EEX55479.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           4 str. 292]
 gi|260672480|gb|EEX59301.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260675113|gb|EEX61934.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           6 str. 870]
 gi|260873544|gb|EEX80613.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           9 str. C68]
 gi|297175738|gb|EFH35085.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           5 str. B3196]
          Length = 594

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 317/587 (54%), Positives = 400/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W  S   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNASVSPQIQILDAA 591


>gi|153009250|ref|YP_001370465.1| single-stranded-DNA-specific exonuclease RecJ [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561138|gb|ABS14636.1| single-stranded-DNA-specific exonuclease RecJ [Ochrobactrum
           anthropi ATCC 49188]
          Length = 594

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 312/591 (52%), Positives = 404/591 (68%), Gaps = 4/591 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLG++ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGIKQSATGQKWVDRLGLREANTALAIAQHHGISDLVARVLAGRGVSVENAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  LTD + AA RI  AI   E + IFGDYDVDGA S ALM RFL H  +
Sbjct: 63  DPTLRNLMPDPATLTDMENAASRIADAILRRETVAIFGDYDVDGACSSALMARFLKHYGI 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M   + +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRDLVAKGATLIVTVDCGTNSASSITAAKQAGADVVVLDH 182

Query: 182 HQVKSEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           HQV  + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR+  K P   DLL
Sbjct: 183 HQVGGD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLTLVQVTKILRERGKGP-GPDLL 240

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           SLLDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+   +LGY
Sbjct: 241 SLLDLVALATVCDVVPLTGVNRAFVVKGLVVARSQSNVGLAALARVARIGEPLNVFHLGY 300

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           +IGP INAGGRIG++ LG+RLL  DDS   + +A++LD LNQ R+ ME+ ML +AEA+  
Sbjct: 301 LIGPRINAGGRIGDAGLGARLLTLDDSATADRIAVELDRLNQERQAMEAEMLMEAEAEAS 360

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G 
Sbjct: 361 LEISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSIMGL 420

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK+V  A+E G+LVKGGGHAMAAG+T+ER N G L  + ++ + +IV  L       I
Sbjct: 421 DLGKLVRGAMERGLLVKGGGHAMAAGITIERANLGALRAYLEEESAHIVSRLRENQSLSI 480

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG L AS   ++L + L+ AGPYG+ +P P+ A P+H L  +R V   H+++     D +
Sbjct: 481 DGALAASGATVSLYEALQKAGPYGSAHPQPILALPHHILADVRGVGRDHVRVALRGADGK 540

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            + AIAFR     LG FL  + G+ +HV G+L +N+W GS   Q+++LDA+
Sbjct: 541 RVNAIAFRAAEGDLGRFLFNNIGQSVHVAGNLSLNHWNGSVTPQIQILDAA 591


>gi|225627737|ref|ZP_03785774.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti str.
           Cudo]
 gi|260168961|ref|ZP_05755772.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. F5/99]
 gi|261758454|ref|ZP_06002163.1| phosphoesterase [Brucella sp. F5/99]
 gi|225617742|gb|EEH14787.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti str.
           Cudo]
 gi|261738438|gb|EEY26434.1| phosphoesterase [Brucella sp. F5/99]
          Length = 594

 Score =  591 bits (1523), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 317/587 (54%), Positives = 400/587 (68%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +L Y+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLRYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254693969|ref|ZP_05155797.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214260|ref|ZP_05928541.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           3 str. Tulya]
 gi|260915867|gb|EEX82728.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           3 str. Tulya]
          Length = 594

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 316/587 (53%), Positives = 399/587 (67%), Gaps = 4/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++
Sbjct: 7   FLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP  L D D AA RI  AI   E + IF DYDVDGA S ALM RFL H  V  ++
Sbjct: 67  RNLMPDPATLNDMDNAAGRIADAIQRRETVAIFSDYDVDGACSSALMARFLKHYGVQHSI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVG 186

Query: 186 SEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LD
Sbjct: 187 GD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP
Sbjct: 245 LVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +  
Sbjct: 305 RINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEIS 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK
Sbjct: 365 GGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGK 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       IDG L
Sbjct: 425 LVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + + A
Sbjct: 485 AASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR     LG FL  + G  +HV G+L +N+W  S   Q+++LDA+
Sbjct: 545 IAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNASVSPQIQILDAA 591


>gi|256061347|ref|ZP_05451491.1| single-stranded-DNA-specific exonuclease RecJ [Brucella neotomae
           5K33]
 gi|261325349|ref|ZP_05964546.1| single-stranded-DNA-specific exonuclease RecJ [Brucella neotomae
           5K33]
 gi|261301329|gb|EEY04826.1| single-stranded-DNA-specific exonuclease RecJ [Brucella neotomae
           5K33]
          Length = 594

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 317/591 (53%), Positives = 401/591 (67%), Gaps = 4/591 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS+  A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVQGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGP P  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QYSIYIPDRIFEGYGPYPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQVKSEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           HQV  + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLL
Sbjct: 183 HQVGGD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLL 240

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           S+LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY
Sbjct: 241 SMLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGY 300

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           +IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+  
Sbjct: 301 LIGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEAS 360

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G 
Sbjct: 361 LEISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGL 420

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       I
Sbjct: 421 DLGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSI 480

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D +
Sbjct: 481 DGALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGK 540

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 541 RVNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|319783896|ref|YP_004143372.1| single-stranded-DNA-specific exonuclease RecJ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169784|gb|ADV13322.1| single-stranded-DNA-specific exonuclease RecJ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 594

 Score =  588 bits (1516), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 309/585 (52%), Positives = 389/585 (66%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V  S+SG  W   L +     ALAI Q + +PDIVARVL  R V+ +  + FL+P+I
Sbjct: 8   FLDVRQSVSGVSWEHRLTERQDMIALAIAQGYGVPDIVARVLAGRGVTAEQTERFLDPTI 67

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R L+PDP  LTD D+AA RI  A+   EK+ IFGDYDVDGAAS AL+ RFL+H SV + +
Sbjct: 68  RDLLPDPASLTDMDRAAARIAAAVMAREKVAIFGDYDVDGAASSALLKRFLTHFSVPSEI 127

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M + ++ GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 128 YIPDRIFEGYGPNPDAMRELVSRGATLIVTVDCGTNSAASIDAANEAGADVVVLDHHQVG 187

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
                A A+VNPNR DDLSGQGHLCAAGVVFL LV   RILR         DLLSLLD+V
Sbjct: 188 GALPAAIAVVNPNRDDDLSGQGHLCAAGVVFLALVQTARILRSRMADATPPDLLSLLDIV 247

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALATVCDVVPL G+NRA+VVKGL +AR+Q N GL AL     I  PI+  +L Y+IGP I
Sbjct: 248 ALATVCDVVPLTGVNRAFVVKGLQMARQQKNEGLAALARVSRIGEPISTFHLAYLIGPRI 307

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG++ LGSRLL +DD  E   +A  LD LNQ R+LME  ML  A A+   +    
Sbjct: 308 NAGGRIGDAALGSRLLATDDPVEARTIAETLDRLNQERQLMEQEMLAAARAEADAELAGG 367

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
              +++V   + WHPGIVGLLA+RLK+   RP+FAI+F  +G G GSGRS+ GFD+G++V
Sbjct: 368 NGPAIVVTASNSWHPGIVGLLASRLKDHARRPAFAIAFNANGIGTGSGRSVSGFDLGRLV 427

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A   G++VKGGGH MAAG+TVER   G L  FF++ A   V  L       IDG L A
Sbjct: 428 REAAIAGLIVKGGGHGMAAGITVERARLGELRAFFEERAAADVFRLQGEESLAIDGALAA 487

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
               ++L+D LE AGP+GAG+  PVFA P H+L   R V   H+++  +S+    +QAIA
Sbjct: 488 EGATLSLLDALEQAGPFGAGHVAPVFALPRHRLADARPVGTNHIRVELQSESGGRIQAIA 547

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           FR   T LGEFL ++RGK +HV G L  NYW G++  Q R+ DA+
Sbjct: 548 FRAVDTALGEFLFKNRGKTIHVAGSLSGNYWNGNRTVQFRITDAA 592


>gi|239832155|ref|ZP_04680484.1| single-stranded-DNA-specific exonuclease RecJ [Ochrobactrum
           intermedium LMG 3301]
 gi|239824422|gb|EEQ95990.1| single-stranded-DNA-specific exonuclease RecJ [Ochrobactrum
           intermedium LMG 3301]
          Length = 594

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 312/591 (52%), Positives = 404/591 (68%), Gaps = 4/591 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLG++ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGIKQSATGQKWVDRLGLREANTALAIAQHHGITDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  LTD D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  +
Sbjct: 63  DPTLRNLMPDPATLTDMDNAAGRIADAILRRETVAIFGDYDVDGACSSALMSRFLKHYGI 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M   + +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRDLVAKGATLIVTVDCGTNSAPSITAAKQAGADVVVLDH 182

Query: 182 HQVKSEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           HQV  + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR+  K P   DLL
Sbjct: 183 HQVGGD-LPEDAVAIVNPNREDDISLQGHLCAAGVVFLTLVQVTKILRERGKGP-GPDLL 240

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           SLLDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+   +LGY
Sbjct: 241 SLLDLVALATVCDVVPLTGVNRAFVVKGLLVARSQSNVGLAALARVSRIGEPLNVFHLGY 300

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           +IGP INAGGRIG++ LG+RLL  DD    + +A++LD LNQ R+ ME+ ML +AEA+  
Sbjct: 301 LIGPRINAGGRIGDAGLGARLLTLDDPATADRIAVELDRLNQERQAMEAEMLMEAEAEAS 360

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G 
Sbjct: 361 LEISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSIMGL 420

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK+V  A++ G+LVKGGGHAMAAG+T+ER N G L  + ++ + +IV  L       I
Sbjct: 421 DLGKLVRGAMDRGLLVKGGGHAMAAGITIERGNLGALRAYLEEESAHIVSRLRENQSLSI 480

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG L AS   ++L + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D +
Sbjct: 481 DGALAASGATVSLYEALQKAGPYGSAHPQPILALPHHILADVRGVGRDHVRVTLRGADGK 540

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            + AIAFR     LG FL  + G+ +HV G+L +N+W GS   Q+++LDA+
Sbjct: 541 RVNAIAFRAAEGDLGRFLFNNIGQSVHVAGNLSLNHWNGSVTPQIQILDAA 591


>gi|294852605|ref|ZP_06793278.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. NVSL
           07-0026]
 gi|294821194|gb|EFG38193.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. NVSL
           07-0026]
          Length = 594

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 315/591 (53%), Positives = 400/591 (67%), Gaps = 4/591 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I  +VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISYLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++  LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLHNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQVKSEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           HQV  + +P  A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLL
Sbjct: 183 HQVGGD-LPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLL 240

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           S+LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+   +LGY
Sbjct: 241 SMLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNVFHLGY 300

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           +IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+  
Sbjct: 301 LIGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEAS 360

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G 
Sbjct: 361 LEISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGL 420

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       I
Sbjct: 421 DLGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSI 480

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D +
Sbjct: 481 DGALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGK 540

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 541 RVNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|148559790|ref|YP_001259184.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ovis ATCC
           25840]
 gi|148371047|gb|ABQ61026.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ovis ATCC
           25840]
          Length = 575

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 310/571 (54%), Positives = 390/571 (68%), Gaps = 4/571 (0%)

Query: 22  LGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKA 81
           LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++R LMPDP  L D D A
Sbjct: 4   LGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTLRNLMPDPATLNDMDNA 63

Query: 82  ARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSL 141
           A RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++YIPDRI +GYGPNP  
Sbjct: 64  AGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSIYIPDRIFEGYGPNPDA 123

Query: 142 MEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP--AYALVNPNR 199
           M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV  + +P  A A+VNPNR
Sbjct: 124 MRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVGGD-LPEDAVAIVNPNR 182

Query: 200 LDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGL 259
            DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LDLVALATVCDVVPL G+
Sbjct: 183 EDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLDLVALATVCDVVPLKGV 241

Query: 260 NRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSR 319
           NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP INAGGRIG++ LG+R
Sbjct: 242 NRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGPRINAGGRIGDAGLGAR 301

Query: 320 LLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWH 379
           LL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +      ASVIV   DRWH
Sbjct: 302 LLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEISGGAGASVIVTASDRWH 361

Query: 380 PGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGG 439
           PGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK+V  AVE+G+LVKGGG
Sbjct: 362 PGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGKLVRGAVEKGLLVKGGG 421

Query: 440 HAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESA 499
           HAMAAG+T+ER N G L  + ++ A +IV  L       IDG L AS   +AL + L+ A
Sbjct: 422 HAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGALAASGATVALYEALQKA 481

Query: 500 GPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ 559
           GPYG+ +P P+ A P+H L  +R V   H+++T    D + + AIAFR     LG FL  
Sbjct: 482 GPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNAIAFRAAEGDLGRFLFN 541

Query: 560 SRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 NIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 572


>gi|49474261|ref|YP_032303.1| single-stranded-DNA-specific exonuclease [Bartonella quintana str.
           Toulouse]
 gi|49239765|emb|CAF26152.1| Single-stranded-DNA-specific exonuclease [Bartonella quintana str.
           Toulouse]
          Length = 594

 Score =  577 bits (1487), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 293/590 (49%), Positives = 392/590 (66%), Gaps = 6/590 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V+ S  G  W+  L  +GIN A AI+QK   PD +ARVL  R+V    A  F+NP++
Sbjct: 7   FLNVQSSACGQAWLDALDLKGINNARAISQKFGFPDALARVLSARDVDESEAVAFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP    D   AA RIV+AI N EK+ +FGDYDVDGA S AL+ RFL +  +   +
Sbjct: 67  RTLMPDPESFMDMQCAAERIVKAILNQEKVAVFGDYDVDGACSSALIARFLRYFEIEVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI++GYGPN   M   + +GA LIITVDCG+ S DA++ A  +G DV+V+DHHQ+ 
Sbjct: 127 YIPDRIIEGYGPNEQAMRMLVQKGAHLIITVDCGANSPDAVRAARLEGADVVVLDHHQMT 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLL 242
                A ALVNPNR DD SGQGHLCAAGVVF+ L  +  +LR+     K+P   DLLS+L
Sbjct: 187 EVHQEAVALVNPNRPDDFSGQGHLCAAGVVFVTLAWVNHLLRKKKFGEKLP---DLLSML 243

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALAT+CDVVPL G+NRA+VVKGL VAR   N G+ AL +   I  P+ + +LG+++G
Sbjct: 244 DLVALATICDVVPLQGVNRAFVVKGLQVARSMHNFGIAALTKVARIDEPLNSFHLGFLLG 303

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG+  LG+RLL  +D  E + +A +LD LNQ R+ ME   L QAE+ + +  
Sbjct: 304 PRINAGGRIGDQALGARLLCCEDKDEADKIAERLDRLNQERQEMEGVQLAQAESYIDSLY 363

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            + +    IV+    WHPGI+G+LA+RLKE+F  P F+I+ +EDG G+GSGRSI+G D+G
Sbjct: 364 QERETPMSIVIAHQEWHPGIIGILASRLKERFFCPVFSIALKEDGSGVGSGRSIDGIDLG 423

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
            +V  AV   +L KGGGH+MAAG+T++        ++ +K    +V  L       IDG 
Sbjct: 424 ALVREAVMLNLLEKGGGHSMAAGITIQSTKIEIFREWLEKKVSLMVSRLRAKKSLSIDGC 483

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L+AS  N AL DM+E AGP+G+GN  PVF  P+H+L ++  V   HL++   + + + LQ
Sbjct: 484 LSASGANKALFDMIEKAGPFGSGNTTPVFVLPSHRLINLCEVGKGHLRLVISNMEGKKLQ 543

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            IAFR  GTPLG FL ++ G+ +HV G+L +NYW G+   QLRV+DA+ V
Sbjct: 544 GIAFRAMGTPLGYFLSENIGEMIHVAGNLSLNYWNGTINPQLRVIDAAAV 593


>gi|49475553|ref|YP_033594.1| single-stranded-DNA-specific exonuclease [Bartonella henselae str.
           Houston-1]
 gi|49238359|emb|CAF27583.1| Single-stranded-DNA-specific exonuclease [Bartonella henselae str.
           Houston-1]
          Length = 594

 Score =  572 bits (1473), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 292/587 (49%), Positives = 386/587 (65%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V+ S  G  W+  L  +GIN A AI+QK   PD +ARVL  R+V    A  F+NP++
Sbjct: 7   FLNVQSSACGQAWLDALDIQGINNARAISQKFGFPDQLARVLSARDVDESEAVAFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP   TD   AA RIV+AI   EK+ +FGDYDVDGA S AL+ RFL +  V   +
Sbjct: 67  RTLMPDPKSFTDMQYAAERIVKAILKQEKVAVFGDYDVDGACSSALIARFLRYFGVEVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRIV+GYGPN   M   + +GA LIITVDCG+ S DA++ A   G DV+V+DHHQ+ 
Sbjct: 127 YIPDRIVEGYGPNEQAMRMLVQQGAHLIITVDCGANSPDAVKAARLAGADVVVLDHHQMS 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
                A ALVNPNR DD SGQGHLCAAGVVF+ L  ++ +LR+   V    DLLS+LDLV
Sbjct: 187 EVHQEAVALVNPNRPDDFSGQGHLCAAGVVFVTLAWVHHLLRKKKFVEELPDLLSMLDLV 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALAT+CDVVPL G+NRA+VVKGL VA    NPG+ AL +   I  P+ + +LG+++GP I
Sbjct: 247 ALATICDVVPLQGVNRAFVVKGLQVAHSMHNPGIAALTKVARIGEPLNSFHLGFLLGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG+  LG+RLL  +D  E + +A +L+ LNQ R+ ME+  L QAE+ + +   D 
Sbjct: 307 NAGGRIGDQALGARLLSCEDKGEADRIAEQLNQLNQERQEMEAIQLAQAESYIDSLYQDR 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           ++   +V+    WHPGI+GLLA+RLKE+F  P FAI+ +E+G GIGSGRSI G D+G +V
Sbjct: 367 EKPLSLVIAHQEWHPGIIGLLASRLKERFFCPVFAIALKENGSGIGSGRSISGIDLGALV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV   +L KGGGH+MAAG+T++         + ++     V  L       IDG L+A
Sbjct: 427 REAVTLNLLEKGGGHSMAAGITIQSTKIEIFRKWLEERVSLNVSQLHAEKSLNIDGCLSA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           S  N AL DM+E AGP+G+GN  PVF  P+H+L ++  V   HL+    + + + LQ IA
Sbjct: 487 SGANKALFDMIEKAGPFGSGNTTPVFVLPSHRLMNLCEVGKGHLRFIMSNMEGKKLQGIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           FR  GT LG FL  + G+ +HV G++ +NYW G+   QLRV+DA+ V
Sbjct: 547 FRAVGTSLGYFLSGNVGEMIHVAGNISLNYWNGNISPQLRVIDAAAV 593


>gi|121601735|ref|YP_989185.1| single-stranded-DNA-specific exonuclease RecJ [Bartonella
           bacilliformis KC583]
 gi|120613912|gb|ABM44513.1| single-stranded-DNA-specific exonuclease RecJ [Bartonella
           bacilliformis KC583]
          Length = 594

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 292/590 (49%), Positives = 391/590 (66%), Gaps = 6/590 (1%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           L V+ S  G  WV  L  +GIN+A AI+QK  +PD +ARVL  R+V       F+NP++R
Sbjct: 8   LDVKSSACGQAWVDSLDIQGINKARAISQKFGLPDQLARVLSARDVDESEVISFINPALR 67

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            LMP+P   TD   AA R+V+AI N E + IFGDYDVDGA S AL+ RF  +  +    Y
Sbjct: 68  TLMPNPEHFTDMQCAAERLVKAIMNQENVAIFGDYDVDGACSSALLARFFRYFGIETKTY 127

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRIV+GYGPN   M+  + EGA LIITVDCG+ S +A++ A   G DV+V+DHHQ+  
Sbjct: 128 IPDRIVEGYGPNAQAMKALVQEGASLIITVDCGANSPEAIKVARLLGADVVVLDHHQMGD 187

Query: 187 EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ---DNKVPLNFDLLSLLD 243
               A ALVNPNR DD S QGHLCAAGVVF+ L  +  +LR+   +  +P   DLL++LD
Sbjct: 188 LHQEAVALVNPNRPDDFSEQGHLCAAGVVFITLAWVNHLLREKKWEGDIP---DLLAMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALAT+CDVVPL G+NRA+VVKGL VAR   NPG+ AL +   I  P+ + +LG+++GP
Sbjct: 245 LVALATICDVVPLKGVNRAFVVKGLQVARSMHNPGIAALAKVARIGEPLNSFHLGFLLGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG+  LG+RLL  D+  E + +A +LD LNQ R+ MES  L QAEA + +   
Sbjct: 305 RINAGGRIGDQALGARLLSCDNRDEADRIAKQLDQLNQERQEMESVQLAQAEAYIHSIYQ 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           D +    IVV    WHPGIVG+LA+RLKE+F  P FAI+ + DGKGIGSGRSI+G D+G+
Sbjct: 365 DEEMPLSIVVAHQEWHPGIVGILASRLKERFFCPVFAIALKADGKGIGSGRSIDGIDLGE 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AV   +L KGGGH+MAAGLT++        ++ ++    +V  L       IDG +
Sbjct: 425 LVREAVSLNLLEKGGGHSMAAGLTIQSTKINAFQEWLKEKVSLMVSQLRAEQCLNIDGFI 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +AS  N  L DM+E AGP+G+GN  PVF  P+H+L ++  V   HL++T    + + LQ 
Sbjct: 485 SASGANKDLFDMIEKAGPFGSGNATPVFVLPSHRLVNLHEVGKGHLRLTVSDIEGKKLQG 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           IAFR   T LG+FL+++  K +H+ G+L +NYW G+   QLRV+DA+ V+
Sbjct: 545 IAFRAVETSLGDFLVKNIDKTIHLAGNLSLNYWNGTITPQLRVIDAAAVD 594


>gi|240850783|ref|YP_002972183.1| single-stranded-DNA-specific exonuclease [Bartonella grahamii
           as4aup]
 gi|240267906|gb|ACS51494.1| single-stranded-DNA-specific exonuclease [Bartonella grahamii
           as4aup]
          Length = 594

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 285/587 (48%), Positives = 386/587 (65%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL VE S  G  W+  L  +GIN A AI+QK   PD +ARVL  R+V    A  F+NP++
Sbjct: 7   FLNVESSACGQAWLDALDVQGINNARAISQKFGFPDQLARVLSARDVDEAEAVAFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP    D   AA RIV+A+ N E++ +FGDYDVDGA S AL+ RF  +  +   +
Sbjct: 67  RTLMPDPESFRDMQCAAERIVKALLNQEQVAVFGDYDVDGACSSALIARFFRYFGIEVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI++GYGPN   M   + EGA+LIITVDCG+ S DA++ A   G DV+++DHHQ+ 
Sbjct: 127 YIPDRIIEGYGPNEQAMRMLVQEGARLIITVDCGANSPDAVKAARLAGADVVILDHHQMS 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
                A ALVNPNR DD S QGHLCAAGVVF+ L  ++ +LR+        DLLS+LDLV
Sbjct: 187 EIHQEAIALVNPNRPDDFSKQGHLCAAGVVFVTLAWVHHLLRKKQFQGQLPDLLSMLDLV 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALAT+CDVVPL G+NRA+V+KGL VAR   NPG+ AL +   I  P+ + + G+++GP I
Sbjct: 247 ALATICDVVPLQGVNRAFVIKGLQVARSMHNPGITALTKVARIGEPLNSFHFGFLLGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG+  LG+RLL  ++  E + +A +LD LNQ R+ ME+  L QAE+ + +   D 
Sbjct: 307 NAGGRIGDQALGARLLSCENKDEADRIAEQLDRLNQERQEMENIQLAQAESYIASLYQDQ 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           +    +V+    WHPGI+G+LA+RLKE+F  P FAI+ +EDG G+GSGRSI G D+G +V
Sbjct: 367 EIPLSLVISHKEWHPGIIGILASRLKERFFCPVFAIALKEDGNGVGSGRSINGIDLGALV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV   +L KGGGH+MAAG+T++         + ++     V  L       IDG L+A
Sbjct: 427 REAVTLNLLEKGGGHSMAAGITIQSTKIEIFRKWLEEKVSLRVSELHAKKSLSIDGSLSA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           S VN AL ++LE AGP+G GN  PVF  P+H+L ++  V   HL++   + + + LQ IA
Sbjct: 487 SGVNEALFELLEKAGPFGTGNATPVFVLPSHRLVNLSEVGKGHLRLIVSNVEGKKLQGIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           FR  GT LG+FL ++ G+ +H+ GHL +NYW G+   QLRV+DA+ V
Sbjct: 547 FRAVGTSLGDFLFENIGEMIHLAGHLSLNYWNGTTNPQLRVIDAAAV 593


>gi|319898876|ref|YP_004158969.1| single-stranded-DNA-specific exonuclease [Bartonella clarridgeiae
           73]
 gi|319402840|emb|CBI76391.1| single-stranded-DNA-specific exonuclease [Bartonella clarridgeiae
           73]
          Length = 594

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 291/587 (49%), Positives = 388/587 (66%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
            L VE S  G  WV  L  E +N A AI+QK  +PD +ARVL  R+V    A  F+NP++
Sbjct: 7   LLNVESSAWGQAWVDALDIERVNNARAISQKFGLPDQLARVLAARDVDESEAITFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R+LMP+P    D   AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL +  +   +
Sbjct: 67  RVLMPNPKDFIDMHCAAERLVKAIINREKIAVFGDYDVDGACSAALLARFLHYFGIIVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI++GYGPN   M+  + EGA LIITVDCG+ S DAL+ A   G DVIV+DHHQ++
Sbjct: 127 YIPDRIIEGYGPNEQAMKGLVQEGASLIITVDCGANSPDALRAAKFAGADVIVLDHHQME 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
           +    A ALVNPNR DDLS QGHLCAAGVVF+ L+ + R+LR+        DLLS+LDLV
Sbjct: 187 NVHEEAVALVNPNRPDDLSEQGHLCAAGVVFITLIWVNRLLREKKWGGALPDLLSMLDLV 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALAT+CD+VPL G+NRA+VVKGL VAR   NPG+ AL +  +I  P+ + +LG+++GP I
Sbjct: 247 ALATICDIVPLKGVNRAFVVKGLQVARSMRNPGIAALAKVAHIGEPLNSFHLGFLLGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG   LG+ LL  +D  E + +A +LD LN+ R+ ME   L QAE  + +   D 
Sbjct: 307 NAGGRIGNQALGAYLLSCNDRDEADRIAQQLDQLNKERQEMEMIQLAQAEVYIDSIYQDE 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
              S  V+    WHPGI+G+LAARLKE+F  P  AI+ +EDG GIGSGRSI G D+G +V
Sbjct: 367 AMPSSFVIAHKEWHPGIIGILAARLKERFFCPVLAIALKEDGSGIGSGRSISGIDLGALV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV   +L KGGGH+MAAG T++        ++ ++    +V  L       IDG L+A
Sbjct: 427 HEAVTLNLLEKGGGHSMAAGFTIQSTKIEAFREWLEEKVSLMVSQLRAEKSLSIDGFLSA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           S  N  L DM+E AGP+G+GN  PVF FP+H+L ++  V   HL++     + + L+ IA
Sbjct: 487 SGANKDLFDMIEKAGPFGSGNATPVFVFPSHRLVNLYEVGKGHLRLIISDIEGKKLKGIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           F   GT LG+FL ++ GK++H+ G+L +N+WRGS   QLRV+DA+ +
Sbjct: 547 FGAVGTSLGKFLSKNIGKKIHLAGNLSLNHWRGSISPQLRVIDAAAL 593


>gi|13471056|ref|NP_102625.1| single-strand DNA-specific exonuclease [Mesorhizobium loti
           MAFF303099]
 gi|14021800|dbj|BAB48411.1| single-strand DNA-specific exonuclease [Mesorhizobium loti
           MAFF303099]
          Length = 592

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 306/587 (52%), Positives = 384/587 (65%), Gaps = 5/587 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL +  S +G  W   L +     ALAI Q H +PDIVARVL  R V+ D  + FL P+I
Sbjct: 7   FLDIRQSATGLSWEHRLTERQDMVALAIAQGHGVPDIVARVLAGRGVTADETERFLEPTI 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R L+P+P  LTD DKAA RI  A+   EK+ IFGDYDVDGAAS AL+ RFL+H S+ + +
Sbjct: 67  RDLLPNPASLTDMDKAATRIAAAVMAREKVAIFGDYDVDGAASSALLKRFLAHFSIPSEI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M + ++ GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 127 YIPDRIFEGYGPNPDAMRELVSRGATLIVTVDCGTNSAISVDAANEAGADVVVLDHHQVG 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR--QDNKVPLNFDLLSLLD 243
                A A+VNPNR DDLSGQGHLCAAGVVFL LV   +ILR   D   P     LSLLD
Sbjct: 187 GALPAAIAVVNPNRDDDLSGQGHLCAAGVVFLALVQTAKILRGLSDVAPPDL---LSLLD 243

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL +AR+Q N GL AL     I  PI+  +L Y+IGP
Sbjct: 244 LVALATVCDVVPLTGVNRAFVVKGLQMARQQKNEGLAALARVSRIGEPISTFHLAYLIGP 303

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LGSRLL +DD  E   +A  LD LNQ R+LME  ML  A A+   +  
Sbjct: 304 RINAGGRIGDAALGSRLLATDDPVEARTIAETLDRLNQERQLMEQEMLAAARAEADAELA 363

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
                +++V   + WHPGIVGLLA+RLK+   RP+FAI+F   G G GSGRS+ GFD+G+
Sbjct: 364 GGSGPAIVVTASNNWHPGIVGLLASRLKDHARRPAFAIAFNAVGIGTGSGRSVSGFDLGR 423

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  A + G++VKGGGH MAAG+TVER   G L  FF++ A   V  L       IDG L
Sbjct: 424 LVREAADAGLIVKGGGHGMAAGITVERARLGELRAFFEERAAADVFRLQDEESLAIDGAL 483

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            A    ++L+D LE AGP+GAG+  PVF  P H+L   R V   H++   +S     + A
Sbjct: 484 AAEGATLSLLDALEKAGPFGAGHVAPVFVLPRHRLADARPVGTNHIRCELQSDAGGRIPA 543

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR   T LGEFL ++RGK +HV G L  NYW G++  Q R++DA+
Sbjct: 544 IAFRAVDTVLGEFLFKNRGKSVHVAGSLSGNYWNGNRTVQFRIVDAA 590


>gi|163868609|ref|YP_001609818.1| single-stranded-DNA-specific exonuclease [Bartonella tribocorum CIP
           105476]
 gi|161018265|emb|CAK01823.1| single-stranded-DNA-specific exonuclease [Bartonella tribocorum CIP
           105476]
          Length = 594

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 287/592 (48%), Positives = 393/592 (66%), Gaps = 10/592 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL VE S  G  W+  L  +GIN A AI+QK   PD +ARVL  R V    A  F++P++
Sbjct: 7   FLNVESSACGQAWLDALDVQGINNARAISQKFGFPDQLARVLSARGVDETEAVAFIDPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R+LMPDP    D   AA RIV+A+ N E++ +FGDYDVDGA + AL+ RF  +  +   +
Sbjct: 67  RMLMPDPESFRDMQCAAERIVKALLNQEQVAVFGDYDVDGACASALIARFFRYFGIEVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRIV+GYGPN   M   + EGA+LIITVDCG+ S DA++ A   G DV+++DHHQ+ 
Sbjct: 127 YIPDRIVEGYGPNEQAMRMLVQEGARLIITVDCGANSPDAVKAARLAGADVVILDHHQMS 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLLDL 244
                A ALVNPNR DD S QG+LCAAGVVF+ L  ++ +LR+   + PL  DLLS+LDL
Sbjct: 187 EIHQEAIALVNPNRPDDFSEQGYLCAAGVVFVTLAWVHHLLRKKQFEGPLP-DLLSMLDL 245

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALAT+CDVVPL G+NRA+VVKGL VAR   N G+ AL +   I  P+ + +LG+++GP 
Sbjct: 246 VALATICDVVPLQGVNRAFVVKGLHVARSMHNLGIAALTKVARIGEPLNSFHLGFLLGPR 305

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG+  LG+RLL  ++  E + +A +LD LNQ R+ ME   L QAE+ + +   D
Sbjct: 306 INAGGRIGDQALGARLLSCENKDEADRIAEQLDQLNQERQEMEKIQLAQAESYIASLYQD 365

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
            +    +V+    WHPGI+G+LA+RLKE+F  P FAI+ +EDG G+GSGRSI G D+G +
Sbjct: 366 QEPPLSLVISHQEWHPGIIGILASRLKERFFCPVFAIALKEDGNGVGSGRSIHGIDLGAL 425

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALIT----TPVFKID 480
           V  AV   +L KGGGH+MAAG+T++        +FF+K+    V  +++        +ID
Sbjct: 426 VREAVTLNLLEKGGGHSMAAGITIQSTKI----EFFRKWLEEKVSVMVSQLHAKKSLRID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L+AS  N AL ++LE AGP+G GN  PVF  P+H+L ++  V   HL++   + + + 
Sbjct: 482 GSLSASGANQALFELLEKAGPFGTGNATPVFVLPSHRLMNLSEVGKGHLRLIISNGEGKK 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           LQ IAFR  GT LG+FL ++ G+ +H+ GHL +NYW G+   QLRV+DA+ V
Sbjct: 542 LQGIAFRAVGTALGDFLSRNIGEMIHLAGHLSLNYWNGTINPQLRVIDAAAV 593


>gi|304391919|ref|ZP_07373861.1| single-stranded-DNA-specific exonuclease RecJ [Ahrensia sp. R2A130]
 gi|303296148|gb|EFL90506.1| single-stranded-DNA-specific exonuclease RecJ [Ahrensia sp. R2A130]
          Length = 597

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 292/591 (49%), Positives = 396/591 (67%), Gaps = 4/591 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           D+ FL VE SISG RW   + +    +A A+ ++H+IP++VARVL  R+V+ D A  FL+
Sbjct: 5   DRPFLDVESSISGQRWEERMSRTQAGQAEAMRERHSIPELVARVLAARDVTADEALGFLD 64

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R LMPDP +LT  D AA R+V AI   E + +FGDYDVDGA S AL+  FL +  V 
Sbjct: 65  PKLRDLMPDPSLLTGMDAAADRLVSAIAAKEPVAVFGDYDVDGATSSALLAAFLRNFDVP 124

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +YIPDRI +GYGPN + + +    GA+L++TVDCGSTS+DAL  A + G+D +V+DHH
Sbjct: 125 VEIYIPDRIFEGYGPNENAIRELAERGAKLLVTVDCGSTSHDALAVAKSLGLDAVVLDHH 184

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLS 240
           QV  E     ALVNPNR DDLSGQGHLCAAGVVFL LV   R +RQ  K+P +   DL+ 
Sbjct: 185 QVGDELPDVIALVNPNRQDDLSGQGHLCAAGVVFLTLVATQRAMRQQGKLPTDKPVDLMQ 244

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVAL TVCDVVPL GLNRA+V +G+ V ++Q N GL AL        P    +LG++
Sbjct: 245 SLDLVALGTVCDVVPLKGLNRAFVTRGIEVMQKQRNVGLAALARVARQDGPAAPWHLGFV 304

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG++ LG+RLL + D  E E +A +LD LN  R+ +E+AML QA  +   
Sbjct: 305 LGPRINAGGRIGDAALGARLLTTSDPTEAEEIAQQLDTLNGERQNIETAMLAQAIDEAEA 364

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +    +  SV+V E D WH G+VGLLA+RLK++F RP+FAI+F+  G+G GSGRSI G D
Sbjct: 365 EIGFSEGPSVLVTESDTWHAGVVGLLASRLKDRFNRPTFAIAFDGRGRGQGSGRSIPGCD 424

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKI 479
           +G+ V  AV+EG+L+KGGGHAMAAG+T+ER   G    F  ++   ++  A ++  V +I
Sbjct: 425 LGRTVRAAVDEGLLLKGGGHAMAAGITIERDKLGDFRAFMEERLCDDVATARLSRSV-RI 483

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG L+A    + + D L +AGP+GAG+  P+ AFP H L+   VV   H++ +  S D  
Sbjct: 484 DGALSARGATVEMFDQLAAAGPFGAGHSQPLLAFPRHTLRFSDVVGKGHVRFSIGSADGA 543

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            L+ I+FR   TPLG+ L+  RGK MH  G L  +++RG++R QLR++D +
Sbjct: 544 ELRGISFRAVDTPLGDALLDGRGKVMHFAGTLSADFFRGTRRVQLRLVDVA 594


>gi|319405639|emb|CBI79262.1| single-stranded-DNA-specific exonuclease [Bartonella sp. AR 15-3]
          Length = 594

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 291/587 (49%), Positives = 387/587 (65%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
            L V+ S     WV  L  + IN A AI+QK  +PD +ARVL  R+V    A  F+NP++
Sbjct: 7   LLNVQSSACDQAWVDALDMDRINNARAISQKFGLPDQLARVLAARDVDEAEAVAFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R+LMPDP  +TD D AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL    +   +
Sbjct: 67  RILMPDPKKITDVDCAAERLVKAIINQEKIAVFGDYDVDGACSAALLARFLHCFGIIVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI++GYGPN   M   + EGA LIITVDCG+ S DA++ A   G DVIV+DHHQ++
Sbjct: 127 YIPDRIIEGYGPNEQAMRGLVQEGASLIITVDCGANSPDAIRAARLAGADVIVLDHHQME 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
           +    A ALVNPNR DD S QGHLCAAGVVF+ L+ + R+LR+        DLLS+LDLV
Sbjct: 187 NIHEEAVALVNPNRPDDFSEQGHLCAAGVVFITLMWVNRLLRKKKWGGALPDLLSMLDLV 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALAT+CDVVPL G+NRA+V KGL VAR   NPG+ AL +  +I  P+ + +LG+++GP I
Sbjct: 247 ALATICDVVPLQGVNRAFVNKGLQVARSMYNPGIAALAKVAHIGEPLNSFHLGFLLGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG   LG+ LL  +D  E + +A +LD LN+ R+ ME   L QAE+ + +   + 
Sbjct: 307 NAGGRIGNQALGAYLLSCNDRDEADRIAQELDRLNKERQEMEMIQLAQAESYLDSIYQEK 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
              S  V+    WHPGI+G+LAARLKE+F  P   I+ +EDG GIGSGRSI G ++G +V
Sbjct: 367 TIPSPFVIAHKEWHPGIIGILAARLKERFFCPVLVIALKEDGSGIGSGRSISGINLGALV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV   +L KGGGH+MAAG T++        ++ ++    +V  L       IDG L+A
Sbjct: 427 REAVTLNLLEKGGGHSMAAGFTIQSTKIEAFREWLEEKVSLMVSQLRAKKSLSIDGFLSA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           S  N  L DM+E AGP+G+GN  PVFAFP+H+L  +  V   HL++   + + E LQ IA
Sbjct: 487 SGANKDLFDMIEKAGPFGSGNAIPVFAFPSHRLVKLYEVGKGHLRLIISNIEGEKLQGIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           F   GTPLG+FL ++ GK +H+ G+L +N+WRG+   QLRV+DA+ V
Sbjct: 547 FGAVGTPLGQFLFENIGKTIHLAGNLSLNHWRGNISPQLRVIDAAAV 593


>gi|319408572|emb|CBI82225.1| single-stranded-DNA-specific exonuclease [Bartonella
           schoenbuchensis R1]
          Length = 593

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 291/586 (49%), Positives = 382/586 (65%), Gaps = 1/586 (0%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           L V+ S     WV  L  +GIN A AI+QK   PD +ARVL  RNV    A  F+NP++R
Sbjct: 8   LNVKSSACDQAWVDPLDIQGINNARAISQKFGFPDQLARVLAARNVDESEAVSFINPTLR 67

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            L+P+P   TD   AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL +  +   +Y
Sbjct: 68  NLLPNPESFTDMQCAAERLVKAIMNREKIAVFGDYDVDGACSSALLARFLRYFGITVKIY 127

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRIV+GYGPN   M+    EGA LIITVDCG+ S DA++ A   G DV+V+DHHQ+  
Sbjct: 128 IPDRIVEGYGPNEQAMKMLAQEGASLIITVDCGANSPDAIKAARFAGADVVVLDHHQMSD 187

Query: 187 EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVA 246
               A ALVNPNR DD S QGHLCAAG+VF+ LV +  +LR+        DLLS+LDLVA
Sbjct: 188 VHQEAVALVNPNRPDDFSEQGHLCAAGIVFVTLVWVNHLLRKQKWTETVPDLLSMLDLVA 247

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           LATVCDVVPL G+NRA+VVKGL VAR   N G+ AL +   I  PI + +LG+++GP IN
Sbjct: 248 LATVCDVVPLRGVNRAFVVKGLQVARSMHNAGIAALAKVARIGEPINSFHLGFLLGPRIN 307

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGRIG+  LG+RLL  D+  E + +A +L+ LNQ R+ ME+  L QAEA + +   D +
Sbjct: 308 AGGRIGDQALGARLLSCDNRDEADKMAEQLNKLNQERQEMEAIQLAQAEAYIDSVHHD-K 366

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
           + S +VV    WHPGIVG+LA+RLKE+F  P F I+ + DG G GSGRSI G D+G +V 
Sbjct: 367 EMSSLVVACQEWHPGIVGILASRLKERFFCPVFVIALKADGSGTGSGRSISGVDLGALVH 426

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            AV   +L KGGGH+MAAG+T++        ++ ++    +V  L       IDG L+AS
Sbjct: 427 EAVTLNLLEKGGGHSMAAGITIQSTKVEAFREWLEEKVSLVVSQLRAKKSLSIDGFLSAS 486

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAF 546
             N  L DM+E AGP+G+ N  PVF  P+H+L S+  V   HL++     + + LQ IAF
Sbjct: 487 GANKDLFDMIEKAGPFGSENATPVFVLPSHRLVSVCEVGKGHLRLFVSDLEGKKLQGIAF 546

Query: 547 RVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
              GT LG FL ++ G+ +HV G+L +NYW G+ + QLRV+DA+ V
Sbjct: 547 HAVGTSLGNFLSENVGETIHVAGNLSLNYWNGTIKPQLRVIDAATV 592


>gi|319404201|emb|CBI77794.1| single-stranded-DNA-specific exonuclease [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 594

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 289/587 (49%), Positives = 385/587 (65%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
            L ++ S     W+  L  +  N A AI+QK  +PD +ARVL  RNV    A  F+NP++
Sbjct: 7   LLNIQSSACNQAWIDALDMDRTNNARAISQKFGLPDQLARVLAARNVDESEAVVFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMP+P   TD D AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL    +   +
Sbjct: 67  RALMPNPKKFTDMDCAAERLVRAIINQEKITVFGDYDVDGACSAALLARFLHCFGIIVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI++GYGPN   M+  + EGA LIITVDCG+ S +A++ A   G DVIV+DHHQ++
Sbjct: 127 YIPDRIIEGYGPNEQAMKGLVQEGASLIITVDCGANSPNAIRAARLAGADVIVLDHHQME 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
           +    A ALVNPNR DD S QGHLCAAGVVF+ L+ + R+LR+        DLLS+LDLV
Sbjct: 187 NIHEEAVALVNPNRPDDFSEQGHLCAAGVVFITLMWVNRLLREKKWKGALPDLLSMLDLV 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALAT+CDVVPL G+NRA+VVKGL VAR   NPG+ AL +   I  P+ + +LG+++GP I
Sbjct: 247 ALATICDVVPLQGVNRAFVVKGLQVARSMHNPGIAALAKVARIGEPLNSFHLGFLLGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG   LG+ LL  +D  E + +A +LD LN+ R+ ME + L QAEA + +   + 
Sbjct: 307 NAGGRIGNQALGAYLLSCNDRDEADRIAQQLDQLNKERQEMEISQLAQAEAYIDSIYQER 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
              S  V+    WHPGI+G+LAARLKE+F  P   I+ +EDG GIGSGRSI G D+G +V
Sbjct: 367 TIPSSFVIAHKGWHPGIIGILAARLKERFFCPVLIIALKEDGSGIGSGRSISGIDLGALV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV   +L KGGGH+MAAG T++        ++ ++    IV  L       IDG L+A
Sbjct: 427 HEAVALNLLEKGGGHSMAAGFTIQSDKIEAFREWLEEKISLIVSQLRAEKSLNIDGFLSA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           S  N  L DM+E AGP+G+GN  PVF FP+H+L ++  V   HL++   + + E LQ IA
Sbjct: 487 SGANKDLFDMIEKAGPFGSGNATPVFVFPSHRLVNLYEVGKGHLRLIISNIEGEKLQGIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           F   GT LG+FL ++ GK +H+ G+L +N+WRG+   QLRV+DA+ V
Sbjct: 547 FGAVGTALGKFLSENIGKTIHLAGNLSLNHWRGNISPQLRVIDAAAV 593


>gi|319407211|emb|CBI80850.1| single-stranded-DNA-specific exonuclease [Bartonella sp. 1-1C]
          Length = 594

 Score =  558 bits (1438), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 289/587 (49%), Positives = 386/587 (65%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
            L ++ S     W+  L  +  N A AI+QK  +P+ +ARVL  RNV    A  F+NP++
Sbjct: 7   LLNIQSSACNQVWIDALDIDRTNNARAISQKFGLPEQLARVLAARNVDESEAMVFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R+LMP+P   TD D AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL    +   +
Sbjct: 67  RVLMPNPKKFTDMDCAAERLVKAIINQEKIAVFGDYDVDGACSAALLARFLHCFGIIVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI++GYGPN   M+  + EGA LIITVDCG+ S +A++ A   G DVIV+DHHQ++
Sbjct: 127 YIPDRIIEGYGPNEQAMKGLVQEGASLIITVDCGANSPNAIRAARLAGADVIVLDHHQME 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
           +    A ALVNPNR DD S QGHLCAAGVVF+ L+ + R+LR+        DLLS+LDLV
Sbjct: 187 NIHEEAVALVNPNRPDDFSEQGHLCAAGVVFITLMWVNRLLREKKWKGALPDLLSMLDLV 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALAT+CDVVPL G+NRA+VVKGL VAR   NPG+ AL +   I  P+ + +LG+++GP I
Sbjct: 247 ALATICDVVPLQGVNRAFVVKGLQVARSMHNPGIAALAKVARIGEPLNSFHLGFLLGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG   LG+ LL  +D  E + +A +LD LN+ R+ ME + L QAEA + +   + 
Sbjct: 307 NAGGRIGNQALGAYLLSCNDRDEADRIAQQLDQLNKERQEMEISQLAQAEAYIDSIYQER 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
              S  V+    WHPGI+G+LAARLKE+F  P   I+ +EDG GIGSGRSI G D+G +V
Sbjct: 367 TIPSSFVIAHKGWHPGIIGILAARLKERFFCPVLIIALKEDGSGIGSGRSISGIDLGALV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV   +L KGGGH+MAAG T++        ++ ++    IV  L       IDG L+A
Sbjct: 427 HEAVTLNLLEKGGGHSMAAGFTIQSDKIEAFREWLEEKISLIVSQLRAEKSLSIDGFLSA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           S  N  L DM+E AGP+G+GN  PVF FP+H+L ++  V   HL++   + + E LQ IA
Sbjct: 487 SGANKDLFDMIEKAGPFGSGNATPVFVFPSHRLVNLYEVGKGHLRLIISNIEGEKLQGIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           F   GT LG+FL ++ GK +H+ G+L +N+WRGS   QLRV+DA+ V
Sbjct: 547 FGAVGTTLGKFLSENIGKTIHLAGNLSLNHWRGSISPQLRVIDAAAV 593


>gi|260459842|ref|ZP_05808096.1| single-stranded-DNA-specific exonuclease RecJ [Mesorhizobium
           opportunistum WSM2075]
 gi|259034644|gb|EEW35901.1| single-stranded-DNA-specific exonuclease RecJ [Mesorhizobium
           opportunistum WSM2075]
          Length = 593

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 304/585 (51%), Positives = 379/585 (64%), Gaps = 1/585 (0%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V  S +G  W   L +     ALAI Q H +PDIVARVL  R V+ D  + FL+P+I
Sbjct: 8   FLDVRQSATGLAWEHRLTERQDMIALAIAQGHGVPDIVARVLAGRGVTADETERFLDPTI 67

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R L+PDP  LTD D+AA RI  A+   EK+ IFGDYDVDGAAS AL+ RFL+H SV + +
Sbjct: 68  RDLLPDPASLTDMDRAAARIAAAVMAKEKVAIFGDYDVDGAASSALLKRFLTHFSVPSEI 127

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI +GYGPNP  M + ++ GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV 
Sbjct: 128 YIPDRIFEGYGPNPDAMRELVSRGATLIVTVDCGTNSAVSVDAANAAGADVVVLDHHQVG 187

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
                A A+VNPNR DDLSGQGHLCAAGVVFL LV   R+LR     P    L  L  L 
Sbjct: 188 GALPAAIAVVNPNRDDDLSGQGHLCAAGVVFLALVQTARVLRGLTDAPPPDLLSLLD-LA 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALATVCDVVPL G+NRA+VVKGL VAR+Q N GL AL     I  PI+  +L Y+IGP I
Sbjct: 247 ALATVCDVVPLTGVNRAFVVKGLQVARQQKNEGLAALARVSRIGEPISTFHLAYLIGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG++ LGSRLL +DD  E   +A  LD LNQ R+LME  ML  A A+   +    
Sbjct: 307 NAGGRIGDAALGSRLLATDDPVEARTIAETLDRLNQERQLMEQEMLAAARAEADAELAGG 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
              +++V   + WHPGIVGLLA+RLK+   RP+FAI+F   G G GSGRS+ GFD+G++V
Sbjct: 367 SGPAIVVTASNNWHPGIVGLLASRLKDHARRPAFAIAFNAVGIGTGSGRSVSGFDLGRLV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A   G++VKGGGH MAAG+TVER   G L  FF++ A   V  L       IDG L A
Sbjct: 427 REAATAGLIVKGGGHGMAAGITVERARLGELRAFFEERAAADVFRLQDEESLAIDGALAA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
               + L+D LE AGP+GAG+  PVF  P H+L   R V   H++   +S     +QAIA
Sbjct: 487 EGATLGLLDALEKAGPFGAGHVAPVFVLPRHRLADARSVGTNHIRCELQSDSGGRIQAIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           FR   T LGEFL ++RGK +HV G L  N+W G++  Q R++DA+
Sbjct: 547 FRAVDTVLGEFLFKNRGKTVHVAGSLSGNHWNGNRTVQFRIIDAA 591


>gi|300023047|ref|YP_003755658.1| single-stranded-DNA-specific exonuclease RecJ [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524868|gb|ADJ23337.1| single-stranded-DNA-specific exonuclease RecJ [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 616

 Score =  543 bits (1398), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 287/595 (48%), Positives = 377/595 (63%), Gaps = 12/595 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S  GF+W   L  E  + A AI Q H +P+++ R+L  RNV +D    FL+P+
Sbjct: 19  AFLGVRSSARGFQWRERLRPELKSLATAIGQHHGLPEMIGRILAARNVGLDAVPGFLDPT 78

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ LMPDP +L D DKAA R+  AI   +++ IFGDYDVDGA S AL+ RFLSH  V + 
Sbjct: 79  LKSLMPDPSVLRDMDKAAARLADAIEGKQRVAIFGDYDVDGACSSALLHRFLSHHDVPSR 138

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDR+ +GYGPN   +E  +NEGA+LI+TVDCG+TS++ L  A   G DV+V+DHHQ 
Sbjct: 139 IYIPDRLFEGYGPNVGAIETLVNEGAKLIVTVDCGTTSFEPLAAARKLGADVVVVDHHQA 198

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-----KVPLNFDLL 239
                   A+VNPNR DD+SGQG LCAAGVVFLVLV + R LR+       + P   DLL
Sbjct: 199 DERLPDVEAVVNPNRQDDISGQGMLCAAGVVFLVLVAVMRELRRRGFYTSVREP---DLL 255

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           + LDLVALATV DVVPL+ LNRAYV KGL V R + N GL AL +   +++P T  +LG+
Sbjct: 256 ASLDLVALATVADVVPLVALNRAYVKKGLAVMRARENVGLTALADVAGLTTPPTPYHLGF 315

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIG + LG+ LL + D+ E + +A  L+ LN+ RR +E+ MLE+A A   
Sbjct: 316 ILGPRINAGGRIGNAALGATLLSTSDTVEAQKIAELLNRLNKERRDVEAIMLEEALAIAD 375

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDG----KGIGSGRS 415
            Q  D    ++++V  + WH GIVGL+A+RL E+F RP+  I++E +     +G GS RS
Sbjct: 376 QQVADDPARAMVIVASETWHKGIVGLVASRLVERFRRPACVIAWEAEASRPNEGTGSLRS 435

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           I G D+G  V  AV  G+LVKGGGHAMAAGLTV R N   L   FQ              
Sbjct: 436 IPGVDLGAAVRAAVSAGLLVKGGGHAMAAGLTVGRNNLAALEAHFQTQLRTATVTANEAA 495

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              ID  L AS     L+DM+E   P+G GNP+P F FP H+++  +VV  AH ++  E 
Sbjct: 496 GLDIDAALVASGATTELMDMIERVSPFGQGNPDPRFVFPAHRVKFAKVVGDAHARVLIEG 555

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            D   L AIAFR  G PLG+ LM   G  +HV GHL  + W G  R +L++ DA+
Sbjct: 556 GDGARLDAIAFRAAGQPLGDLLMSGGGMPLHVAGHLRRDTWGGRDRVELQIEDAA 610


>gi|118588879|ref|ZP_01546286.1| single-stranded-DNA-specific exonuclease [Stappia aggregata IAM
           12614]
 gi|118438208|gb|EAV44842.1| single-stranded-DNA-specific exonuclease [Stappia aggregata IAM
           12614]
          Length = 605

 Score =  539 bits (1388), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 290/592 (48%), Positives = 382/592 (64%), Gaps = 15/592 (2%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           LGV  S +   W   L    +  A+AI+Q H +PD++ARV+  R V  D A  FL+PS++
Sbjct: 14  LGVARSANDNAWRERLSAADLRTAMAISQVHGLPDVLARVMAARGVLADEATGFLDPSLK 73

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
           LLMPDP  L D D A  R+  A+    KI IFGDYDVDGA S A+  ++L    ++  ++
Sbjct: 74  LLMPDPSSLVDMDAAVARVADAVQAGRKIAIFGDYDVDGATSSAIFAKYLQWLGLDPVIH 133

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRI++GYGPN   +E     GA L++T+DCGSTS++A + A    +DV+VIDHHQV  
Sbjct: 134 IPDRIIEGYGPNGPAIEHLRQGGADLLVTLDCGSTSFEAFETARQLDLDVVVIDHHQV-G 192

Query: 187 EEIPAY-ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-----QDNKVPLNFDLLS 240
           E +PA  ALVNPNR DDLSGQGHL A GV FL LV + R LR     Q  + P   DL++
Sbjct: 193 ETLPAVEALVNPNRQDDLSGQGHLAAVGVTFLFLVGLNRELRRRGVFQGAQQP---DLMA 249

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVAL TVCDVVPL GLNRAYV +GL V  ++ N GL AL +   +S      +LG++
Sbjct: 250 LLDLVALGTVCDVVPLQGLNRAYVTRGLAVMHQRRNYGLTALADTARVSGKPAPYHLGFL 309

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQ--AEAKV 358
           IGP INAGGRIG++ LG+RLL ++D  E   +A +LD LN  R+ ME+ MLEQ  AEA++
Sbjct: 310 IGPRINAGGRIGDAALGARLLTTEDPHEARAIAERLDQLNTERQAMEAVMLEQADAEAEM 369

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
             Q  D    +V++   D WHPGIVGL+A+RLKE + RPSFAI+F+E GKG GSGRSI G
Sbjct: 370 AIQARD---PAVLLTGSDDWHPGIVGLIASRLKEAYRRPSFAIAFDETGKGTGSGRSIPG 426

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+GK V  AV+ G+L KGGGHAMAAGLTV       L  +F     + V         K
Sbjct: 427 VDLGKAVRGAVDLGLLEKGGGHAMAAGLTVLSEKRADLEAYFNDVLKDDVETASANRELK 486

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           ID  L A+  N+ L+++LE AGPYGAG+  PVFAFP H++    VV   H++ +  S D 
Sbjct: 487 IDAALTATGANLDLLELLEKAGPYGAGHAEPVFAFPAHRISFADVVGKGHVRASITSGDG 546

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             L+AI F+    P G+ L+Q RG+ +HV G L ++ W+G+ + QLR+LD +
Sbjct: 547 TALKAICFKADDKPHGQMLLQGRGQSLHVAGTLSIDTWQGTPKVQLRILDVA 598


>gi|307946821|ref|ZP_07662156.1| single-stranded-DNA-specific exonuclease RecJ [Roseibium sp.
           TrichSKD4]
 gi|307770485|gb|EFO29711.1| single-stranded-DNA-specific exonuclease RecJ [Roseibium sp.
           TrichSKD4]
          Length = 606

 Score =  531 bits (1368), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 282/586 (48%), Positives = 385/586 (65%), Gaps = 3/586 (0%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           LGV+ S +   W   L ++    A+AI+Q+  +PD++ARV+  R V  + A+ FL PSI+
Sbjct: 15  LGVQKSFNQNAWRDRLSEDEQRHAMAISQRLGVPDVLARVMAARGVLPESAEAFLAPSIK 74

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            LMPDP  L D D A  R+  AI + + I IFGDYDVDGA S A++ R+L    ++  ++
Sbjct: 75  TLMPDPSNLVDMDSAVSRVADAIQSGKNIAIFGDYDVDGATSSAVLARYLRWTGIDPVIH 134

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRI++GYGPN   +E     GA L++TVDCGSTS+DA + A + G++V+VIDHHQV  
Sbjct: 135 IPDRIIEGYGPNGPALEHLKAGGADLLVTVDCGSTSFDAFEVARSVGLNVVVIDHHQVGE 194

Query: 187 EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLSLLDL 244
                 ALVNPNR DDLSGQ HL A GV FL +V + R LRQ          DLL+LLDL
Sbjct: 195 TLPKVAALVNPNRQDDLSGQEHLAAVGVTFLFVVGLNRELRQRGFFNGKAAPDLLALLDL 254

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VAL TVCDVVPL GLNRAYV++GL V  ++ NPGL  L++   +   +   +LG+++GP 
Sbjct: 255 VALGTVCDVVPLKGLNRAYVMRGLEVMHQRRNPGLAFLVDVARVVGKVAPYHLGFLLGPR 314

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG++ LG+RLL S+D      +A +LD LN  R+ ME+ MLEQA+A+  T   +
Sbjct: 315 INAGGRIGDAALGARLLTSEDHVTAREIAARLDELNTERQAMEAVMLEQADAQA-TLAIE 373

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
            +  +V++   D WHPGIVGL+A+RLK+   RPSFAI+++E GKG GSGRSI G D+GK+
Sbjct: 374 AKDPAVLLTGSDDWHPGIVGLIASRLKDAHRRPSFAIAYDETGKGTGSGRSIPGVDLGKV 433

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           V  AV+EG+L KGGGHAMAAGLTV +     L ++F       V     +   KIDG L 
Sbjct: 434 VRKAVDEGLLEKGGGHAMAAGLTVLKDKVEALTEYFDTHLRADVEQTNASRDLKIDGALT 493

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
           A+  N+ L++MLE AGPYGAG+  PVF FP H++    VV   H++ +  S D   ++AI
Sbjct: 494 ATGANLDLMNMLEKAGPYGAGHSEPVFVFPTHRVSFADVVGKGHVRASLASSDGAKIKAI 553

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +F+    P G+ L++ RG+ +HV G L V+ W+G+ R QLR+LD +
Sbjct: 554 SFKAEDKPHGKALLEKRGQSVHVAGSLSVDTWQGTPRVQLRILDVA 599


>gi|90419170|ref|ZP_01227080.1| single-stranded-DNA-specific exonuclease recJ [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336107|gb|EAS49848.1| single-stranded-DNA-specific exonuclease recJ [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 597

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 282/589 (47%), Positives = 390/589 (66%), Gaps = 7/589 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           + FL V+ SI G RW++ L +     AL + Q   +PDIV+RVL  R ++   A  FL+P
Sbjct: 6   RTFLDVDRSIGGRRWLNALDERAEGAALKMAQSLGLPDIVSRVLAARGIAEADATGFLDP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
            IR LMPDP  LT  D AA R+  AI   E + IFGDYDVDGAAS AL+ R+L H  ++A
Sbjct: 66  RIRDLMPDPSRLTAMDAAAERLADAIGRRESVAIFGDYDVDGAASSALLWRYLKHFGIDA 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            + IPDRI +GYGPNP+ M +   +GA LI+TVDCG+ S++A++ A  +G+DV+V+DHHQ
Sbjct: 126 AIRIPDRITEGYGPNPAAMRELAADGATLIVTVDCGTGSFEAIEAARAEGVDVVVLDHHQ 185

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLL 239
              E   A  LVNPNR DDLSG GHLCAAGVVF+ LV + R LR+     +K+P   D+ 
Sbjct: 186 TGPELPDANVLVNPNRQDDLSGLGHLCAAGVVFMTLVAVSRELRRRGMAQSKLP---DVF 242

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            LLDLVALATVCDVVPL+GLNRA+VV+GL VA  Q N GL AL     +S P+   + G+
Sbjct: 243 GLLDLVALATVCDVVPLVGLNRAFVVQGLKVAHAQRNGGLAALGRVSRLSGPMETHHFGF 302

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG++ LGSRLL  DD    + +A +L  LN+ R+ ME  ML +A+A+V 
Sbjct: 303 MLGPRINAGGRIGDAALGSRLLCLDDDAACDEVAARLSALNEERQAMEQTMLAEADAEVA 362

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +    +  +V+VV  + WHPGIVGL++ARLKE++ RP+FAI+F+  G+G GSGRSI GF
Sbjct: 363 AEIGSGEGPAVLVVGSNDWHPGIVGLISARLKERYRRPAFAIAFDGSGRGTGSGRSIGGF 422

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G++V  AV EG+LVKGGGHAMAAG+T+++   G    F ++ A   V AL      K+
Sbjct: 423 DLGRLVREAVIEGLLVKGGGHAMAAGVTIQKDRLGDFRGFLEERAAAAVSALREGDSLKV 482

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A+ +   L   +  AGP+G+G+ +P+FA   H++ S  +V   H++ T    D  
Sbjct: 483 DGTVSAAGLTPDLYATIMRAGPFGSGHASPIFALARHRIDSSSIVGNGHVRATLRGADGA 542

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            + AIAF+   T +G+ L+ SR + +H  G L ++ +RG +  + R+LD
Sbjct: 543 RVSAIAFKTADTEVGQRLLSSRDRPIHAVGTLSLDRFRGREEVRFRLLD 591


>gi|154248669|ref|YP_001419627.1| single-stranded-DNA-specific exonuclease RecJ [Xanthobacter
           autotrophicus Py2]
 gi|154162754|gb|ABS69970.1| single-stranded-DNA-specific exonuclease RecJ [Xanthobacter
           autotrophicus Py2]
          Length = 626

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 280/595 (47%), Positives = 378/595 (63%), Gaps = 8/595 (1%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           + ++ FL V  S +G  W   L   G   ALA+ Q+  I +++ARVL  R+V +D  + +
Sbjct: 32  LPNRLFLDVARSATGRTWRERLDVRGAQTALAMAQRTGISELLARVLAGRDVPLDGVEQY 91

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L+PSIR L+PDP  LTD   A  R+ +A+ + E++ +FGDYDVDGA + ALM+  L    
Sbjct: 92  LDPSIRTLLPDPDTLTDMGAAVARLSRAVTSGEQVAVFGDYDVDGACATALMVGVLRAAG 151

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           ++   +IPDRI +GYGPN   +E+    G  L++TVDCG+TS + L  A   G+D +VID
Sbjct: 152 LDPLFHIPDRIFEGYGPNVPAIEQLAARGVTLLVTVDCGTTSMEPLAAARRLGMDTVVID 211

Query: 181 HHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNF 236
           HHQ   E +P A A+VNPNR DDLSG GH+CAAG+ F+  V + R LRQ+   N      
Sbjct: 212 HHQ-SGERLPDAAAIVNPNREDDLSGLGHVCAAGLAFITAVGLVRALRQNGHFNTARPAP 270

Query: 237 DLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAEN 296
           DLL  LDLVALATV DVVPL GLNRA+V KGL+  RR+G  GL AL++   +  P    +
Sbjct: 271 DLLDTLDLVALATVADVVPLKGLNRAFVTKGLLAMRRRGRIGLTALMDAARLDGPPRPFH 330

Query: 297 LGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEA 356
           LG++IGP INAGGRIGE+ LG++LL++ D  E   +A +LD LN  R+ +E A+L  AEA
Sbjct: 331 LGFLIGPRINAGGRIGEATLGAKLLLTQDPAEARQIAAELDRLNGERQEVERAILAAAEA 390

Query: 357 KVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSI 416
           +         + SVIVV GD WHPG+VGL+A+RLKE+F RP+FAI+F  +  G GSGRS+
Sbjct: 391 EAEAALGLSDEGSVIVVSGDGWHPGVVGLVASRLKERFQRPAFAIAFNGE-TGTGSGRSL 449

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRL-CDFFQKFAHNIVPALITTP 475
            G DIG+ V  A+E G+LVKGGGHAMAAGLTVER   G L   F ++ A ++  A     
Sbjct: 450 PGVDIGRAVRAALEAGLLVKGGGHAMAAGLTVERARLGALRAAFEERLAADVARARAEG- 508

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              IDG L A      L++M+  AGP+GAGN  PVFAFP H++  +      H++    S
Sbjct: 509 TLSIDGALTARGATTDLVEMVSRAGPFGAGNGEPVFAFPGHRISYVESFGAGHVRARISS 568

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            D  TL+A AFR    PLG  L+ +RG+ +HV G L ++ W+G  R  LR+ D +
Sbjct: 569 PDGTTLKATAFRCAEEPLGRALLAARGRPLHVAGSLELDTWQGETRVALRMRDVA 623


>gi|312115910|ref|YP_004013506.1| single-stranded-DNA-specific exonuclease RecJ [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311221039|gb|ADP72407.1| single-stranded-DNA-specific exonuclease RecJ [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 609

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 277/593 (46%), Positives = 369/593 (62%), Gaps = 7/593 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S  G +W+  L  +  + A AI Q+H +P+IV R+L  R VS+D   D LNP+
Sbjct: 16  AFLGVERSARGLKWIERLAPQDAHIAAAIAQRHNLPEIVGRILAARGVSLDEVADVLNPT 75

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L PDP   TD DKAA RI +AI   E+I IFGDYDVDGA+S AL+ RFL+   ++A 
Sbjct: 76  LRALCPDPSTFTDMDKAADRIARAIETGERIAIFGDYDVDGASSSALLKRFLAWHGLDAR 135

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   + + I +GAQLI+TVDCGSTS++AL  A  +G++V+V+DHHQV
Sbjct: 136 IYIPDRITEGYGPNGPAIAQLIEDGAQLIVTVDCGSTSFEALDVAAKRGVEVVVVDHHQV 195

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLS 240
            +EE+P A+A+VNPNR D LSGQGHLCAAGV FL+ V   R LR      K P   DLL 
Sbjct: 196 -NEELPVAHAVVNPNRQDCLSGQGHLCAAGVTFLLCVAAQRRLRAKGAYAKSPAP-DLLG 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LD+VALATVCDVVPL G+NRA+VV+GL V R + NPGL+AL +   ++ P +   LG++
Sbjct: 254 WLDIVALATVCDVVPLSGVNRAFVVQGLKVLRNRRNPGLRALADAAGVNKPPSPYTLGFV 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG+++LG+RLL S+D  E   +A  LD LN+ RR +E   +E+A A    
Sbjct: 314 LGPRINAGGRIGDASLGARLLASEDDIETRRIAETLDRLNRERREIEIKTVEEAAAWADR 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGF 419
              +   A +I+     WH G+VGL A+RL E+F RP    S ++D G+  GS RS+ G 
Sbjct: 374 TLMEDPSAPIIIAGSPSWHKGLVGLAASRLTERFQRPCLIFSQDDDAGESTGSARSVSGV 433

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           DIG  V  AVE G+  KGGGH MAAG+TV+      L  F +             P   I
Sbjct: 434 DIGAAVRGAVEAGVAKKGGGHTMAAGITVDTARLHELAAFLRAALDPAYRVASAAPELAI 493

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DGVL   A  +     LE+AGPYG GNP P F+  + +   I+ ++  HL++  +  D  
Sbjct: 494 DGVLKPRAATLDFCAQLEAAGPYGQGNPAPRFSLASVRPTMIKEISGGHLRLALQDVDGS 553

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            + A+AFR   T +G  L   R    HV G +  + W G  R +  + D +P 
Sbjct: 554 QISAVAFRAAQTEIGAALAAGRDLACHVAGRIERDEWGGKSRIEFHIEDVAPA 606


>gi|182678538|ref|YP_001832684.1| single-stranded-DNA-specific exonuclease RecJ [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182634421|gb|ACB95195.1| single-stranded-DNA-specific exonuclease RecJ [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 610

 Score =  528 bits (1360), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 279/601 (46%), Positives = 382/601 (63%), Gaps = 15/601 (2%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
           + + FL VE S+ G  W   L   G  +ALA+ Q H   D+++RVL  R ++ +  + +L
Sbjct: 9   SSRPFLNVERSVQGRVWRDRLDASGQAQALALAQIHGHGDLLSRVLAGRGITPEDCEAYL 68

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +PS+R LMPDP IL D DKAA R+ +AI   EKI IFGDYDVDGA+S AL+  + + C  
Sbjct: 69  DPSLRRLMPDPTILLDMDKAAVRMARAIMAGEKIAIFGDYDVDGASSSALLADYFTACGT 128

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   ++     GA+L++TVDCG+TS++ L  A   G+D IV+DH
Sbjct: 129 PFQIHIPDRIFEGYGPNVDAIQALAAGGAKLLVTVDCGTTSHNPLGEAAKLGLDPIVLDH 188

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ------DNKVPLN 235
           HQ  ++ +P   +VNPNR DDLSG G LCAAGVVF++LV + R LR+      + + P  
Sbjct: 189 HQAPAD-LPEAIIVNPNRQDDLSGLGQLCAAGVVFMLLVALNRRLREQGFFTAERREP-- 245

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DLL+ LDLVALATV DV PL GLNRA+V KGL V + +   GL+AL +         A 
Sbjct: 246 -DLLAFLDLVALATVADVAPLTGLNRAFVTKGLAVMQMRQRAGLRALFDCAGAREAPKAG 304

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQA- 354
           +LG++IGP INAGGRIG++ LG+RLLI  D  + E +A +LD LN+ R+++E+  LEQA 
Sbjct: 305 HLGFLIGPRINAGGRIGDAALGARLLIERDQIKAEEIARRLDTLNRERQVIEAETLEQAL 364

Query: 355 ---EAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIG 411
              EA+   Q DD +  + IV   + WHPGIVGL+A RLK+K+  P+FA++F E G G G
Sbjct: 365 LQAEAEQGLQ-DDAKAGAAIVTASEDWHPGIVGLVATRLKDKYRCPAFAVAFNESGIGTG 423

Query: 412 SGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL 471
           SGRSI G D+G  V  AVE G+L+KGGGHAMAAG+T+ R +      F ++     V A 
Sbjct: 424 SGRSIAGVDLGHAVREAVEAGLLIKGGGHAMAAGITLVRDHLAAFRAFLEEKLTEAVTAG 483

Query: 472 ITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQM 531
            +     +D  L AS  N AL+  LE AGP+GAGNP PVF  P H+L    VV   H++ 
Sbjct: 484 RSGDALFVDAALTASGANPALMASLEKAGPFGAGNPEPVFVLPAHRLMDASVVGNGHVRF 543

Query: 532 TFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
             E+ D   ++ IAFR    PLG+ L+  RG +MH  G L ++ + G +R Q+R+ D +P
Sbjct: 544 RAEAGDGARIEGIAFRSAAEPLGDALLAGRGTKMHFAGTLMLDRFGGRERVQMRLTDLAP 603

Query: 592 V 592
           +
Sbjct: 604 L 604


>gi|85717365|ref|ZP_01048317.1| RecJ exonuclease [Nitrobacter sp. Nb-311A]
 gi|85695840|gb|EAQ33746.1| RecJ exonuclease [Nitrobacter sp. Nb-311A]
          Length = 613

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 278/591 (47%), Positives = 376/591 (63%), Gaps = 7/591 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L Q G  RALAI Q+H +P+++ARV+  R V ID   DFL+P+
Sbjct: 15  AFLGVSHSATGRLWRDRLDQRGAARALAIAQRHQLPEMLARVIAGRGVEIDAIADFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  +T  + AA+R+  A    E + IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRRLMPDPSTVTQMETAAKRLADAAMRGETVAIFGDYDVDGATSAALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   ++   + GA L++TVDCG+TS + L  A  +G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNVDAIDALADRGATLLVTVDCGTTSIEPLSVARQRGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLS 240
             +     ALVNPNR DDLSG GHL A G+V + LV + R LR+     ++ P   +LL 
Sbjct: 195 GDDLPEVEALVNPNRPDDLSGLGHLAAVGLVLVTLVALNRELRKRGFWSSERP-EPNLLD 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PL GLNRA+V KGL+  RR+ + G  AL++   +S P  A +LG+M
Sbjct: 254 MLHHVALGTVADVAPLTGLNRAFVAKGLIALRRRDHVGHTALMDVARLSGPPEAWHLGFM 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E A   QAEA+ L 
Sbjct: 314 LGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNAERRVIEQAAEAQAEAEALA 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + SVIV   + WHPG+VGL+A+RLK+KF RP+F ++ E  G G GSGRSI G D
Sbjct: 374 SLGLEDKGSVIVTASEGWHPGVVGLVASRLKDKFSRPAFVVALEPGGIGTGSGRSIGGVD 433

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQK-FAHNIVPALITTPVFKI 479
           +GK V  AV +G+L+KGGGHAMAAG+T+ +        + +   A ++  +     +F I
Sbjct: 434 LGKAVRRAVTDGVLLKGGGHAMAAGVTLRKEQLAEFRAYMENTLAADVARSRHVRELF-I 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A       + ML  AGP+GAGNP P+ A P+H+L     V  AHL++ F+S D  
Sbjct: 493 DGAVSARTATPEFVTMLNRAGPFGAGNPEPMVALPSHQLIHADEVGQAHLRLRFKSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +  IAFR  G PLG  L Q RG+ +HV G L V+ W+G++R QLRV+D +
Sbjct: 553 IVNGIAFRAVGQPLGNALAQMRGQPLHVAGSLAVDRWQGAERVQLRVVDVA 603


>gi|75675837|ref|YP_318258.1| RecJ exonuclease [Nitrobacter winogradskyi Nb-255]
 gi|74420707|gb|ABA04906.1| exonuclease RecJ [Nitrobacter winogradskyi Nb-255]
          Length = 613

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 280/595 (47%), Positives = 375/595 (63%), Gaps = 6/595 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L   G  RALAI Q+H +P+++ARV+  R V ID   DFL+P+
Sbjct: 15  AFLGVSHSATGRLWRDRLDPRGAARALAIAQRHQLPEMLARVIAGRGVDIDAVTDFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  +T  + AA+RI  A    E + IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRRLMPDPFTVTQMETAAQRIADAAMRGETVAIFGDYDVDGATSAALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   ++     GA L++TVDCG+TS + L  A  +G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNVDAVDALAGRGATLLVTVDCGTTSIEPLAVARQRGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNFDLLSL 241
             +     ALVNPNR DDLSG GHL A G+VF+ LV + R LRQ    ++     +LL +
Sbjct: 195 GDDLPEVEALVNPNRPDDLSGLGHLAAVGLVFITLVALNRELRQRGFWSRERPEPNLLDM 254

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           L  VAL TV DV PL GLNRA+V KGL+  RR+ + G  AL++   +S P  A +LG+M+
Sbjct: 255 LHHVALGTVADVAPLTGLNRAFVAKGLIALRRRDHVGHTALMDVARLSGPPEAWHLGFML 314

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L  
Sbjct: 315 GPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNAERRVIEQTAEAQAEAEALAS 374

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                + SVIV   + WHPG+VGL+A+RLK+KF RP+F ++ E  G G GSGRSI G D+
Sbjct: 375 LGLEDKGSVIVTASEGWHPGVVGLVASRLKDKFARPAFVVALEPGGIGTGSGRSIGGVDL 434

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQK-FAHNIVPALITTPVFKID 480
           GK V  AV +G+L+KGGGHAMAAG+T+ +        + +   A ++  +     +F ID
Sbjct: 435 GKAVRRAVTDGVLLKGGGHAMAAGVTLRKEQLAEFRAYMETALAADVARSRHVRKLF-ID 493

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G ++A A     +  L  AGP+GAGNP PV A P+H+L     +  AHL++ F S D   
Sbjct: 494 GAVSARAATPEFVATLNRAGPFGAGNPEPVVALPSHQLIHADEIGQAHLRLRFRSGDGAI 553

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD-ASPVEG 594
           +  IAFR  G PLG  L + RG+ +HV G L V+ W+G++R QLRV+D A+P  G
Sbjct: 554 VNGIAFRAVGQPLGNALARMRGQPLHVAGSLAVDRWQGAERVQLRVVDVAAPDPG 608


>gi|146340534|ref|YP_001205582.1| putative single-stranded-DNA-specific exonuclease recJ
           [Bradyrhizobium sp. ORS278]
 gi|146193340|emb|CAL77356.1| putative single-stranded-DNA-specific exonuclease recJ
           [Bradyrhizobium sp. ORS278]
          Length = 613

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 282/591 (47%), Positives = 380/591 (64%), Gaps = 5/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           QAFLGV  S++   W   L   G  RALAI Q++ +P+++ARVL  R+V++D  +DFL+P
Sbjct: 14  QAFLGVRLSLTNKLWRDRLDTRGAARALAIVQRYQLPEMLARVLAGRDVALDAVQDFLDP 73

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  +T  + AA+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 74  TIRKLMPDPFTVTQMEAAAQRIADAAVKGEKVAIFGDYDVDGATSAALLAWHLRHCGLDP 133

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +    N+GA L++TVDCG+TS + L  A   G+ V+VIDHHQ
Sbjct: 134 LIHIPDRIFEGYGPNTDAIRALANKGATLLVTVDCGTTSLEPLAEARRLGMSVVVIDHHQ 193

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNFDLLS 240
              E     ALVNPNR DDLSG G+L A G+ F+ LV + R LR     +      DLLS
Sbjct: 194 CGEELPEVEALVNPNRPDDLSGLGYLAAVGLTFVTLVAVNRELRSRGFWSGTRPEPDLLS 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PLI LNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M
Sbjct: 254 MLHHVALGTVADVAPLIALNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGFM 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L 
Sbjct: 314 LGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNTERRVIEQQAEAQAEAEALA 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKF RP+FAI+ E  G G GSGRSI G D
Sbjct: 374 SLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFARPAFAIALEPGGIGTGSGRSIPGVD 433

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQK-FAHNIVPALITTPVFKI 479
           +GK V  AVE+G+L+KGGGHAMAAG+T+ +        + +   A ++  A     +  I
Sbjct: 434 LGKAVRHAVEQGLLMKGGGHAMAAGVTLRKERLAEFRAYLENALAADVAEARHVNEIL-I 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A A    L++ L  AGP+G+GNP P+ A P+H+L     V  AHL++ F+S D  
Sbjct: 493 DGAISARAATPELVNTLNRAGPFGSGNPEPIVALPSHQLVYADEVGQAHLKLRFKSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           T+ AIAFR  G  LG  L+Q RG+ +HV G L V+ ++G +R QLRVLD +
Sbjct: 553 TVNAIAFRSVGQRLGNALVQHRGQVLHVAGTLTVDRYQGVERVQLRVLDVA 603


>gi|328544275|ref|YP_004304384.1| Single-stranded-DNA-specific exonuclease RecJ [polymorphum gilvum
           SL003B-26A1]
 gi|326414017|gb|ADZ71080.1| Single-stranded-DNA-specific exonuclease RecJ [Polymorphum gilvum
           SL003B-26A1]
          Length = 602

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 285/584 (48%), Positives = 374/584 (64%), Gaps = 3/584 (0%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           LGV  S SG  W           ALAI Q+  +PD++ARVL  R+V+   A+ FL+P+++
Sbjct: 11  LGVTRSASGQVWRERQTPAQGLAALAIAQRLDLPDVLARVLAARDVTAADAEGFLDPTLK 70

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            LMPDP  L D D+A  R+  A+    +I IFGDYDVDGA S A++ R+L    ++  ++
Sbjct: 71  ALMPDPSRLVDMDRAVARVADAVEAGTRIAIFGDYDVDGATSSAVLARYLRRLGLDPAIH 130

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRI++GYGPN   +E     GA L++TVDCGSTS++A   A   G+DV+VIDHHQ   
Sbjct: 131 IPDRIIEGYGPNGPAIEALRAAGAGLLVTVDCGSTSFEAFDVARRLGLDVVVIDHHQCGV 190

Query: 187 EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLSLLDL 244
           E     ALVNPNR DDLSGQGHL A GV FL LV + R LR+        +  LL LLDL
Sbjct: 191 ELPAVSALVNPNRQDDLSGQGHLAAVGVTFLFLVGLNRELRRRGTFRRGGEPDLLGLLDL 250

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VAL TVCDVVPL GLNRAYV KGL+    + NPGL +L +   +     A +LG+++GP 
Sbjct: 251 VALGTVCDVVPLKGLNRAYVAKGLIAMHGRLNPGLASLADVARVGGKPAAYHLGFLLGPR 310

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG++ LG+RLL  DD QE   LA  LD LN  R+ ME+ MLE+ +A+ + Q D 
Sbjct: 311 INAGGRIGDAALGARLLTCDDPQEARGLAETLDRLNAERQAMEAVMLEEGDAQAVVQID- 369

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
               +V+V     WHPGIVGL+A+RLKE   RP+FAI+++E GKG GSGRSI G D+G+ 
Sbjct: 370 THDPAVLVTGSPGWHPGIVGLIASRLKEAHRRPAFAIAYDETGKGTGSGRSISGVDLGRA 429

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           V  AV+EG+L KGGGHAMAAGLTV R     L  +F +   + V     T   KID  L 
Sbjct: 430 VRRAVDEGLLEKGGGHAMAAGLTVRREREADLVAYFNETLKDDVEVASATRELKIDAALT 489

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
           A+   + L+ +L+ AGPYGAG+P PVF FP H++    VV   H++ T  + D  +L+ I
Sbjct: 490 AAGATLELMSLLDKAGPYGAGHPEPVFVFPAHRISYADVVGKGHVRATIAAPDGSSLKGI 549

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           +F+    P GE L+ +RG+ MHV G L V+ W+G+ R QLR+LD
Sbjct: 550 SFKAAERPHGEALLAARGRPMHVAGSLSVDTWQGAPRVQLRILD 593


>gi|254502532|ref|ZP_05114683.1| single-stranded-DNA-specific exonuclease RecJ [Labrenzia alexandrii
           DFL-11]
 gi|222438603|gb|EEE45282.1| single-stranded-DNA-specific exonuclease RecJ [Labrenzia alexandrii
           DFL-11]
          Length = 606

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 279/589 (47%), Positives = 376/589 (63%), Gaps = 9/589 (1%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           LGV  S +   W   L       A+AI+Q+H +PD+++RV+  R V+   A  FL PS++
Sbjct: 15  LGVARSANDNAWRERLSAAETRAAMAISQQHGLPDVLSRVMAARGVAAADASAFLEPSLK 74

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            LMPDP  L D D A  R+  A+   +KI IFGDYDVDGA S A++  +L    ++  ++
Sbjct: 75  TLMPDPSSLVDMDAAVARVADAVQTGKKIAIFGDYDVDGATSSAVLANYLQWLGLDPVIH 134

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRI++GYGPN   +E     GA+L+IT+DCGSTS++A + A    +DV+VIDHHQV  
Sbjct: 135 IPDRIIEGYGPNGPAIENLQAGGAELLITLDCGSTSFEAFETAKKLNLDVVVIDHHQVGE 194

Query: 187 EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSL 241
                 ALVNPNR DDLSGQGHL A GV FL +V + R LRQ       + P   DL++L
Sbjct: 195 TLPEVRALVNPNRQDDLSGQGHLAAVGVTFLFIVGLNRELRQRGAFSGRQAP---DLMAL 251

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVAL TVCDVVPL GLNRAYV +GL V  ++ N GL AL +   +S      +LG++I
Sbjct: 252 LDLVALGTVCDVVPLQGLNRAYVTRGLAVMHQRQNHGLTALSDTARVSGKPAPYHLGFLI 311

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LG+RLL + D  E   +A +LD LN  R+ ME+ MLEQA A+    
Sbjct: 312 GPRINAGGRIGDAALGARLLTTADPHEARAIAERLDQLNTERQAMEAVMLEQAGAEAAIA 371

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
            +  +  +V++   + WHPGIVGL+A+RLKE   RP+FAI+++E GKG GSGRSI G D+
Sbjct: 372 IEH-RDPAVLLTGSNDWHPGIVGLIASRLKEAHRRPAFAIAYDETGKGTGSGRSINGVDL 430

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           GK V  AV++G+L KGGGHAMAAGLTV +     L  FF     + V A       KID 
Sbjct: 431 GKAVRKAVDDGLLEKGGGHAMAAGLTVRQEKAADLEAFFNDVLKDDVEAATAHRELKIDA 490

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            L A+  N+ L++MLE AGPYGAG+  PVFAFP H++    VV   H++ T  + D   L
Sbjct: 491 ALTATGANLDLMNMLEKAGPYGAGHSEPVFAFPAHRISFADVVGKGHVRATLAAGDGTAL 550

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + I F+    P G+ L++ RG+ +HV G L ++ W+G+ + QLR+LD +
Sbjct: 551 KGICFKAEDKPHGQMLLEGRGRNLHVAGTLSIDTWQGTPKVQLRILDVA 599


>gi|154253388|ref|YP_001414212.1| single-stranded-DNA-specific exonuclease RecJ [Parvibaculum
           lavamentivorans DS-1]
 gi|154157338|gb|ABS64555.1| single-stranded-DNA-specific exonuclease RecJ [Parvibaculum
           lavamentivorans DS-1]
          Length = 603

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 268/598 (44%), Positives = 376/598 (62%), Gaps = 15/598 (2%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S +G  W+S L  + +  ALAI Q+  +P+IVARVL  R V+ +    +L P
Sbjct: 7   RAFLGVERSATGRAWLSRLADDRL--ALAIAQREGLPEIVARVLAGRGVAPEDCAAYLAP 64

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           S++ LMPDP ++TD +KAA R+ QAI   EKI +FGDYDVDGA S AL+ RF        
Sbjct: 65  SLKTLMPDPRVVTDMEKAATRVAQAIMAGEKIAVFGDYDVDGATSSALLQRFFRAAGSEL 124

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   + +  +EG  L+ITVDCG+ ++ AL  A + G+  IV+DHHQ
Sbjct: 125 RIYIPDRIREGYGPNAPALLRLKDEGIDLVITVDCGTMAHKALGLAADAGLPSIVVDHHQ 184

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLLSL 241
            +    PAYALVNPNRLDD SG G L A GV FL +V   R LR+          DL+  
Sbjct: 185 AEPALPPAYALVNPNRLDDESGLGQLAAVGVAFLFVVATNRALREAGWYATRPEPDLMQW 244

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVAL T+CDVVPL+GLNRA+V +GL V  R+ N GL AL +   ++      + G+++
Sbjct: 245 LDLVALGTICDVVPLLGLNRAFVAQGLRVMARRQNIGLAALGDVARLNGAPVPYHCGFLL 304

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP +NAGGR+G+++LG+RLL ++D +E   +A +L+V+N  R+ +E+ +LE+A    LTQ
Sbjct: 305 GPRVNAGGRVGKADLGARLLTTEDVEEARAIAEELNVMNGERQAIEAQVLEEA----LTQ 360

Query: 362 CDDIQQAS-------VIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGR 414
            D+   A+       +I+  G  WHPG++G++A+RLK+K+ RPS  ++F+  G+G GSGR
Sbjct: 361 VDERLSAARANTLPPIIIASGHGWHPGVIGIVASRLKDKYERPSLVLAFDGKGEGKGSGR 420

Query: 415 SIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITT 474
           S+ G D+G+ V+ A+E G+LV GGGHAMAAGLT+   N   L  F  K   + V A    
Sbjct: 421 SLTGVDLGRAVTAALEAGLLVNGGGHAMAAGLTLREDNLEALEAFLAKRLADDVSAASEA 480

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K+DG L+A      L ++L+ AGPYGAGN  P FA P+ ++    +V   H+++   
Sbjct: 481 RALKLDGALSARGATRELYELLQQAGPYGAGNAEPRFAVPSVRVVKADIVGKDHVRVILS 540

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            +D   ++AIAFR   TPLG  LM      +HV G L  + W+G +  QL + DA P 
Sbjct: 541 GEDGGRIKAIAFRAATTPLGAVLMDKGSGLLHVAGRLSADDWQGRRAVQLTIEDAVPT 598


>gi|90424310|ref|YP_532680.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris BisB18]
 gi|90106324|gb|ABD88361.1| exonuclease RecJ [Rhodopseudomonas palustris BisB18]
          Length = 613

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 280/590 (47%), Positives = 377/590 (63%), Gaps = 5/590 (0%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L   G  RALAI Q++ +P+++ARVL  RNV ID  +DFL+P+
Sbjct: 15  AFLGVARSATGRVWRDRLDPRGAARALAIAQRYQLPEMLARVLAGRNVEIDAVEDFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR L+PDP  +T  + AA+R+  A+  +E + IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRRLLPDPYSVTQMEAAAKRLADAVLGAETVAIFGDYDVDGATSAALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +    + GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNVDAVRMLASRGATLLITVDCGTTSLEPLAEAKRLGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF---DLLSL 241
             E     ALVNPNR DDLSG GHL A G+VF+ LV + R LR      L     +LL++
Sbjct: 195 GDELPVVDALVNPNRPDDLSGLGHLAAVGLVFVTLVALNRELRARGFWTLERPQPELLNM 254

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           L  VAL TV DV PL GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+++
Sbjct: 255 LHHVALGTVADVAPLTGLNRAFVAKGLIAMRRRDHVGHTALMDIARLNGPPDAFHLGFLL 314

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L  
Sbjct: 315 GPRINAGGRIGRADLGVRLLLESDISEAAKIAAELDRLNAERRVIEQMAEAQAEAEALAA 374

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                + SVIV   + WHPG+VGL+A+RLKEKF RP+FAI+ E  G G GSGRSI G D+
Sbjct: 375 LGFEDKGSVIVTASEGWHPGVVGLVASRLKEKFSRPAFAIALEPGGIGTGSGRSIPGVDL 434

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQ-KFAHNIVPALITTPVFKID 480
           GK V  AV +G+L+KGGGHAMAAG+T+ +        + +   A ++  +     +F ID
Sbjct: 435 GKAVRQAVSDGLLLKGGGHAMAAGVTLRKEKLAEFRAYIEAALAADVARSRHANELF-ID 493

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G ++A AV   L+  L  AGP+G+GNP PV A P+H+L     V  AHL++ F+S D   
Sbjct: 494 GAVSARAVTPDLVATLNRAGPFGSGNPEPVLALPSHQLVYADEVGQAHLRLRFKSGDGAI 553

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +  IAFR  G  LG  L ++RG+ +HV G L V+ W+G++R QLRV D +
Sbjct: 554 VNGIAFRSVGQKLGNALQENRGQPLHVAGCLTVDRWQGNERVQLRVTDVA 603


>gi|158423475|ref|YP_001524767.1| RecJ exonuclease [Azorhizobium caulinodans ORS 571]
 gi|158330364|dbj|BAF87849.1| RecJ exonuclease [Azorhizobium caulinodans ORS 571]
          Length = 606

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 280/599 (46%), Positives = 372/599 (62%), Gaps = 11/599 (1%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           + ++ FL V  S +G  W   L       ALAI Q+H +PD+VAR+L  R V ID    F
Sbjct: 11  LTNRPFLSVARSATGRTWRDRLDVRASQMALAIAQRHFVPDLVARILAGRGVDIDDVPAF 70

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L+P+I+ L+PDP  LTD   A  R+  A+   E++ +FGDYDVDGA S AL++  L    
Sbjct: 71  LDPTIKALLPDPDTLTDMGGAVERVAAAVTRGEQVAVFGDYDVDGATSTALLVDVLRAAG 130

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           ++   +IPDRI +GYGPN + +E+    G  L+ITVDCG+TS + L  A   G+DV+VID
Sbjct: 131 LDPFFHIPDRIFEGYGPNVNAIEQLAARGVTLLITVDCGTTSTEPLAAARRLGLDVVVID 190

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ------DNKVPL 234
           HHQ       A A+VNPNR DDLSG GHLCA G+VF+ +V + R LR+      D   P 
Sbjct: 191 HHQAGEHLPDANAIVNPNREDDLSGLGHLCAVGLVFVTVVGLVRKLREMGHWTGDRPAPD 250

Query: 235 NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITA 294
               L+ LDLVAL TV DVVPL GLNRA+V KGL+  RR+  PGL AL++   +  P   
Sbjct: 251 L---LAALDLVALGTVADVVPLKGLNRAFVTKGLIALRRRQRPGLTALMDVSRLDGPPRP 307

Query: 295 ENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQA 354
            +LG+++GP INAGGRIG++ LG+RLL++ D  E   +A +LD LN  R+ +E  +L  A
Sbjct: 308 WHLGFLLGPRINAGGRIGDATLGTRLLLTQDPAEARAIAAELDRLNTERQAVEQGILADA 367

Query: 355 EAKVLTQCDDI-QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSG 413
           EA+           AS +VV G  WHPG+VGL+A+RLKE+F RP+FAI+F  +  G GSG
Sbjct: 368 EAEAQAAMGIAGDGASTVVVSGQGWHPGVVGLVASRLKERFNRPAFAIAFTGE-TGTGSG 426

Query: 414 RSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALIT 473
           RSI+G D+GK V  AVE G+LVKGGGHAMAAGLTVE+   G L  F +      V     
Sbjct: 427 RSIQGVDLGKAVRAAVEAGLLVKGGGHAMAAGLTVEKARLGDLRAFLENALAPDVAKAAG 486

Query: 474 TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
                IDG L AS    AL+D +  AGP+GAGNP PVFAFP+H+L         H++   
Sbjct: 487 EGTLTIDGALTASGATPALLDQVAKAGPFGAGNPEPVFAFPSHRLTYAETFGNGHVRARL 546

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            + D  TL+A+AFR    PLG  ++ +RG+ +HV G L +++W+G  R  LRV D + V
Sbjct: 547 VAGDGTTLKAVAFRCAEEPLGRAILNARGRNLHVAGGLDMDHWQGEARVSLRVRDVAEV 605


>gi|27379488|ref|NP_771017.1| single-stranded-DNA-specific exonuclease [Bradyrhizobium japonicum
           USDA 110]
 gi|27352640|dbj|BAC49642.1| single-stranded-DNA-specific exonuclease [Bradyrhizobium japonicum
           USDA 110]
          Length = 633

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 287/597 (48%), Positives = 383/597 (64%), Gaps = 8/597 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           QAFLGV  S++   W   L   G  +ALAI Q+H +P+++ARVL  R V ID   DFL+P
Sbjct: 34  QAFLGVTRSLTDKLWRDRLDARGAAQALAIVQRHQLPELLARVLAGRGVDIDAVPDFLDP 93

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  +T+ + AA+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 94  TIRKLMPDPFTVTEMEAAAKRIADAAAKGEKVAIFGDYDVDGATSAALLAWHLRHCGLDP 153

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +     +GA L++TVDCG+TS + L  A   G+ V+VIDHHQ
Sbjct: 154 LIHIPDRIFEGYGPNTEAVRGLAAKGATLLVTVDCGTTSIEPLAEAKRLGMSVVVIDHHQ 213

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLL 239
             +E     ALVNPNRLDDLSG GHL A G+V + LV + R LRQ    + ++P   DLL
Sbjct: 214 AGTELPLVDALVNPNRLDDLSGLGHLAAVGLVLVTLVAVNRELRQRGFWNAEMP-EPDLL 272

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+
Sbjct: 273 GMLHHVALGTVADVAPLIGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGF 332

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP +NAGGRIG ++LG RLL+  DS E   +A +LD LN  RR++E A   QAEA+ L
Sbjct: 333 MLGPRVNAGGRIGRADLGVRLLLEGDSVEAARIAAELDRLNTERRVIEQAAEAQAEAEAL 392

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  +  VIV   + WHPG+VGL+A+RLKEKF RP+FAI+ E  G G GSGRSI G 
Sbjct: 393 ASIGLEDKLGVIVTASEGWHPGVVGLVASRLKEKFSRPAFAIALEPGGIGTGSGRSIAGV 452

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQK-FAHNIVPALITTPVFK 478
           DIGK V  AV +GIL+KGGGHAMAAG+T+ +        + +   A ++  A     ++ 
Sbjct: 453 DIGKAVRQAVTDGILLKGGGHAMAAGVTLRKEKLAEFRAYLENALARDVAEARHVNELY- 511

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           IDG ++A AV   L   L  AGP+G+GNP  V A P H+L     V  AHL++ F+S D 
Sbjct: 512 IDGAVSARAVTTELAATLNRAGPFGSGNPEAVLALPAHQLVYADEVGQAHLRLRFKSGDG 571

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD-ASPVEG 594
             +  IAFR  G  LG  L+ +RG+++HV G L V+ ++G++R Q RV+D A P +G
Sbjct: 572 AIVNGIAFRSVGQKLGNALVANRGQQLHVAGSLSVDRYQGAERVQFRVIDVALPDQG 628


>gi|92117830|ref|YP_577559.1| single-stranded-DNA-specific exonuclease RecJ [Nitrobacter
           hamburgensis X14]
 gi|91800724|gb|ABE63099.1| exonuclease RecJ [Nitrobacter hamburgensis X14]
          Length = 613

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 280/591 (47%), Positives = 375/591 (63%), Gaps = 7/591 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L   G  RALAI Q+H +P+++ARV+  R V +D   DFL+P+
Sbjct: 15  AFLGVSHSATGRLWRDRLDARGAARALAIAQRHQLPEMLARVIAGRGVEVDAVADFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  +T  + AA+R+  A    E + IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRRLMPDPFTVTQMEAAAKRLADAAMRGETVAIFGDYDVDGATSAALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +      GA L++TVDCG+TS + L  A  QG+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNVEAINALAARGATLLVTVDCGTTSIEPLAVAKQQGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLS 240
             +     ALVNPNR DDLSG GHL A G+V + LV + R LRQ     ++ P   DLL+
Sbjct: 195 GDDLPEVEALVNPNRPDDLSGLGHLAAVGLVLVTLVALNRELRQRGFWTDERP-EPDLLN 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PL GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M
Sbjct: 254 MLHHVALGTVADVAPLTGLNRAFVAKGLIALRRRDHVGHTALMDVARLNGPPEAWHLGFM 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E A   QAEA+ L 
Sbjct: 314 LGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNVERRVIEQAAEAQAEAEALA 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLK+KF RP+F ++ E  G G GSGRSI G D
Sbjct: 374 SLGLEDKGAVIVTASEGWHPGVVGLVASRLKDKFSRPAFVVALEPGGIGTGSGRSIGGVD 433

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQK-FAHNIVPALITTPVFKI 479
           +GK V  AV +G+L+KGGGHAMAAG+T+ +        + +K  A ++  +     +F I
Sbjct: 434 LGKAVRQAVTDGVLLKGGGHAMAAGVTLRKERLAEFRAYMEKALAADVARSRHVRELF-I 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A AV    +  L  AGP+GAGNP PV A P+H+L     V  AHL++ F+S D  
Sbjct: 493 DGAVSARAVTPEFVATLNRAGPFGAGNPEPVVALPSHQLIYADEVGQAHLRLRFKSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +  IAFR  G PLG  L Q RG+ +HV G L V+ W+G++R QLRV D +
Sbjct: 553 IVNGIAFRAIGQPLGNVLTQMRGQPLHVAGSLAVDRWQGAERVQLRVSDVA 603


>gi|148255389|ref|YP_001239974.1| exonuclease RecJ [Bradyrhizobium sp. BTAi1]
 gi|146407562|gb|ABQ36068.1| exonuclease RecJ [Bradyrhizobium sp. BTAi1]
          Length = 613

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 280/591 (47%), Positives = 375/591 (63%), Gaps = 5/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           QAFLGV  S++   W   L   G  RALA+ Q++ +P+++ARVL  R+V ID   DFL+P
Sbjct: 14  QAFLGVRLSLTNKLWRDRLDARGAARALAMVQRYQLPEMLARVLAGRDVDIDAVNDFLDP 73

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  +T  + AA+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 74  TIRKLMPDPFTVTQMEAAAKRIADAAVRGEKVAIFGDYDVDGATSAALLAWHLRHCGLDP 133

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +     +GA L++TVDCG+TS + L  A   G+ V+VIDHHQ
Sbjct: 134 LIHIPDRIFEGYGPNVEAIRALAGKGATLLVTVDCGTTSLEPLAEARRLGMSVVVIDHHQ 193

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNFDLLS 240
              E     ALVNPNR DDLSG G+L A G+  + LV + R LR     +      DLLS
Sbjct: 194 CGEELPEVEALVNPNRPDDLSGLGYLAAVGLTLVTLVAVNRELRGRGFWSGTRPEPDLLS 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PLI LNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M
Sbjct: 254 MLHHVALGTVADVAPLIALNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGFM 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L 
Sbjct: 314 LGPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERRIIEQHAEAQAEAEALA 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKF RP+FAI+ E  G G GSGRSI G D
Sbjct: 374 SLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFARPAFAIALEPGGIGTGSGRSIPGVD 433

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQK-FAHNIVPALITTPVFKI 479
           +GK V  AVE+G+L+KGGGHAMAAG+T+ +        + +   A ++  A     +  I
Sbjct: 434 LGKAVRHAVEQGLLIKGGGHAMAAGVTLRKERLAEFRAYLESALAADVAEARHVNEIL-I 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A A    L+  L  AGP+G+GNP P+ A P+H+L     V  AHL++ F+S D  
Sbjct: 493 DGAISARAATPELVATLNRAGPFGSGNPEPIVALPSHQLVYADEVGQAHLKLRFKSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           T+ AIAFR  G  LG  L+Q RG+ +HV G L V+ ++G +R QLRVLD +
Sbjct: 553 TVNAIAFRSVGQKLGNALVQHRGQVLHVAGTLTVDRYQGVERVQLRVLDVA 603


>gi|114704297|ref|ZP_01437205.1| single-stranded-DNA-specific exonuclease protein [Fulvimarina
           pelagi HTCC2506]
 gi|114539082|gb|EAU42202.1| single-stranded-DNA-specific exonuclease protein [Fulvimarina
           pelagi HTCC2506]
          Length = 612

 Score =  511 bits (1317), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 287/587 (48%), Positives = 377/587 (64%), Gaps = 2/587 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           QAFLGVE S+SG RW + L   G   ALA++QK  I +IVARVL  R V  + A  FL P
Sbjct: 24  QAFLGVERSLSGRRWRAALDARGEGLALAMSQKQGIDEIVARVLAARGVPGEEAHRFLAP 83

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
            +R LMPDP +LTD D AA RI  AI   E++ IFGDYDVDGA+S ALM R+L H  + A
Sbjct: 84  RLRDLMPDPSVLTDMDAAADRIASAIQKRERVAIFGDYDVDGASSSALMWRYLDHFGIGA 143

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDR+ +GYGP+   M +  +E A LIITVDCG+ S+D ++ A   G DV+V+DHHQ
Sbjct: 144 RIYIPDRVTEGYGPSVVAMRELASE-ASLIITVDCGTASFDPIEAAKAAGADVVVLDHHQ 202

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
              +   A ALVNPNR DD++G GHLCAAGVVF+ LV I R LR+     L  D+L  LD
Sbjct: 203 TGPDIPSATALVNPNRQDDVAGLGHLCAAGVVFMTLVAINRALRKRGYSDLP-DILCWLD 261

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           +VALATVCDVVPL GLNRA+VV+GL V R   N GL AL     +S PI   +LG+++GP
Sbjct: 262 IVALATVCDVVPLTGLNRAFVVQGLKVMRTMKNVGLAALTRIARLSGPIEPHHLGFLLGP 321

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LGSRLL   D  E E LA +LD LNQ R+ ME  ML  AE  +L +  
Sbjct: 322 RINAGGRIGDAALGSRLLCLTDGAEAEALAARLDGLNQERQAMEQVMLRDAEEAILREIG 381

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
             +   V+V     WH GIVGL+AARLKE+F RP+FAI+F+  GKG GSGRSI G D+G+
Sbjct: 382 TGEGPPVLVTSSGEWHLGIVGLIAARLKERFRRPAFAIAFDGSGKGSGSGRSIAGVDLGR 441

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AV   ++ KGGGHAMAAG+T+ R        F ++ A + V          IDG +
Sbjct: 442 LVRDAVSHEVIEKGGGHAMAAGITIRRERLSDFRAFIEERALDAVARTRANESLDIDGAI 501

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +AS +   L   +E+AGP+G G+  PVFA  N ++ +  +V  AH++ T           
Sbjct: 502 SASGLLPDLYRAIEAAGPFGQGHETPVFALGNLRVLNADIVGHAHVRATVGGPSGGRADV 561

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAF+   TP+GE L++   + +H+ G L ++ +RG ++ +LRV+D +
Sbjct: 562 IAFKQAETPIGERLLKRSDRPVHIAGSLSLDRFRGQEQVRLRVIDVA 608


>gi|115524940|ref|YP_781851.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris BisA53]
 gi|115518887|gb|ABJ06871.1| exonuclease RecJ [Rhodopseudomonas palustris BisA53]
          Length = 613

 Score =  511 bits (1317), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 285/592 (48%), Positives = 380/592 (64%), Gaps = 9/592 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L   G  RALAI Q++ +P+++ARVL  RNV ID   DFL+P+
Sbjct: 15  AFLGVTRSATGRIWRDRLDIRGTARALAIAQRYQLPEMLARVLAGRNVEIDAVADFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR L+PDP  +T+ + AA+RI  A    E++ IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRNLLPDPHTVTEMEAAAKRIADAALRGEQVAIFGDYDVDGATSAALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +     +GA L++TVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNVEAVRGLAQKGATLLVTVDCGTTSLEPLAEAAKLGMAVVVIDHHQC 194

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLL 239
             EE+P   ALVNPNR DDLSG GHL A G+VF+ LV + R LRQ      + P   +LL
Sbjct: 195 -GEELPIVEALVNPNRPDDLSGLGHLAAVGLVFVTLVAVNRELRQRGFWTTERP-EPNLL 252

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+
Sbjct: 253 DMLHHVALGTVADVAPLIGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGF 312

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L
Sbjct: 313 MLGPRINAGGRIGRADLGVRLLLEGDISEAAKIAAELDRLNSERRVIEQMAEAQAEAEAL 372

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + +VIV   + WHPG+VGL+A+RLKEKFGRP+FAI+ E  G G GSGRSI G 
Sbjct: 373 ASLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPAFAIALEPGGLGTGSGRSIPGV 432

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQ-KFAHNIVPALITTPVFK 478
           D+GK V  AV +G+LVKGGGHAMAAG+T+ +        + +   + ++  A     +F 
Sbjct: 433 DLGKAVRQAVIDGVLVKGGGHAMAAGVTLRKDKLAEFRGYIEAALSTDVARARHANELF- 491

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           IDG ++A  V      ML  AGP+G+GNP PV A P+H+L     V  AHL++ F+S D 
Sbjct: 492 IDGAVSARGVTPDFAAMLNRAGPFGSGNPEPVIALPSHQLVYADEVGQAHLRLRFKSGDG 551

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +  IAFR  G  LG  L ++RG+ +HV G L ++ W+GS+R QLRV D +
Sbjct: 552 AIVNGIAFRAIGQKLGNALAENRGQLLHVAGSLAIDRWQGSERVQLRVTDVA 603


>gi|192291166|ref|YP_001991771.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris TIE-1]
 gi|192284915|gb|ACF01296.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris TIE-1]
          Length = 613

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 274/590 (46%), Positives = 365/590 (61%), Gaps = 5/590 (0%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L      +A A+ Q++ +P+++ARVL  R V ID  +DFL+P+
Sbjct: 15  AFLGVTRSATGKAWRDRLDARATAKAQAMVQRYQLPEMLARVLAGRGVEIDQVEDFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  LT  +  A+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRKLMPDPASLTQMEAGAKRIADAASRGEKVAIFGDYDVDGATSSALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +     +GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNIDAIRMLAGKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLS 240
             E     AL+NPNR DDLSG GHL A G+V + LV + R LR       + P   +LL 
Sbjct: 195 GDELPDVDALINPNRPDDLSGLGHLAAVGLVLMTLVAVNRELRHRGFWTTERP-EPNLLD 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PL+GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M
Sbjct: 254 MLHHVALGTVADVAPLVGLNRAFVAKGLIAMRRRDHVGHTALMDVSRLNGPPEAWHLGFM 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR +E     QAEA+ + 
Sbjct: 314 LGPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERREIEQKAEAQAEAEAMA 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKFGRPSFAI+ E  G G GSGRSI G D
Sbjct: 374 SLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPSFAIALEPGGIGTGSGRSISGVD 433

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK V  AV +G+L+KGGGHAMAAG+T+ +        + +      V          ID
Sbjct: 434 LGKAVRQAVHDGLLLKGGGHAMAAGVTLRKERLAEFRAWLETTLAGDVAKSRHVNELYID 493

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G ++A  V   L   L  AGP+GAGNP P+ A P H+L     V  AHL++ F++ D   
Sbjct: 494 GAVSARGVTTELAATLNRAGPFGAGNPEPIVALPAHQLIYADEVGQAHLRLRFKAGDGAI 553

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +  IAFR  G  LG  L ++RG+ +HV G L V+ W+G++R QLRV+D +
Sbjct: 554 VNGIAFRSVGQKLGNALTENRGQTLHVAGSLSVDRWQGAERVQLRVIDVA 603


>gi|209885147|ref|YP_002289004.1| single-stranded-DNA-specific exonuclease RecJ [Oligotropha
           carboxidovorans OM5]
 gi|209873343|gb|ACI93139.1| single-stranded-DNA-specific exonuclease RecJ [Oligotropha
           carboxidovorans OM5]
          Length = 613

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 271/592 (45%), Positives = 378/592 (63%), Gaps = 7/592 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            AFLGV+ S +G  W   L   G  +ALAI Q+H +P+++AR++  R + ID  +DFL+P
Sbjct: 14  HAFLGVKRSATGKLWRDRLDVRGAAQALAIAQRHQLPEMLARIIAGRGIDIDAVEDFLDP 73

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR L+PDP  +T  + AA+R+  A+   E + IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 74  TIRKLLPDPSTVTQMEAAAKRLADAVMRGEMVAIFGDYDVDGATSSALLAWHLRHCGLDP 133

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +    + GA+L++TVDCG+TS + L  A   G+DV+VIDHHQ
Sbjct: 134 LIHIPDRIFEGYGPNVDAIRMLSSRGAKLLVTVDCGTTSLEPLAEARKLGMDVVVIDHHQ 193

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN----KVPLNFDLL 239
              E     A+VNPNR DDLSG GHL A G+VF+ LV + R LR  N    + P   +LL
Sbjct: 194 CNDELPTVNAIVNPNRPDDLSGLGHLAAVGLVFVTLVAVNRELRVRNFWTAERP-EPNLL 252

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            +L  VAL TV DV PL+GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+
Sbjct: 253 DMLHHVALGTVADVAPLVGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGF 312

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG ++LG +LL+  D  E   +A +LD LN  RRL+E A  +QAEA+ L
Sbjct: 313 MLGPRINAGGRIGRADLGVQLLLEGDVSEAARIAAELDRLNVERRLIEQAAEQQAEAEAL 372

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + +VIV   + WHPG+VGL+A+RLKEKF RP+FA++ E  G G GSGRSI G 
Sbjct: 373 AALGLEDKGAVIVTAAEGWHPGVVGLVASRLKEKFSRPAFAVALEPGGIGTGSGRSIAGV 432

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQK-FAHNIVPALITTPVFK 478
           D+GK V  AV EG+L+KGGGHAMAAG+T+++        + +   A ++  A     +F 
Sbjct: 433 DLGKAVRGAVSEGLLMKGGGHAMAAGVTLKKDRLAEFRAYLEGVLAEDVARARHLDELF- 491

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +DG ++A AV    +  L  AGP+G GNP P+ A P+H+L     V  AHL++  +S D 
Sbjct: 492 VDGAVSARAVTTDFVATLNRAGPFGTGNPEPMMALPSHQLVYADEVGGAHLRVRLKSGDG 551

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +  IAFR  G  LG  L  +RG+ +HV G L ++ W+G++R Q R+ D +
Sbjct: 552 AFVNGIAFRAVGQKLGNALTDNRGQVVHVAGSLSIDRWQGAERVQFRICDVA 603


>gi|316934340|ref|YP_004109322.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris DX-1]
 gi|315602054|gb|ADU44589.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris DX-1]
          Length = 613

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 274/591 (46%), Positives = 370/591 (62%), Gaps = 7/591 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L      +A A+ Q++ +P+++ARVL  R V ID  +DFL+P+
Sbjct: 15  AFLGVTRSATGKAWRDRLDARATAKAQAMVQRYQLPEMLARVLAGRGVEIDQVEDFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  LT  +  A+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRKLMPDPASLTQMEAGAKRIADAASRGEKVAIFGDYDVDGATSSALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +     +GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNIDAIRMLAGKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLS 240
             E     AL+NPNR DDLSG GHL A G+V + LV + R LR       + P   +LL 
Sbjct: 195 GDELPEVEALINPNRPDDLSGLGHLAAVGLVLMTLVAVNRELRHRGFWSTERP-EPNLLD 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M
Sbjct: 254 MLHHVALGTVADVAPLIGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGFM 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR +E     QAEA+ L 
Sbjct: 314 LGPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERREIEQKAEAQAEAEALA 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKFGRPSFAI+ E  G G GSGRSI G D
Sbjct: 374 SLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPSFAIALEPGGIGTGSGRSISGVD 433

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQ-KFAHNIVPALITTPVFKI 479
           +GK V  AV +G+L+KGGGHAMAAG+T+ +        + +   A ++  +     ++ +
Sbjct: 434 LGKAVRQAVHDGLLLKGGGHAMAAGVTLRKERLAEFRAWLETTLASDVAKSRHVNELY-V 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A  V   L   L  AGP+GAGNP P+ A P H+L     V  +HL++ F++ D  
Sbjct: 493 DGAVSARGVTPELAATLNRAGPFGAGNPEPIVALPAHQLVYADEVGQSHLRLRFKAGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +  IAFR  G  LG  L ++RG+ +HV G L V+ W+G++R QLRV+D +
Sbjct: 553 IVNGIAFRSVGQKLGNALAENRGQTLHVAGCLSVDRWQGAERVQLRVIDVA 603


>gi|86750079|ref|YP_486575.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris HaA2]
 gi|86573107|gb|ABD07664.1| exonuclease RecJ [Rhodopseudomonas palustris HaA2]
          Length = 613

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 271/590 (45%), Positives = 362/590 (61%), Gaps = 3/590 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            AFLGV  S +G  W   L   G  +A AI Q++ +P+++ARV+  R + ID   DFL+P
Sbjct: 14  SAFLGVTRSATGKLWRDRLDARGTAKAQAIAQRYQLPEMLARVIAGRGIEIDAVADFLDP 73

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  +T  +  A RI  A    EK+ IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 74  TIRKLMPDPSTVTQMEAGASRIADAATKREKVAIFGDYDVDGATSAALLAWHLRHCGLDP 133

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +    ++GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ
Sbjct: 134 LIHIPDRIFEGYGPNVDAIRMLADKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQ 193

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF---DLLS 240
              E     AL+NPNR DDLSG GHL A G+V + LV + R LR      L     +LL 
Sbjct: 194 TADELPEVDALINPNRPDDLSGLGHLAAVGLVMMTLVAVNRELRHRGFWTLERPEPNLLD 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P    +LG+M
Sbjct: 254 MLHHVALGTVADVAPLIGLNRAFVAKGLIALRRRDHVGHTALMDVARLNGPPEVWHLGFM 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ + 
Sbjct: 314 LGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNTERRVIEQHAEAQAEAEAIA 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKFGRP+FAI+ E  G G GSGRSI G D
Sbjct: 374 ALGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPAFAIALEPGGIGTGSGRSIGGVD 433

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G+ V  AV EGIL+KGGGHAMAAG+T+ +        + +      V          ID
Sbjct: 434 LGRAVRNAVTEGILMKGGGHAMAAGVTLRKERLAEFRGWLETALAADVAKSRHVNELSID 493

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G ++A  +       L  AGP+GAGNP PV A P H+L     V  AHL++ F+S D   
Sbjct: 494 GAVSARGITPEFAATLNRAGPFGAGNPEPVIALPAHQLVYADEVGQAHLRLRFKSGDGAI 553

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +  IAFR  G  LG+ L ++RG  +HV G L ++ W+G++R Q RV+D +
Sbjct: 554 VNGIAFRSVGQKLGQALAENRGHPLHVAGSLAIDRWQGAERVQFRVIDVA 603


>gi|39935574|ref|NP_947850.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris CGA009]
 gi|39649427|emb|CAE27949.1| putative single-strand DNA-specific exonuclease [Rhodopseudomonas
           palustris CGA009]
          Length = 645

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 274/590 (46%), Positives = 364/590 (61%), Gaps = 5/590 (0%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L      +A A+ Q++ +P+++ARVL  R V ID  +DFL P+
Sbjct: 47  AFLGVTRSATGKAWRDRLDARATAKAQAMVQRYQLPEMLARVLAGRGVEIDQVEDFLEPT 106

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  LT  +  A+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++  
Sbjct: 107 IRKLMPDPASLTQMEAGAKRIADAASRGEKVAIFGDYDVDGATSSALLAWHLRHCGLDPL 166

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +     +GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 167 IHIPDRIFEGYGPNIDAIRMLAGKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQC 226

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLS 240
             E     AL+NPNR DDLSG GHL A G+V + LV + R LR       + P   +LL 
Sbjct: 227 GDELPDVDALINPNRPDDLSGLGHLAAVGLVLMTLVAVNRELRHRGFWTTERP-EPNLLD 285

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PL+GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M
Sbjct: 286 MLHHVALGTVADVAPLVGLNRAFVAKGLIAMRRRDHVGHTALMDVSRLNGPPEAWHLGFM 345

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR +E     QAEA+ + 
Sbjct: 346 LGPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERREIEQKAEAQAEAEAMA 405

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKFGRPSFAI+ E  G G GSGRSI G D
Sbjct: 406 SLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPSFAIALEPGGIGTGSGRSISGVD 465

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK V  AV +G+L+KGGGHAMAAG+T+ +        + +      V          ID
Sbjct: 466 LGKAVRQAVHDGLLLKGGGHAMAAGVTLRKERLAEFRAWLETTLAGDVAKSRHVNELYID 525

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G ++A  V   L   L  AGP+GAGNP P+ A P H+L     V  AHL++ F++ D   
Sbjct: 526 GAVSARGVTTDLAATLNRAGPFGAGNPEPIVALPAHQLIYADEVGQAHLRLRFKAGDGAI 585

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +  IAFR  G  LG  L ++RG+ +HV G L V+ W+G++R QLRV+D +
Sbjct: 586 VNGIAFRSVGQKLGNALTENRGQTLHVAGSLSVDRWQGAERVQLRVIDVA 635


>gi|217979197|ref|YP_002363344.1| single-stranded-DNA-specific exonuclease RecJ [Methylocella
           silvestris BL2]
 gi|217504573|gb|ACK51982.1| single-stranded-DNA-specific exonuclease RecJ [Methylocella
           silvestris BL2]
          Length = 603

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 275/593 (46%), Positives = 369/593 (62%), Gaps = 5/593 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           ++FLGVE S  G  W   L   G  RA AITQ     DI+AR+L  R V  +   ++L+P
Sbjct: 10  RSFLGVEHSALGVSWRDRLDAGGQARAAAITQLRGHGDILARILAGRGVGPETCDEYLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDP  + D + AA RI  A+  S K+ IFGDYDVDGAAS AL+  + + C V A
Sbjct: 70  TLRRLLPDPFCIKDMEPAAERIAAAVEGSRKLAIFGDYDVDGAASSALLADYFTACGVEA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   +      G  L+ITVDCG+ S+  L  AT  G++ IV+DHHQ
Sbjct: 130 FVYIPDRIFEGYGPNIGAIRNLAAAGCHLLITVDCGTMSHGPLAEATALGLEPIVLDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLLSL 241
              E +P   +VNPNR DDLSG G LCAAGVVFL L+ + R LR+     L    DLLS 
Sbjct: 190 AP-ENLPDALIVNPNRQDDLSGLGALCAAGVVFLTLIAVNRRLREKGFFNLRPEPDLLSG 248

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLV+LATV DV PL GLNRA+V KGL V R++  PGL AL +   +  P T  +LG++I
Sbjct: 249 LDLVSLATVADVAPLGGLNRAFVTKGLAVMRQRLRPGLSALFDVAKLEGPPTPYHLGFLI 308

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LG+RLL   D  E + +A +LD LN+ R+++ES  L++AEA+ +  
Sbjct: 309 GPRINAGGRIGDAALGARLLSIADPIEAKRIAEELDRLNRERQVIESGTLDEAEAQAIAG 368

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                 A+ IVV  D WHPG+VGL+A+RLKE+  +P+FAI+F  D  G+GSGRS+ G D+
Sbjct: 369 GLS-PDAAAIVVASDGWHPGVVGLVASRLKERQRKPAFAIAFSAD-LGVGSGRSVPGVDL 426

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G +V  AVE GILVKGGGHAMAAG+T+ +        F +    +            +D 
Sbjct: 427 GAVVRAAVEAGILVKGGGHAMAAGITIAKDRLEDFRGFLESKLADKRTEGGDAHALLVDA 486

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            + A+     L+  LE AGPYGAGN  PVFA P H+L  +  V   HLQ+  ++ D  T+
Sbjct: 487 AVTAAGATATLVKSLERAGPYGAGNSEPVFALPAHRLMRVNEVGNGHLQLRAQAGDGSTI 546

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
             IAFR    PL + L  + G  +H+ G L ++ W G++R +LR++D +P  G
Sbjct: 547 DGIAFRAAAQPLEKALRAAVGSSVHLAGALALDSWGGTERVRLRLIDLAPASG 599


>gi|91976971|ref|YP_569630.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris BisB5]
 gi|91683427|gb|ABE39729.1| exonuclease RecJ [Rhodopseudomonas palustris BisB5]
          Length = 633

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 271/590 (45%), Positives = 363/590 (61%), Gaps = 3/590 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            AFLGV  S +G  W   L   G  +A AI Q++ +P+++ARV+  R V ID   DFL+P
Sbjct: 34  SAFLGVTRSATGKLWRDRLDPRGTAKAQAIAQRYQLPEMLARVIAGRGVEIDAVPDFLDP 93

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  +T  +  A+RI  A    E + IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 94  TIRKLMPDPSSVTQMEAGAQRIADAAMKRETVAIFGDYDVDGATSAALLTWHLRHCGLDP 153

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +     +GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ
Sbjct: 154 LIHIPDRIFEGYGPNVDAIRGLSEKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQ 213

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF---DLLS 240
              E     AL+NPNR DDLSG GHL A G+V + LV + R LR      +     +LL 
Sbjct: 214 CGDELPEVEALINPNRPDDLSGLGHLAAVGLVMMTLVAVNRELRHRGFWTVELPEPNLLD 273

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P    +LG+M
Sbjct: 274 MLHHVALGTVADVAPLIGLNRAFVAKGLIALRRRDHVGHTALMDVARLNGPPDVFHLGFM 333

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ + 
Sbjct: 334 LGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNTERRVIEQMAEAQAEAEAMA 393

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKFGRP+FAI+ E  G G GSGRSI G D
Sbjct: 394 SLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPAFAIALEPGGIGTGSGRSIGGVD 453

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G+ V  AV EG+L+KGGGHAMAAG+T+ +        + +      V          ID
Sbjct: 454 LGRAVRRAVSEGLLMKGGGHAMAAGVTLRKERLAEFRGWLETALAADVAKSRHINELLID 513

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G ++A  V       L  AGP+GAGNP PV A P H+L     V  AHL++ F+S D   
Sbjct: 514 GAVSARGVTTEFAATLNRAGPFGAGNPEPVIALPAHQLIYADEVGQAHLRLRFKSGDGAI 573

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +  IAFR  G  LG+ L ++RG+ +HV G L ++ W+G++R QLRV+D +
Sbjct: 574 VNGIAFRSVGQKLGQALTENRGQSLHVAGSLSIDRWQGAERVQLRVIDVA 623


>gi|299133805|ref|ZP_07026999.1| single-stranded-DNA-specific exonuclease RecJ [Afipia sp. 1NLS2]
 gi|298591641|gb|EFI51842.1| single-stranded-DNA-specific exonuclease RecJ [Afipia sp. 1NLS2]
          Length = 613

 Score =  504 bits (1299), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 279/593 (47%), Positives = 381/593 (64%), Gaps = 13/593 (2%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            AFLGV  S +G  W   L   G  +ALAI Q++ +P+++AR++  R + ID  +DFL+P
Sbjct: 14  HAFLGVARSATGKLWRDRLDARGAAQALAIVQRYQLPEMLARIIAGRGIDIDAVEDFLDP 73

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR L+PDP  +T  + AA+RI  A    E + IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 74  TIRKLLPDPSTVTQMEAAAKRIADAATRGEMVAIFGDYDVDGATSAALLAWHLRHCGLDP 133

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +      GA+L++TVDCG+TS + L  A   G+DV+VIDHHQ
Sbjct: 134 LIHIPDRIFEGYGPNVEAIRSLSLRGAKLLVTVDCGTTSLEPLAEARKLGMDVVVIDHHQ 193

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN----KVPLNFDLL 239
              E     ALVNPNR DDLSG GHL A G+VF+ LV + R LR  N    + P   +LL
Sbjct: 194 CGDELPVVNALVNPNRPDDLSGLGHLAAVGLVFVTLVAVNRELRVRNFWTAERP-EPNLL 252

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            +L  VAL TV DV PL+GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+
Sbjct: 253 DMLHHVALGTVADVAPLLGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGF 312

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RRL+E A  +QAEA+ L
Sbjct: 313 MLGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNVERRLIEQAAEQQAEAEAL 372

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + SVIV   + WHPG+VGL+A+RLKEKF RP+FA++ E  G G GSGRSI G 
Sbjct: 373 ASLGLEDKGSVIVTASEGWHPGVVGLVASRLKEKFSRPAFAVALEPGGIGTGSGRSIAGV 432

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF----QKFAHNIVPALITTP 475
           D+GK V  AV EG+L+KGGGHAMAAG+T+++    RL +F     Q+ A ++  A     
Sbjct: 433 DLGKAVREAVSEGLLMKGGGHAMAAGVTLKK---DRLAEFRAYLEQRLAEDVAKARHVDE 489

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
           +F IDG ++A AV    ++ L  AGP+G GNP P+ A P+H+L     V  AH+++  +S
Sbjct: 490 LF-IDGAVSARAVTTDFVETLNRAGPFGTGNPEPMIALPSHQLVYADEVGGAHMRVRLKS 548

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            D   +  IAFR  G  LG  L ++RG+ +HV G L ++ W+G++R QLR+ D
Sbjct: 549 GDGAMVNGIAFRSVGQKLGNALAENRGQVVHVAGSLSIDRWQGAERVQLRISD 601


>gi|323136274|ref|ZP_08071356.1| single-stranded-DNA-specific exonuclease RecJ [Methylocystis sp.
           ATCC 49242]
 gi|322398348|gb|EFY00868.1| single-stranded-DNA-specific exonuclease RecJ [Methylocystis sp.
           ATCC 49242]
          Length = 597

 Score =  501 bits (1291), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 279/591 (47%), Positives = 355/591 (60%), Gaps = 12/591 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+ G  W + L   G   ALA+ Q H + D++ARVL  R VS+     +L+P+
Sbjct: 7   AFLGVERSVLGRPWRARLDASGEALALALAQTHGLDDMLARVLAGRGVSVAEVDRYLDPT 66

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV-NA 123
           IR LMPDP  + D D A  R+ +AI   E+I IFGDYDVDGA S AL++ +         
Sbjct: 67  IRTLMPDPSTVRDMDAAVDRLARAIETGEQIAIFGDYDVDGACSSALLIDYWRAAEAPEP 126

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +      GA L++TVDCG+TS++    A   G+DVIV+DHHQ
Sbjct: 127 LLHIPDRIFEGYGPNAEAIRNLAGRGATLLVTVDCGTTSHEPFAVARELGLDVIVLDHHQ 186

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN------KVPLNFD 237
              E +P   +VNPNR DDLSGQG LCAAGVVFL L  + R LR  +        P   D
Sbjct: 187 AP-EHLPDAIVVNPNRQDDLSGQGGLCAAGVVFLALAGLLRTLRTRDWWGDHRPAP---D 242

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           LLS LDLVALATV DV PL GLNRA+V KGL V R +   GL AL++   +  P  A +L
Sbjct: 243 LLSSLDLVALATVADVAPLSGLNRAFVAKGLSVMRNRSRTGLAALMDAARMDGPPRAYHL 302

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAK 357
           G+ +GP INAGGRIG++ LG+ LL   D  E   +A +LD LN  R+ +E   LE A A 
Sbjct: 303 GFALGPRINAGGRIGDAGLGACLLTLSDPVEASRIARELDRLNAERQAIEREALEAAVAL 362

Query: 358 VLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIE 417
              Q     + S +VVEG  WHPG+VGL+AARLKEKF  PSFAI+F  +    GSGRS+ 
Sbjct: 363 AEEQFVKTNRLSCLVVEGSDWHPGVVGLIAARLKEKFNLPSFAIAFNGE-TCSGSGRSLS 421

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVF 477
           G DIGK V  AVE G+ VKGGGHAMAAG+TV       L +F        V A       
Sbjct: 422 GVDIGKTVRRAVELGLAVKGGGHAMAAGITVLADRVAALREFLNDALAEQVEAARGADAL 481

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            ID  L+   VN+ L+  +E AGP+G GNP P+F  P  ++    VV   H++    S D
Sbjct: 482 VIDAALSGRGVNLDLLRRVERAGPFGQGNPEPLFVLPEQRIVDAAVVGTGHVRARLRSGD 541

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
             ++ AIAFR  G+PLGE L+  RG+R HV   L  N +RG +R + R+ D
Sbjct: 542 GASVDAIAFRAVGSPLGEALLGGRGERFHVAARLSTNQFRGVERVETRIAD 592


>gi|298291363|ref|YP_003693302.1| single-stranded-DNA-specific exonuclease RecJ [Starkeya novella DSM
           506]
 gi|296927874|gb|ADH88683.1| single-stranded-DNA-specific exonuclease RecJ [Starkeya novella DSM
           506]
          Length = 606

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 273/590 (46%), Positives = 369/590 (62%), Gaps = 4/590 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGV  S +G  W   L   G    LAI Q+  +P+I+ARVL  R V ID  + +L+P
Sbjct: 13  RAFLGVARSATGRFWRERLDLRGAQATLAIVQRTGVPEILARVLAGRGVGIDEVEAWLDP 72

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +++ L+PDP  LTD      R+  A+   EK+ +FGDYDVDGA S AL++  L    ++ 
Sbjct: 73  TVKRLLPDPDTLTDMGPCVARLADAVTTGEKVAVFGDYDVDGATSTALLVEVLRAGGLDP 132

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
             YIPDRI +GYGPN   +E     GA L++ VDCG+ S++    A   G+DV+VIDHHQ
Sbjct: 133 AFYIPDRIFEGYGPNIPAIEGLAAGGASLLVPVDCGTMSFEPFARARELGLDVVVIDHHQ 192

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNFDLLS 240
                    ALVNPNR+DDLSG GHLCA G+VF+V V + R L Q    N      +LL+
Sbjct: 193 AGETLPEVAALVNPNRVDDLSGLGHLCAVGLVFVVAVGLLRELEQRGWWNAARPKPNLLA 252

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVAL TV DVVPL+GLNRAYV KGL+  R++  PGL AL++   +S P  A +LG++
Sbjct: 253 DLDLVALGTVADVVPLLGLNRAYVTKGLLQLRKRERPGLTALMDAARLSGPPKAWHLGFL 312

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG++ LG+RLL++ D  E   +A +LD LN  R+ +E A++ QAEA+   
Sbjct: 313 LGPRINAGGRIGDAALGTRLLLTRDPIEAAAIAAELDRLNAERQQVERAIVAQAEAEAEA 372

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VI+  G  WHPG+VGL+AARLKEKFGRP+FAI+F  +  G GS RSI G D
Sbjct: 373 ALGRAGEGAVILSSGQGWHPGVVGLVAARLKEKFGRPAFAIAFTGE-SGAGSARSIPGVD 431

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G+ V  AVE GILVKGGGHAMAAGLTV R   G L    ++     V          ID
Sbjct: 432 VGRAVRAAVELGILVKGGGHAMAAGLTVAREKLGELRAHLEEVLAVSVEEARAVDETVID 491

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L+A+     L++++E AGP+GAGNP P+FAFP H++      N   +++     D   
Sbjct: 492 GALSAAGATPDLVELIEKAGPFGAGNPQPIFAFPAHRIVYAEPGNSDQVRVRLRGSDGTV 551

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           L  +AFR   TPLG+ L+ +RG++ HV G L ++ W+G  +  LR+ D +
Sbjct: 552 LSGVAFRAANTPLGQALIAARGQQAHVAGMLELDSWQGRTQVNLRICDVA 601


>gi|254561927|ref|YP_003069022.1| single-strand DNA-specific exonuclease RecJ [Methylobacterium
           extorquens DM4]
 gi|254269205|emb|CAX25171.1| putative single-strand DNA-specific exonuclease RecJ
           [Methylobacterium extorquens DM4]
          Length = 611

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 268/594 (45%), Positives = 365/594 (61%), Gaps = 9/594 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           + FL V  S  G  W    G  G+   A+ +TQ + +PD++ARVLV R V    A  +L 
Sbjct: 19  RPFLDVTASALGRPWRERCGDPGLQALAVTMTQAYGLPDLLARVLVGRGVRPAEADAYLA 78

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R LMPDP +L D + A  R+  A+   E + IFGDYDVDGA+S AL+  +L    V 
Sbjct: 79  PRLRDLMPDPSVLVDMEAAVERLAHAVRGREAVAIFGDYDVDGASSAALLADYLRALGVP 138

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DHH
Sbjct: 139 VRIHIPDRITEGYGPNVGAVTMLREEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDHH 198

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLS 240
               E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR+D     + +  L  
Sbjct: 199 GAPEELPQTRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRRDGVFATSAEPRLTD 258

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATV DVVPL GLNRA+VV+GL V R +G PGL AL++   +S P  A +LG++
Sbjct: 259 FLDLVALATVADVVPLTGLNRAFVVQGLAVMRGRGRPGLAALLDAAGLSEPPEAWHLGFL 318

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIGE+ LG+RLL + D  E   +A +LD LN+ R+ +E+  + +AEA++  
Sbjct: 319 VGPRINAGGRIGEAGLGARLLTTADPMEARRIADELDRLNRERQAIEAQAVAEAEAEMDA 378

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                    V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G D
Sbjct: 379 HLTRDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGAD 438

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL---ITTPVF 477
           +G  V  AVE G+ +KGGGHAMAAG+T+     G L  F +   H++V A+         
Sbjct: 439 LGGAVRGAVEAGLAIKGGGHAMAAGVTLPP---GGLAAFGESLTHDLVEAVGRARAAEAL 495

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            IDG ++A      L+ +++ AGP+G G P PV A P H++    +V   H++    S D
Sbjct: 496 LIDGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRIVDAGIVGNGHVRARLVSGD 555

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 556 GQAVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|220920253|ref|YP_002495554.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           nodulans ORS 2060]
 gi|219944859|gb|ACL55251.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           nodulans ORS 2060]
          Length = 597

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 276/589 (46%), Positives = 368/589 (62%), Gaps = 5/589 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRA-LAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           +  L V  S+ G  W     + G   A + I Q H +P+++ARVL  R V+      FL 
Sbjct: 9   RPLLDVHRSVLGRPWRDRCAEAGPQAAAVTIAQSHGLPEVLARVLAGRGVAPGEVPGFLE 68

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R LMPDP IL D + AA R+  A+   EK+ IFGDYDVDGAAS AL+   L    V 
Sbjct: 69  PRLRDLMPDPSILVDMEAAADRLAHAVLRREKVAIFGDYDVDGAASAALLAGTLRDLGVP 128

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +     EGA L++TVDCG+  +  L  A   G+DV+V+DHH
Sbjct: 129 FRLHIPDRITEGYGPNGEAIRMLAGEGASLLVTVDCGTAGHGPLAEAARLGLDVLVLDHH 188

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSL 241
                  PA A+VNPNRLDDLSG GHLCAAGVVFL LV + R LR+D  +VP   DL++ 
Sbjct: 189 GAPETLPPARAVVNPNRLDDLSGLGHLCAAGVVFLTLVALKRRLRRDGVEVP---DLMAG 245

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATV DVVPL+GLNRA+V +GL V R +G  GL AL++   ++ P  A +LG+++
Sbjct: 246 LDLVALATVADVVPLLGLNRAFVRQGLAVMRGRGRRGLAALLDAAGLAEPPQAWHLGFLV 305

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LG+RLL+ +D  E   +A +LD LN+ R+ +E+A + +AEA    +
Sbjct: 306 GPRINAGGRIGDATLGARLLLCEDPIEAAGIAAQLDQLNRERQAIEAAAVAEAEALAALR 365

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
            +      VIV     WHPG+VGL+AARLKE+FGRP+FA +  EDG   GSGRSI G D+
Sbjct: 366 LERDPDQPVIVAGSPDWHPGVVGLIAARLKERFGRPAFAFALREDGTATGSGRSIIGADL 425

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G+ V  AVE G+  KGGGHAMAAG+T+  V+  R  D   +     V          +DG
Sbjct: 426 GRAVRRAVEAGLAAKGGGHAMAAGVTLAAVDLDRFRDGLSQELAAAVGDARAAQALLVDG 485

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
           VL+A  V   L+  +E AGP+G G P PVFA   H++   R+V   H++     +D  T+
Sbjct: 486 VLSAGGVQPDLVAAVERAGPFGQGAPEPVFALARHRIADARIVGTGHVKAQLRGRDGVTV 545

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            AIAFR    PLG+ L++S G+ +H  G L  + WRG +R QLR+ DA+
Sbjct: 546 GAIAFRAAEGPLGQLLLRSIGRDIHAAGTLSRDRWRGGERVQLRLCDAA 594


>gi|163852181|ref|YP_001640224.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           extorquens PA1]
 gi|163663786|gb|ABY31153.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           extorquens PA1]
          Length = 611

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 268/594 (45%), Positives = 364/594 (61%), Gaps = 9/594 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           + FL V  S  G  W    G  G+   A+ +TQ + +PD++ARVLV R V    A  +L 
Sbjct: 19  RPFLDVTASALGRPWRERCGDPGLQALAVTMTQAYGLPDLLARVLVGRGVRPAEADAYLA 78

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R LMPDP +L D + A  R+  A+   E + IFGDYDVDGA+S AL+  +L    V 
Sbjct: 79  PRLRDLMPDPSVLVDMEAAVERLAYAVRAREAVAIFGDYDVDGASSAALLAGYLRALGVP 138

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DHH
Sbjct: 139 VRIHIPDRITEGYGPNVGAVTMLREEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDHH 198

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLS 240
               E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR+D     + +  L  
Sbjct: 199 GAPEELPQTRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRRDGVFATSTEPRLTD 258

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATV DVVPL GLNRA+VV+GL V R +G PGL AL++   +S P  A +LG++
Sbjct: 259 FLDLVALATVADVVPLTGLNRAFVVQGLAVMRGRGRPGLAALLDAAGLSEPPEAWHLGFL 318

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG++ LG+RLL + D  E   +A +LD LN+ R+ +E+  + +AEA++  
Sbjct: 319 VGPRINAGGRIGDAGLGARLLTTTDPMEARRIADELDRLNRERQAIEAQAVAEAEAEMDA 378

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                    V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G D
Sbjct: 379 HLTRDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGAD 438

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL---ITTPVF 477
           +G  V  AVE G+ VKGGGHAMAAG+T+     G L  F     H++V A+         
Sbjct: 439 LGGAVRGAVEAGLAVKGGGHAMAAGVTLPP---GGLAAFGDSLTHDLVEAVGRARAAEAL 495

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            IDG ++A      L+ +++ AGP+G G P PV A P H++    +V   H++    S D
Sbjct: 496 LIDGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRIVDAGIVGNGHVRARLVSGD 555

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 556 GQAVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|240139513|ref|YP_002963988.1| putative single-strand DNA-specific exonuclease RecJ
           [Methylobacterium extorquens AM1]
 gi|240009485|gb|ACS40711.1| putative single-strand DNA-specific exonuclease RecJ
           [Methylobacterium extorquens AM1]
          Length = 611

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 267/594 (44%), Positives = 364/594 (61%), Gaps = 9/594 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           + FL V  S  G  W    G  G+   A+ +TQ + +PD++ARVLV R V    A  +L 
Sbjct: 19  RPFLDVTASALGRPWRERCGDPGLQALAVTMTQAYGLPDLLARVLVGRGVRPAEADAYLA 78

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R LMPDP +L D + A  R+  A+   E + IFGDYDVDGA+S AL+  +L    V 
Sbjct: 79  PRLRDLMPDPSVLVDMEAAVERLAYAVRARETVAIFGDYDVDGASSAALLADYLRALGVP 138

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DHH
Sbjct: 139 VRIHIPDRITEGYGPNVGAVTTLREEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDHH 198

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLS 240
               E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR+D     + +  L  
Sbjct: 199 GAPEELPQTRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRRDGVFATSAEPRLTD 258

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATV DVVPL GLNRA+VV+GL V R +G PGL AL++   +S P  A +LG++
Sbjct: 259 FLDLVALATVADVVPLTGLNRAFVVQGLAVMRGRGRPGLAALLDAAGLSEPPEAWHLGFL 318

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG++ LG+RLL + D  E   +A +LD LN+ R+ +E+  + +AEA++  
Sbjct: 319 VGPRINAGGRIGDAGLGARLLTTADPMEARRIADELDRLNRERQAIEAQAVAEAEAEMDA 378

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                    V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G D
Sbjct: 379 HLTRDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGAD 438

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL---ITTPVF 477
           +G  V  AVE G+ VKGGGHAMAAG+T+     G L  F +   H++V  +         
Sbjct: 439 LGGAVRSAVEAGLAVKGGGHAMAAGVTLPP---GGLAAFGESLTHDLVETVGRARAAEAL 495

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            IDG ++A      L+ +++ AGP+G G P PV A P H++    +V   H++    S D
Sbjct: 496 LIDGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRIVDAGIVGNGHVRARLVSGD 555

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 556 GQAVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|188582130|ref|YP_001925575.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           populi BJ001]
 gi|179345628|gb|ACB81040.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           populi BJ001]
          Length = 611

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 271/596 (45%), Positives = 373/596 (62%), Gaps = 13/596 (2%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALA--ITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
           + FL V  S+ G  W    G  G  +ALA  +TQ + +PD++ARVLV R V    A+ +L
Sbjct: 19  RPFLDVTASVLGRPWCERCGDPG-QQALATTMTQAYGLPDLLARVLVGRGVGPAEAEAYL 77

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P +R LMPDP +L D + A  R+  A+ + E + IFGDYDVDGA+S AL+  +L    V
Sbjct: 78  SPRLRDLMPDPSVLVDMEAAVDRLAHAVRSREAVAIFGDYDVDGASSAALLADYLRALGV 137

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DH
Sbjct: 138 PVRIHIPDRITEGYGPNVGAVTALRGEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDH 197

Query: 182 HQVKSEEIPAY-ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--L 238
           H    EE+PA  ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR +       +  L
Sbjct: 198 HGAP-EELPATRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRGEGVFASAAEPRL 256

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
              LDLVALATV DVVPL+GLNRA+V++GL V R +G PGL AL++   +S P  A +LG
Sbjct: 257 TDFLDLVALATVADVVPLVGLNRAFVMQGLAVMRARGRPGLAALLDAAGLSEPPEAWHLG 316

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +++GP INAGGRIG++ LG+RLL + DS E   +A +LD LN+ R+ +E+  + +AEA++
Sbjct: 317 FLVGPRINAGGRIGDAGLGARLLTTADSMEARRIADELDRLNRERQAIEAQAVAEAEAEM 376

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
             +        V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G
Sbjct: 377 DARLAGDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVG 436

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL---ITTP 475
            D+G  V  AV  G+ VKGGGHAMAAG+T+     G L  F +  A ++  A+       
Sbjct: 437 ADLGGAVRDAVAAGLAVKGGGHAMAAGVTLPP---GGLAAFGESLARDLTEAVGQARAAE 493

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              IDG ++A      L+ +++ AGP+G G P PV A P H++    VV   H++    S
Sbjct: 494 ALLIDGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRVVDAGVVGNGHVRARLVS 553

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            D + + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 554 GDGQAVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|170741326|ref|YP_001769981.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium sp.
           4-46]
 gi|168195600|gb|ACA17547.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium sp.
           4-46]
          Length = 597

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 277/589 (47%), Positives = 366/589 (62%), Gaps = 5/589 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALA-ITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           +  L V  S+ G  W          +A A I Q H +P+++ARVL  R V+      FL 
Sbjct: 9   RPLLDVHRSVLGRPWRERCADGPPQQAAATIAQSHGLPEVLARVLAGRGVAPRDVPLFLE 68

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R LMPDP +L D + AA R+  A+   EK+ IFGDYDVDGAAS AL+   L    V 
Sbjct: 69  PRLRDLMPDPAVLLDMEAAADRLAHAVLRREKVAIFGDYDVDGAASAALLAGALRDLGVP 128

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +     EGA+L++TVDCG+  +  L  A   G+DVIV+DHH
Sbjct: 129 YRLHIPDRITEGYGPNVEAVRVLAGEGARLLVTVDCGTAGHAPLAEAARLGLDVIVLDHH 188

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSL 241
                  PA A+VNPNRLDDLSG GHLCAAGVVFL LV + R LR+D   +P   DL++ 
Sbjct: 189 GAPESLPPARAVVNPNRLDDLSGLGHLCAAGVVFLTLVALKRRLRRDGVDLP---DLMTG 245

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATV DVVPL GLNRA+V +GL V R +G  GL AL++   +  P  A +LG+++
Sbjct: 246 LDLVALATVADVVPLAGLNRAFVRQGLAVMRGRGRLGLAALLDAAGLGEPPQAWHLGFLV 305

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LG+RLL+ +D  E   +A +LD LN+ R+ +E+A + +AEA    +
Sbjct: 306 GPRINAGGRIGDATLGARLLLCEDPIEAAGIAAQLDQLNRERQAIEAAAVAEAEALTALR 365

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
            +     +VIV     WHPG+VGL+AARLKE+FGRP+FA +  +DG   GSGRSI G D+
Sbjct: 366 LEREPDQAVIVTGSPDWHPGVVGLIAARLKERFGRPAFAFALRQDGSATGSGRSIVGADL 425

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G+ V  AVE G+  KGGGHAMAAG+T+  V+  R  D   +     V          IDG
Sbjct: 426 GRAVRRAVECGLAAKGGGHAMAAGVTIAAVDLDRFRDALARDLAASVGEARAAEALLIDG 485

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            L+A  V   LI  LE AGP+G G P PVFA   H++   R+V   H+++    +D  T+
Sbjct: 486 TLSAGGVQPDLIAALERAGPFGQGAPEPVFALARHRVADARMVGTGHVKVQLRGRDGVTV 545

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            AIAFR    PLG FL++  G+ +H  G L  + WRGS+R QLR+ DA+
Sbjct: 546 PAIAFRAAEGPLGRFLLRGIGRDIHAAGTLARDRWRGSERVQLRLCDAA 594


>gi|218515524|ref|ZP_03512364.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           8C-3]
          Length = 434

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 247/434 (56%), Positives = 314/434 (72%), Gaps = 1/434 (0%)

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLV 220
           TS+DAL  A  + IDV+VIDHHQV  E    +ALVNPNR DDLSGQGHLCAAGVVF+VLV
Sbjct: 1   TSHDALAAAAARDIDVVVIDHHQVTHELPRCHALVNPNREDDLSGQGHLCAAGVVFMVLV 60

Query: 221 LIYRILRQ-DNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGL 279
              R+LR   NK  L  DLL  LD+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL
Sbjct: 61  ATLRLLRAAGNKRILAIDLLQWLDIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGL 120

Query: 280 KALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVL 339
            AL  +  +S P+T  + G++IGP INAGGRIG++ LGSRLL  DD+ E E++A +LD L
Sbjct: 121 AALFRKAGLSGPVTPYHFGFLIGPRINAGGRIGDAALGSRLLTLDDAGEAEVIAQRLDEL 180

Query: 340 NQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSF 399
           N+ R+ ME+ ML++AEA+ L +  D + ASVIV   ++WHPGIVGL+AARLKEKF RP+F
Sbjct: 181 NRERQAMEAMMLQEAEAEALAEYGDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAF 240

Query: 400 AISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDF 459
           AI+F+  G+G GSGRSI GFD+G+MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  F
Sbjct: 241 AIAFDPSGRGTGSGRSINGFDMGRMVRAAVDEGLLVKGGGHAMAAGLTVERADLGRLRTF 300

Query: 460 FQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQ 519
           F + A   V  L+     KIDG + AS   + LID LE+AGPYG+G+  P+FA P H+++
Sbjct: 301 FTEKAARTVANLVANETLKIDGAIGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVR 360

Query: 520 SIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGS 579
             R+V   H+++T E+ D   L  IAFR   T LG  L+ SRG  +HV G L  ++++G+
Sbjct: 361 DARLVGEKHVKVTLEAMDGSRLDGIAFRAADTALGNLLVNSRGASLHVAGTLGADHYQGA 420

Query: 580 KRCQLRVLDASPVE 593
           +R Q+RV DA+P +
Sbjct: 421 RRIQMRVCDAAPAK 434


>gi|170749204|ref|YP_001755464.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655726|gb|ACB24781.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           radiotolerans JCM 2831]
          Length = 605

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 265/593 (44%), Positives = 360/593 (60%), Gaps = 6/593 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALA-ITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           FLGV  S++G RW    G   +   +A + Q H +P+++ARVL  R +  + A   L P 
Sbjct: 13  FLGVAASVTGRRWQERCGGAAVQNQIAKMVQAHGLPELLARVLAGRGIVPEAAPRHLAPR 72

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R LMPDP  L D + A RR+V+A+   E + +FGDYDVDGAAS AL+  +L +  + A 
Sbjct: 73  LRDLMPDPDTLLDMEAAVRRLVRAVKRGETVAVFGDYDVDGAASAALLAGYLRNLGLRAP 132

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN + +     EGA L++ VDCG++ +  L+ A   G+DVIV+DHH  
Sbjct: 133 IHIPDRITEGYGPNVAAITALAAEGATLLVCVDCGTSGHAPLEEAEKFGLDVIVLDHHAA 192

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD----NKVPLNFDLLS 240
                PA A+VNPNRLDDLSG GHLCAAG+VFL LV + R LRQ+    +  P    L  
Sbjct: 193 SEILPPARAVVNPNRLDDLSGLGHLCAAGIVFLTLVALNRALRQEGFFGSHRP-EPQLTD 251

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATV DVVPL GLNRA+V +GL V R +G  GL AL++  ++  P  A +LG++
Sbjct: 252 ALDLVALATVADVVPLTGLNRAFVTQGLTVMRHRGRTGLAALLDAASLGEPPEAWHLGFV 311

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG+S LG+RLL + D  E   +A  LD LN+ R+ +E+  + +AEA++  
Sbjct: 312 LGPRINAGGRIGDSALGARLLTTADPGEAARIAADLDRLNRERQAIEAQAVLEAEAEMDR 371

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                   +V+V     WHPGIVGL+A+RLKE+F RP+FA +   DG   GSGRSI G D
Sbjct: 372 ALTLDPDRTVLVTASADWHPGIVGLIASRLKERFNRPAFAFAIRPDGTATGSGRSIPGAD 431

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  V   VE  +  KGGGHAMAAG+TV   +  R            V          ID
Sbjct: 432 LGLAVRACVEARLASKGGGHAMAAGVTVRADDIPRFEAHLAMLLGASVAVARAADALLID 491

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L+A       + +L+ AGP+G G P P+FA   H+L    VV  +H++    S+D + 
Sbjct: 492 GGLSAGGATAETVRLLQRAGPFGQGAPEPIFALGRHRLVDAGVVGSSHVRARLRSRDGQV 551

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           + AI FR    PLG  L+   G+ MHV G L  + WRG++R QLR++D +P E
Sbjct: 552 VGAICFRAAERPLGLALLNGIGREMHVAGTLSCDRWRGAERAQLRIVDLAPSE 604


>gi|218530939|ref|YP_002421755.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           chloromethanicum CM4]
 gi|218523242|gb|ACK83827.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           chloromethanicum CM4]
          Length = 611

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 268/594 (45%), Positives = 365/594 (61%), Gaps = 9/594 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           + FL V  S  G  W    G  G+   A+ +TQ + +PD++ARVLV R V    A  +L 
Sbjct: 19  RPFLDVTASALGRPWRERCGDPGLQALAVTMTQAYGLPDLLARVLVGRGVRPAEADAYLA 78

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R LMPDP +L D + A  R+  A+   E + IFGDYDVDGA+S AL+  +L    V 
Sbjct: 79  PRLRDLMPDPSVLVDMEAAVERLAHAVRAREAVAIFGDYDVDGASSAALLADYLRALGVP 138

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DHH
Sbjct: 139 VRIHIPDRITEGYGPNVGAVTTLREEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDHH 198

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLS 240
               E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR+D     + +  L  
Sbjct: 199 GAPEELPQTRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRRDRVFATSAEPRLTD 258

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATV DVVPL GLNRA+VV+GL V R +G PGL AL++   +S P  A +LG++
Sbjct: 259 FLDLVALATVADVVPLTGLNRAFVVQGLAVMRGRGRPGLAALLDAAGLSEPPEAWHLGFL 318

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG++ LG+RLL + D  E   +A +LD LN+ R+ +E+  + +AEA++  
Sbjct: 319 VGPRINAGGRIGDAGLGARLLTTADPMEARRIADELDRLNRERQAIEAQAVAEAEAEMDA 378

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                    V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G D
Sbjct: 379 HLTRDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGAD 438

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL---ITTPVF 477
           +G  V  AVE G+ VKGGGHAMAAG+T+     G L  F +   H++V A+         
Sbjct: 439 LGGAVRSAVEAGLAVKGGGHAMAAGVTLPP---GGLAAFGESLTHDLVEAVGRARAAEAL 495

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            IDG ++A      L+ +++ AGP+G G P PV A P H++    +V   H++    S D
Sbjct: 496 LIDGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRVVDAGIVGNGHVRARLVSGD 555

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 556 GQAVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|241762072|ref|ZP_04760156.1| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373538|gb|EER63125.1| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 586

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 252/587 (42%), Positives = 358/587 (60%), Gaps = 17/587 (2%)

Query: 8   GVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRL 67
           GV  S  G  W    GQ         + ++ + D++ R+L+ R    +    + +P I+ 
Sbjct: 7   GVSSSALGQAW-QWRGQNS-----GFSGENPLEDLIDRILITRGCPRESLSAYRDPKIKN 60

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
            MPDP +L D D+AA R+ +AIY  E I+IFGDYDVDGA S ALM+  L    VNA  YI
Sbjct: 61  FMPDPSLLCDMDRAAERLAKAIYKKESIVIFGDYDVDGATSSALMIDLLRQLGVNAGYYI 120

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           PDR+ +GYGP    M K   EGA L++TVDCG+ +Y+AL+ A   G+DV+V+DHHQ + +
Sbjct: 121 PDRVAEGYGPAVQSMRKLAEEGANLVVTVDCGAQAYEALEAAKEAGLDVVVVDHHQCQPQ 180

Query: 188 EIPAYALVNPNRLDDLSGQ--GHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLSLLD 243
              A+A+VNPNRLD+  G   GHL A GV FL+   + R LRQD       +  L++LLD
Sbjct: 181 LPEAHAVVNPNRLDEEEGAQYGHLAAVGVAFLLAAALVRHLRQDGYFSDRPEPKLMALLD 240

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TV DV  L GLNRA+V +GL V   +  PG+ AL++   +S P T  +LG+++GP
Sbjct: 241 LVALGTVADVAALHGLNRAFVAQGLKVMAARYRPGIAALLDVAGVSRPPTTYDLGFILGP 300

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGR+G+S+LG RLL S D  E E LA+ L+  N  RR +E  + E AE      C+
Sbjct: 301 RINAGGRVGKSDLGVRLLTSLDKNECENLALALNQFNLERRSIEQTVTEAAEG----LCE 356

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           +  +  V+VV G+ WHPG++G++A RLK+K+ RP   I  +E+G G GSGRS+ G D+G 
Sbjct: 357 EQVERPVMVVAGEGWHPGVIGIVAGRLKQKYDRPIIVIGIDEEGNGKGSGRSLSGVDLGA 416

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V  A + G+LV GGGHAMAAGL++++        F  +     V          ID VL
Sbjct: 417 AVLSAKQAGLLVNGGGHAMAAGLSIKKNQIEDFATFISERVQKDVETARANKALLIDEVL 476

Query: 484 NASAVNIALIDMLESAGPYGAGNPNP-VFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           +A  VN++LI+ LE+ GPYGAG P+P V A P + +Q+ R++   HL + F+ QD ++ +
Sbjct: 477 SAGGVNLSLIEALEAGGPYGAGWPSPHVVAGPVYAIQT-RILKEKHLSVIFKGQDGQSFK 535

Query: 543 AIAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AIAF    TP+ + ++ + R +++ V G + +N W G K  QL + D
Sbjct: 536 AIAFNAVETPITQIVVAAGRDRKLWVAGKIQLNEWNGRKDAQLHIED 582


>gi|283856427|ref|YP_162966.2| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775429|gb|AAV89855.2| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 586

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 251/587 (42%), Positives = 358/587 (60%), Gaps = 17/587 (2%)

Query: 8   GVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRL 67
           GV  S  G  W    GQ         + ++ + D++ R+L+ R    +    + +P I+ 
Sbjct: 7   GVSSSALGQAW-QWRGQNS-----GFSGENPLEDLIDRILITRGCPRESLSAYRDPKIKN 60

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
            MPDP +L D D+AA R+ +AIY  E I+IFGDYDVDGA S ALM+  L    VNA  YI
Sbjct: 61  FMPDPSLLCDMDRAAERLAKAIYKKESIVIFGDYDVDGATSSALMIDLLRQLGVNAGYYI 120

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           PDR+ +GYGP    M K   EGA L++TVDCG+ +Y+AL+ A   G+DV+V+DHHQ + +
Sbjct: 121 PDRVAEGYGPAVQSMRKLAEEGANLVVTVDCGAQAYEALEAAKEAGLDVVVVDHHQCQPQ 180

Query: 188 EIPAYALVNPNRLDDLSGQ--GHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLSLLD 243
              A+A+VNPNRLD+  G   GHL A GV FL+   + R LRQD       +  L++LLD
Sbjct: 181 LPEAHAVVNPNRLDEEEGAQYGHLAAVGVAFLLAAALVRHLRQDGYFSDRPEPKLMALLD 240

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TV DV  L GLNRA+V +GL V   +  PG+ AL++   +S P T  +LG+++GP
Sbjct: 241 LVALGTVADVAALHGLNRAFVAQGLKVMAARHRPGIAALLDVAGVSRPPTTYDLGFILGP 300

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGR+G+S+LG RLL S D  E E LA+ L+  N  RR +E  + E AE      C+
Sbjct: 301 RINAGGRVGKSDLGVRLLTSLDKNECENLALALNQFNLERRSIEQTVTEAAEG----LCE 356

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           +  +  V+VV G+ WHPG++G++A RLK+K+ RP   I  +E+G G GSGRS+ G D+G 
Sbjct: 357 EQVERPVMVVAGEGWHPGVIGIVAGRLKQKYDRPIIVIGIDEEGNGKGSGRSLSGVDLGA 416

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V  A + G+LV GGGHAMAAGL++++        F  +     V          ID VL
Sbjct: 417 AVLSAKQAGLLVNGGGHAMAAGLSIKKDQIEDFSTFISERVQKDVETARANKALLIDEVL 476

Query: 484 NASAVNIALIDMLESAGPYGAGNPNP-VFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           +A  VN++LI+ LE+ GPYGAG P+P + A P + +Q+ R++   HL + F+ QD ++ +
Sbjct: 477 SAGGVNLSLIEALEAGGPYGAGWPSPHIVAGPVYAIQT-RILKEKHLSVIFKGQDGQSFK 535

Query: 543 AIAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AIAF    TP+ + ++ + R +++ V G + +N W G K  QL + D
Sbjct: 536 AIAFNAVETPITQMVVAAGRDRKLWVAGKIQLNEWNGRKDAQLHIED 582


>gi|163759418|ref|ZP_02166503.1| probable single-stranded-dna-specific exonuclease protein [Hoeflea
           phototrophica DFL-43]
 gi|162283015|gb|EDQ33301.1| probable single-stranded-dna-specific exonuclease protein [Hoeflea
           phototrophica DFL-43]
          Length = 449

 Score =  472 bits (1214), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 314/420 (74%), Gaps = 1/420 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++AFLGVE S+SG +WV+ L Q G N+A++I Q   +PDIVARVL  R V++  A  FL
Sbjct: 30  TERAFLGVEQSLSGQKWVARLDQAGENKAISIAQTTGLPDIVARVLAGRGVAMGDAVAFL 89

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P+I+ LMPDP  LTDCD+AA R+  AI   +++ IFGDYDVDGAAS ALM RF +H  +
Sbjct: 90  DPTIKALMPDPSRLTDCDRAAERLALAIARRQRVAIFGDYDVDGAASSALMQRFFNHFGL 149

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
            + +YIPDRI +GYGPN   + + I  GA LI+TVDCGSTS++AL  A  +G+DV+VIDH
Sbjct: 150 ESEIYIPDRIFEGYGPNAPAIAELIERGAGLIVTVDCGSTSHEALGEAAQRGVDVVVIDH 209

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN-FDLLS 240
           HQ+ +E  PA+ALVNPNR DDLSG GHLCA GVVF+VL    R+LRQ     ++ FDLLS
Sbjct: 210 HQMAAELPPAHALVNPNREDDLSGLGHLCACGVVFMVLAGTLRLLRQQGDARVSGFDLLS 269

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATVCDVVPL GLNRA+VVKGL+ AR  GNPGL AL +R  ++ PI+  +LG++
Sbjct: 270 CLDLVALATVCDVVPLKGLNRAFVVKGLLAARGLGNPGLAALCQRAGVNGPISPYHLGFL 329

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LGSRLL  DD  E + +A +L+ LN+ R+ +E+AMLE+A+A+  T
Sbjct: 330 IGPRINAGGRIGDAALGSRLLALDDPAEAQAIAERLEELNRERQAIEAAMLEEADAEAAT 389

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +    +  +VIV     WHPG+VGLLA+RLKE++ RP+FAI+F+ +GKG GSGRS+ G D
Sbjct: 390 EMQSGEGPAVIVTARQGWHPGVVGLLASRLKERYRRPAFAIAFDGNGKGTGSGRSVPGLD 449


>gi|260752349|ref|YP_003225242.1| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258551712|gb|ACV74658.1| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 586

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 251/587 (42%), Positives = 358/587 (60%), Gaps = 17/587 (2%)

Query: 8   GVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRL 67
           GV  S  G  W    GQ         + ++ + D++ R+L+ R    +    + +P I+ 
Sbjct: 7   GVSSSALGQAW-QWRGQNS-----GFSGENPLEDLIDRILITRGCPRESLSAYRDPKIKN 60

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
            MPDP +L D D+AA R+ +AIY  E I+IFGDYDVDGA S ALM+  L    VNA  YI
Sbjct: 61  FMPDPSLLCDMDRAAERLAKAIYKKESIVIFGDYDVDGATSSALMIDLLRQLGVNAGYYI 120

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           PDR+ +GYGP    M K   EGA L++TVDCG+ +Y+AL+ A   G+DV+V+DHHQ + +
Sbjct: 121 PDRVAEGYGPAVQSMRKLAEEGANLVVTVDCGAQAYEALEAAKEAGLDVVVVDHHQCQPQ 180

Query: 188 EIPAYALVNPNRLDDLSGQ--GHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLSLLD 243
              A+A+VNPNRLD+  G   GHL A GV FL+   + R LRQD       +  L++LLD
Sbjct: 181 LPEAHAVVNPNRLDEEEGAQYGHLAAVGVAFLLAAALVRHLRQDGYFSDRPEPKLMALLD 240

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TV DV  L GLNRA+V +GL V   +  PG+ AL++   +S P T  +LG+++GP
Sbjct: 241 LVALGTVADVAALHGLNRAFVAQGLKVMAARHRPGIAALLDVAGVSRPPTTYDLGFILGP 300

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGR+G+S+LG RLL S D  E E LA+ L+  N  RR +E  + E AE      C+
Sbjct: 301 RINAGGRVGKSDLGVRLLTSLDKNECENLALALNQFNLERRSIEQIVTEAAEG----LCE 356

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           +  +  V+VV G+ WHPG++G++A RLK+K+ RP   I  +E+G G GSGRS+ G D+G 
Sbjct: 357 EQVERPVMVVAGEGWHPGVIGIVAGRLKQKYDRPIIVIGIDEEGNGKGSGRSLSGVDLGA 416

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V  A + G+LV GGGHAMAAGL++++        F  +     V          ID VL
Sbjct: 417 AVLSAKQAGLLVNGGGHAMAAGLSIKKDQIEDFSTFISERVQKDVETARANKALLIDEVL 476

Query: 484 NASAVNIALIDMLESAGPYGAGNPNP-VFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           +A  VN++LI+ LE+ GPYGAG P+P + A P + +Q+ R++   HL + F+ QD ++ +
Sbjct: 477 SAGGVNLSLIEALEAGGPYGAGWPSPHIVAGPVYAIQT-RILKEKHLSVIFKGQDGQSFK 535

Query: 543 AIAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AIAF    TP+ + ++ + R +++ V G + +N W G K  QL + D
Sbjct: 536 AIAFNAVETPITQMVVAAGRDRKLWVAGKIQLNEWNGRKDAQLHIED 582


>gi|83312829|ref|YP_423093.1| single-stranded DNA-specific exonuclease [Magnetospirillum
           magneticum AMB-1]
 gi|82947670|dbj|BAE52534.1| Single-stranded DNA-specific exonuclease [Magnetospirillum
           magneticum AMB-1]
          Length = 597

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 258/592 (43%), Positives = 375/592 (63%), Gaps = 16/592 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+SG RW++  G E + +ALA  Q+ A+P++V RVL +R + +D A+ FLNP+
Sbjct: 13  AFLGVERSLSGRRWLARPGDERLAQALA--QRLALPELVGRVLASRGIGLDEAESFLNPT 70

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L   DKA  R+V A+   E I IFGDYDVDGA S AL+   L+     A 
Sbjct: 71  LRDLLPDPGHLKGMDKAVERLVAAVTRGETIGIFGDYDVDGATSSALLRNALADMGAKAR 130

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   + +  +EG  +++TVDCG+T++DAL+ AT  G+D+IV+DHH  
Sbjct: 131 VYIPDRIKEGYGPNAPALLRLRDEGVAVVVTVDCGTTAFDALETATRAGLDMIVVDHHVG 190

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-----QDNKVPLNFDLL 239
           ++    A A++NPNRLD+ S  GHL A GV FL+ V + R L+     Q    P   DL+
Sbjct: 191 EAALPAALAVINPNRLDETSPHGHLAAVGVAFLLAVGLNRGLKAAGWYQSRPAP---DLM 247

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDLVAL TVCDVVPL+G+NRA VV+GL V  ++ N GL AL +   +     +  LGY
Sbjct: 248 RWLDLVALGTVCDVVPLVGVNRALVVQGLKVMAKRANVGLAALADVAGVKERPDSYTLGY 307

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP +NAGGR+GE+ LG+RL+ +D+  E   +A +LD  N++R+ +E+ +L  A  +V 
Sbjct: 308 VLGPRVNAGGRVGEAELGTRLMSTDNPAEAAEIARQLDGYNKDRQEIEAVVLLDAIEQVE 367

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
           T+ DD +   ++V  G+ WHPG++G++A RLKE++GR +  ++ E D +G GSGRS+ G 
Sbjct: 368 TRPDDGR--PLLVAAGENWHPGVIGIVAGRLKERYGRVACVVALEGD-QGKGSGRSVPGL 424

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFK 478
           D+G  +  A + G+L  GGGHAMAAG TV R     L DF  ++    +   L+  P+ +
Sbjct: 425 DLGSAIIAARQAGLLRAGGGHAMAAGFTVARDKLTALSDFLAERLQAQLEGDLV--PLLE 482

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +DG L+A A  I L++ L   GP+G+GNP P FA    ++    VV   H+++       
Sbjct: 483 LDGALDAGAAGIELVETLAGVGPFGSGNPEPRFAISGARIAKADVVGSGHVRLILTGAGG 542

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + L+AIAFR   + +G  L+ S G   H+ G L V+ W+G+   QL V DA+
Sbjct: 543 KRLKAIAFRAADSEMGHALLSSAGASFHLAGTLRVDTWQGNSSVQLIVDDAA 594


>gi|288957790|ref|YP_003448131.1| single-stranded-DNA-specific exonuclease [Azospirillum sp. B510]
 gi|288910098|dbj|BAI71587.1| single-stranded-DNA-specific exonuclease [Azospirillum sp. B510]
          Length = 616

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 255/596 (42%), Positives = 362/596 (60%), Gaps = 16/596 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFL V  S+SG RW +    E   +A A+TQ   +P+IV RVL  R V+ +  + FLNP+
Sbjct: 24  AFLNVANSLSGKRWQARPCDE--RQAQALTQGRGLPEIVGRVLAARGVTEESCETFLNPT 81

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP    D D AA RI +AI + E + +FGDYDVDGA S AL+ RF      +  
Sbjct: 82  LKALLPDPSRFRDMDPAAERIARAIRDGEPVAVFGDYDVDGATSAALLRRFFRALGADIR 141

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN + + +   EG +L++TVDCG +++ AL+ A    ++V+V+DHH  
Sbjct: 142 VYVPDRIKEGYGPNAAALLRLKGEGVRLVVTVDCGISAFAALEAAAEAELEVVVLDHHAA 201

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-----QDNKVPLNFDLL 239
           +    PA ALVNPNRLD+      LCAAGV F+ +V + R LR     +D   P   +L+
Sbjct: 202 EPRLPPAVALVNPNRLDEDGAYRTLCAAGVTFITIVAVNRALRTSGFYRDRAEP---NLM 258

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDLVAL TVCDVVPL GLNRA V +GL V  R+ NPGL AL +   +     A + GY
Sbjct: 259 EWLDLVALGTVCDVVPLTGLNRALVAQGLKVMARRANPGLAALSDVAGVKEKPDAYHAGY 318

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP +NAGGR+G S+LG+RLL +DD  E   LA +L+  N  RR +E A+L++A  +V 
Sbjct: 319 VLGPRVNAGGRVGASDLGARLLSTDDPVEAMELAQRLEGHNAERRAVEQAVLDEALERVA 378

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE--DGKGIG--SGRS 415
           T+    ++  ++ V G  WHPG++G++AARLKE++ RP+  ++ EE  DG  IG  SGRS
Sbjct: 379 TEAG--RETDLVFVTGAGWHPGVIGIVAARLKERYSRPACVVALEETADGTLIGKASGRS 436

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           + G D+G  V  A +EG+L+ GGGH MAAG TV       L DF        V A    P
Sbjct: 437 VRGVDLGAAVIAARQEGLLLAGGGHRMAAGFTVAGDKIDALRDFLHGRISEQVAAAPLVP 496

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
           + ++DG L+    ++ L+ ML+  GPYG GN  P FA  + ++    VV   H++   + 
Sbjct: 497 MLELDGALSVGGASVGLVTMLDKLGPYGTGNSEPRFAIADARVVRADVVGANHVRCILQG 556

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            D   L+AIAFR   + +G+ L+  RG   H+ G L ++ W GS+  QL + DA+P
Sbjct: 557 NDGARLKAIAFRALDSDMGQALLTGRGTPFHLAGVLRIDRWNGSEGVQLLIDDAAP 612


>gi|84515364|ref|ZP_01002726.1| probable single-stranded DNA-specific exonuclease [Loktanella
           vestfoldensis SKA53]
 gi|84510647|gb|EAQ07102.1| probable single-stranded DNA-specific exonuclease [Loktanella
           vestfoldensis SKA53]
          Length = 586

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 265/598 (44%), Positives = 362/598 (60%), Gaps = 22/598 (3%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            D AFLGV  S++G RWV    QE    A A+ Q   +P  + R L  R V    A  FL
Sbjct: 5   QDHAFLGVAASLTGRRWVGPNAQED-RAAEAMVQATNLPPALCRTLARRGVPSQEAALFL 63

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P++R L+PDP  L D +KAA R +QA+   E+I +F DYDVDG AS AL++ +L    +
Sbjct: 64  APTLRDLLPDPRSLRDMEKAATRFLQAVAGRERIAVFADYDVDGGASAALLIVWLRQRGL 123

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
            A +YIPDRI +GYGPN   M + +     LII VDCG+ S+  +  A     DVIV+DH
Sbjct: 124 RATLYIPDRIDEGYGPNEPAMAE-LAAAHDLIICVDCGTLSHGPIAAAVRA--DVIVLDH 180

Query: 182 HQVKSEEIPA-YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           H +  E +PA YA+VNPNR D+     HLCAAGVVFL+LV   R LR   K     DL++
Sbjct: 181 H-LGGETLPAAYAVVNPNRQDESGDLAHLCAAGVVFLMLVEANRQLRDAGKA--GPDLMA 237

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATV DV PL+G+NRA+V +GL+V  R+   GL AL +   + +  TA +LG++
Sbjct: 238 MLDLVALATVADVAPLVGVNRAFVRQGLVVMARRARVGLTALADVSGLDAAPTAYHLGFL 297

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP +NAGGRIG+++LG+RLL SDD  E   LA  LD LN +RR +E A+ + A A+ L 
Sbjct: 298 LGPRVNAGGRIGKADLGARLLASDDPAEARDLADMLDQLNTDRRAVEQAVRDVAIAQALA 357

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +  D     ++   G+ WHPG+VG++AARLKE   RP+  I   EDG G GSGRS+ G D
Sbjct: 358 RGTD---GPLVWAAGEGWHPGVVGIVAARLKEATNRPAVVIGL-EDGIGKGSGRSVSGID 413

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTV--ERVN--FGRLCDFFQK-FAHNIVPALITTP 475
           +G  +     EG+L+KGGGH MAAGL+V  +R+     RL +   K  A  + PA     
Sbjct: 414 LGAAIQRLASEGLLLKGGGHKMAAGLSVAQDRLEPAMARLAELLDKQGASALGPA----- 468

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
             ++DG+L   A  + L+ +L+ AGP+GAG P P FAFP+ ++   + V   HL+++F  
Sbjct: 469 DLRLDGILMPGAATVDLVTLLDDAGPFGAGAPAPRFAFPDCQILFAKQVGETHLKISFGD 528

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                + AI F     PLG  L+Q  G R H+ G + VN W+G +  QLR+ DA+P  
Sbjct: 529 GLGARIDAICFGAMDGPLGPALLQHNGTRFHLAGRIEVNVWQGRQSVQLRLEDAAPAH 586


>gi|254469311|ref|ZP_05082716.1| single-stranded-DNA-specific exonuclease RecJ [Pseudovibrio sp.
           JE062]
 gi|211961146|gb|EEA96341.1| single-stranded-DNA-specific exonuclease RecJ [Pseudovibrio sp.
           JE062]
          Length = 470

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/446 (52%), Positives = 307/446 (68%), Gaps = 2/446 (0%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           LGV+ S+S   W   L  +G+++ALAI Q+  +P++V RVL  R+V ++ A  FLNPSI+
Sbjct: 16  LGVKKSLSARVWRERLDDQGLSQALAIAQRTELPEVVGRVLAGRSVPLEDASGFLNPSIK 75

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            LMPDP  L D DKA  R+  A+    KI +FGDYDVDGA S AL+ R+L    V  ++Y
Sbjct: 76  DLMPDPSKLVDMDKACARVADALQAGVKIAVFGDYDVDGATSSALLKRYLMQLGVEPDVY 135

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRI+DGYGPNP+ + +    GA+L+ITVDCGSTS++A + A   G++V+V+DHHQV  
Sbjct: 136 IPDRIIDGYGPNPTAINQLHAGGARLLITVDCGSTSFEAFEEAKRLGLEVVVLDHHQVDE 195

Query: 187 EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLSLLDL 244
                +ALVN NR DDLSGQG+L A GV FL LV + R LR+        +  L+ LLDL
Sbjct: 196 NFPEVHALVNANRQDDLSGQGYLAAVGVTFLFLVGLNRELRRRGAFAQRAEPRLMDLLDL 255

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VAL TVCDVVPL GLNRAYVV+GL V  R+ N GL  L +   +S   T  +LGYM+GP 
Sbjct: 256 VALGTVCDVVPLKGLNRAYVVQGLKVMARRENIGLSCLADISRLSGKPTPYHLGYMLGPR 315

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG+S LG +LL SDD  E E +A  L+ LNQ R+ ME+ MLE+ E +   + + 
Sbjct: 316 INAGGRIGDSALGMKLLSSDDRAEGERIAATLERLNQERQAMEAVMLEEGEGQAFQKMEG 375

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
               +V++   D WHPG+VGL+A+RLKE++ RP+FA++F E G G GSGRSI G D+G  
Sbjct: 376 AVPPAVLLTGADGWHPGVVGLIASRLKERYRRPAFAMAFNEQGVGTGSGRSIMGVDLGSA 435

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVER 450
           V  AVE G+LVKGGGHAMAAGLT+++
Sbjct: 436 VRAAVEAGLLVKGGGHAMAAGLTIQK 461


>gi|255264521|ref|ZP_05343863.1| single-stranded-DNA-specific exonuclease RecJ [Thalassiobium sp.
           R2A62]
 gi|255106856|gb|EET49530.1| single-stranded-DNA-specific exonuclease RecJ [Thalassiobium sp.
           R2A62]
          Length = 582

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 267/598 (44%), Positives = 364/598 (60%), Gaps = 22/598 (3%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           M D  FLGV  S++G RWV     +    A A+ Q   +P  + R LV R V    A  F
Sbjct: 1   MVDNGFLGVAASVTGRRWVGPTADQD-RLAQAMAQDSDLPLPICRTLVRRGVPAPEASAF 59

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L P++R LMPDP  L D ++AA R VQA+   EKI IF DYDVDG AS AL++ +L   +
Sbjct: 60  LTPALRDLMPDPRSLLDMERAALRCVQALKKREKIAIFADYDVDGGASAALLLAWLRAMN 119

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
            +A +YIPDRI +GYGPN + M+K  ++   LI+ VDCG+ S+  ++ A  Q  DV+V+D
Sbjct: 120 HDATLYIPDRIDEGYGPNDAAMKKLADQ-HDLIVCVDCGTLSHGPIEAA--QSADVVVLD 176

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLL 239
           HH       PA+++VNPNR D+     HLCAAGVVF++LV   R +RQD+ K P   DL+
Sbjct: 177 HHLGGETLPPAHSVVNPNRQDETGDLAHLCAAGVVFMMLVEANRQMRQDDVKGP---DLM 233

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           S+LDLVALATV DV PLIGLNRA+V  GL V  ++   GL AL +   + +  T+ +LG+
Sbjct: 234 SMLDLVALATVADVAPLIGLNRAFVRTGLQVMAQRKRIGLVALADVARMDAAPTSYHLGF 293

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP +NAGGRIG +++G+RLL S D  E   LA +LD LN  RR +E   +  A    +
Sbjct: 294 LLGPRVNAGGRIGAADMGARLLASTDMNEARALAERLDQLNSERREIEG-QVRAAATDQM 352

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            Q D  Q A ++   GD WHPG+VG++A+R+KE+  RPS  I  + D +G GSGRS+ G 
Sbjct: 353 EQRD--QSAPLVWAAGDGWHPGVVGIIASRIKEQTNRPSIVIGLDGD-EGKGSGRSVSGI 409

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALITT 474
           D+G  +     EG+L+KGGGH MAAGLTV R        RL +   K  A  + P+ +  
Sbjct: 410 DLGAAIQRVAAEGLLIKGGGHKMAAGLTVARAQLEPAMARLSELLGKQGAGELGPSDL-- 467

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K+DGVL  SA    LI  LE AGP+GAG   P FAFP+ ++   + V  +HL++TF 
Sbjct: 468 ---KLDGVLMPSAATPELIAQLEQAGPFGAGASAPRFAFPDVQINFAKRVGDSHLKITFG 524

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
                 ++AI+F  +  PLG  L +  G R H+ G L +N W+G  R QLR+ DA+P 
Sbjct: 525 DGMGARIEAISFGAFDGPLGPTLEKHGGARFHLAGRLEINSWQGRDRVQLRLEDAAPA 582


>gi|46201274|ref|ZP_00055375.2| COG0608: Single-stranded DNA-specific exonuclease [Magnetospirillum
           magnetotacticum MS-1]
          Length = 596

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 255/592 (43%), Positives = 377/592 (63%), Gaps = 16/592 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+SG RW++  G E +  A+ + Q+  +P++V RVL +R + +D A+ FLNP+
Sbjct: 12  AFLGVERSLSGRRWLARPGDERL--AVTLAQRLGLPELVGRVLASRGIGLDEAESFLNPT 69

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L   DKA  R+V+A+  +E I IFGDYDVDGA S AL+   L+     A 
Sbjct: 70  LRDLLPDPGHLKGMDKAVERLVKAVTGAETIGIFGDYDVDGATSSALLKNALADMGAKAR 129

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   + +   EG  ++ITVDCG+T+++ALQ AT  G+D+IV+DHH  
Sbjct: 130 VYIPDRIKEGYGPNAPALLRLKAEGVGVVITVDCGTTAFEALQTATQAGLDMIVVDHHVG 189

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-----QDNKVPLNFDLL 239
           ++    A A++NPNRLD+ S  GHL A GV FL+ V + R L+     Q    P   DL+
Sbjct: 190 EAALPAALAVINPNRLDETSPHGHLAAVGVAFLLAVGLNRGLKAAGWYQSRPAP---DLM 246

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDLVAL TVCDVVPL+G+NRA VV+GL V  ++GN GL AL +   +     +  LGY
Sbjct: 247 RWLDLVALGTVCDVVPLVGVNRALVVQGLKVMAKRGNVGLAALADVAGVKERPDSYTLGY 306

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP +NAGGR+GE+ LG+RL+ ++D+ E   +A +LD  N++R+ +E+ +L  A  +V 
Sbjct: 307 VLGPRVNAGGRVGEAELGTRLMSTEDAAEAAEIARQLDGYNKDRQEIEAVVLLDAIEQVE 366

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
           T+ DD +   +++  G+ WHPG++G++A RLKE++GR +  ++  E G+G GSGRS+ G 
Sbjct: 367 TRPDDGR--PLLMAAGENWHPGVIGIVAGRLKERYGRVACVVAL-EGGQGKGSGRSVPGL 423

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFK 478
           D+G  +  A + G+L+ GGGHAMAAG TV R     L DF  ++    +   L+  P+ +
Sbjct: 424 DLGSAIIAARQAGLLLAGGGHAMAAGFTVARDKLNDLSDFLAERLQAQLEGDLV--PLLE 481

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +DG L+A A  I L++ L   GP+G+GNP P FA    ++    VV   H+++       
Sbjct: 482 LDGALDAGAAGIELVETLAQVGPFGSGNPEPRFAISGARIAKADVVGSGHVRLMLTGAGG 541

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + L+AIAFR   + +G  L+ S G   H+ G L V+ W+G+   QL + DA+
Sbjct: 542 KRLKAIAFRAADSEMGHALLSSAGASFHLAGTLRVDTWQGNSSVQLIIDDAA 593


>gi|296445858|ref|ZP_06887810.1| single-stranded-DNA-specific exonuclease RecJ [Methylosinus
           trichosporium OB3b]
 gi|296256686|gb|EFH03761.1| single-stranded-DNA-specific exonuclease RecJ [Methylosinus
           trichosporium OB3b]
          Length = 607

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 262/589 (44%), Positives = 361/589 (61%), Gaps = 6/589 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           Q FLGVE S+SG  W   L      RA+AI+Q   + D++ARVL  R V+ + A  FL+P
Sbjct: 12  QFFLGVERSLSGRVWRPRLAAAEEGRAIAISQVLGLGDLLARVLAGRGVTQESAPAFLDP 71

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           S+R LMPDPL+L D D A  R+ +A+   E++ +FGDYDVDGAAS AL++ FL       
Sbjct: 72  SLRALMPDPLLLQDMDAAVDRLARAVETGEQVAVFGDYDVDGAASSALLVEFLQAAGCPP 131

Query: 124 N-MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI++GYGPN   + +    GA L++T+DCG+TS++AL +A   G+D IVIDHH
Sbjct: 132 PFLHIPDRILEGYGPNVEAISELRRRGASLLVTLDCGTTSHEALAHARALGLDAIVIDHH 191

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLL 239
           Q   E +P   +VNPNR DDLSG GHLCAAGV F+ LV + R LR  +    V    +LL
Sbjct: 192 QAP-ERLPEAIVVNPNRADDLSGLGHLCAAGVAFMTLVALSRELRVRDFWTGVRPEPELL 250

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           + LDLVALATV DV  L GLNRA+V KGL V + +   GL AL++   +  P    +LG+
Sbjct: 251 AALDLVALATVADVAALHGLNRAFVTKGLAVMKGRRRVGLAALLDAARVDGPPRPMHLGF 310

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
            +GP INAGGRIG++ LG+RLL   D  E   +A +LD LN  R+ +E A LE+AEA+  
Sbjct: 311 ALGPRINAGGRIGDAALGARLLTLRDPIEAARIAAELDRLNGERQALERATLEEAEAEAD 370

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            Q     + S +VV G  WHPGIVG++A+RLK+KF  P+F I  ++     GSGR+  G 
Sbjct: 371 RQLMRSNRLSCLVVAGADWHPGIVGIVASRLKDKFKIPAFVIG-QKGQSCSGSGRASTGV 429

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G+ V  AVE G++ KGGGH  AAG+T+          F        V     +    +
Sbjct: 430 DLGRAVRRAVEAGVIEKGGGHRAAAGVTLAPPRIDAFRVFMNDALEEEVERARASDALLV 489

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG L A   +  L+  LE AGP+G+GNP P+F FP+H++    VV   H+++  +S D  
Sbjct: 490 DGALTARGADADLVRALERAGPFGSGNPEPLFVFPDHRIVDAGVVGSDHVRVRLQSGDGA 549

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            L A+AFR  G  +GE L++ RG  +HV   +    +RG +R + R++D
Sbjct: 550 RLDAVAFRAVGNEIGEALLRGRGDLLHVAARIGTRVYRGVERMETRIVD 598


>gi|99082006|ref|YP_614160.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria sp. TM1040]
 gi|99038286|gb|ABF64898.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria sp. TM1040]
          Length = 603

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 259/600 (43%), Positives = 367/600 (61%), Gaps = 37/600 (6%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALA---ITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
           +FLGVE S++G RWV      G+++A A   + Q+  +P  V +VL  R V    A  FL
Sbjct: 25  SFLGVETSLTGRRWVG----PGVDQARASEHLAQETGLPPAVCQVLARRGVPAHEATGFL 80

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P ++ L+PDP  + D + AA R +QA+   E+I IF DYDVDG +S AL++ +L     
Sbjct: 81  TPQLKDLLPDPRRMKDMETAAARFLQAVERRERIAIFADYDVDGGSSAALLLVYLRQMGQ 140

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
            A +YIPDRI +GYGPN + M     +   LII VDCG+ S+  +  A  +G DV+V+DH
Sbjct: 141 QATLYIPDRIDEGYGPNDAAMAALARD-HDLIICVDCGTLSHGPI--AAAKGADVVVLDH 197

Query: 182 HQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           H +  E +P   A+VNPNR D+    G+ CAAGVVFL+LV + R  R D  +    DL++
Sbjct: 198 H-LGGETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVEVRRQAR-DKGLGAGPDLMA 255

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATV DV PLIG NRA V +GL V  R+  PGL AL +   + +  +  +LG++
Sbjct: 256 MLDLVALATVADVAPLIGANRALVRQGLKVMGRRQRPGLVALADVSRMDAAPSTYHLGFL 315

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEA 356
           +GP +NAGGRIG+++LG+RLL +DD  E   L+ +LD LN  RR +E+A+    LEQAEA
Sbjct: 316 LGPRVNAGGRIGKADLGARLLSTDDPHEAAALSERLDQLNTERRDIENAVRAAALEQAEA 375

Query: 357 KVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRS 415
           +          A ++   G+ WHPG+VG++A+RLKE  GRP+  I  + E+GK  GSGRS
Sbjct: 376 RGF-------DAPLVWAAGEGWHPGVVGIVASRLKEATGRPAVVIGLDGEEGK--GSGRS 426

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPA 470
           + G D+G  +     EG+L+KGGGH MAAGLTV R        RL +   K  A ++ PA
Sbjct: 427 VSGIDLGASIQKVAMEGLLLKGGGHKMAAGLTVARGQLEPAMARLAELLDKQGAGDLGPA 486

Query: 471 LITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQ 530
            +     K+DG+L   A ++ LI+ +E AGP+GAG P P + FP+  ++  + V  +HL+
Sbjct: 487 DL-----KLDGMLMPGAASVELIEQIEQAGPFGAGAPAPRYGFPDVAVRFAKRVGESHLK 541

Query: 531 MTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           ++F       + AIAF  + T LG  L++  G R HV+G L VN W G +  QLR+ DA+
Sbjct: 542 VSFTDGMGGNIDAIAFGAFDTNLGPRLLEHGGARFHVSGRLEVNTWGGRQSAQLRLEDAA 601


>gi|209964606|ref|YP_002297521.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Rhodospirillum centenum SW]
 gi|209958072|gb|ACI98708.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Rhodospirillum centenum SW]
          Length = 601

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 252/594 (42%), Positives = 353/594 (59%), Gaps = 10/594 (1%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           + AFLGV  S++G RW +    E +  AL   Q   +P+IV R+L  R V++D   DFL 
Sbjct: 8   ESAFLGVHSSVTGRRWRARPVDERL--ALTFAQSRGLPEIVGRLLAARGVTLDAVDDFLA 65

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           PS+R  +PDP +L D D AA RI  A+   E I +FGDYDVDGA S AL+ RFL    V 
Sbjct: 66  PSLRTQLPDPSVLRDMDAAAGRIAHAVRTGEGIAVFGDYDVDGATSSALLARFLRALGVE 125

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   + +  ++G +L++TVDCG+T++D L  A   G+DV+V+DHH
Sbjct: 126 PRIHIPDRIAEGYGPNLPALLRLRDQGVRLVVTVDCGTTAFDVLDGAAEAGLDVVVVDHH 185

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQ--GHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--L 238
           + +       ALVNPNRLD+  G   G L A GV FL++V + R LR+D       +  L
Sbjct: 186 KAEPRLPRTVALVNPNRLDEPPGGPLGTLAAVGVTFLLVVAVNRALRRDGFYSGRAEPAL 245

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           L  LDLVAL TVCDVVPL GLNR +V +GL VA R+ NPG++AL +   ++      + G
Sbjct: 246 LDWLDLVALGTVCDVVPLTGLNRVFVAQGLKVAGRRANPGIRALADVAGVTDRFDTYHAG 305

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +++GP +NAGGR+G S+LGSR+L +DD  E   LA +L  LN  RR +E+ +LE+A A V
Sbjct: 306 FIVGPRVNAGGRVGRSDLGSRILSTDDPAEALELARQLHDLNAERRELEAVVLEEALALV 365

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
                D  +  +++  G+ WHPG++G++A+RLKE+F RP+  ++  E G G  SGRS+ G
Sbjct: 366 EGVAGDSPE--LVLAAGEGWHPGVIGIVASRLKERFNRPACVVAL-EGGLGKASGRSVRG 422

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVF 477
            D+G  V  A + G+L+ GGGHAMAAG TVE      L  F  ++    +  A    P  
Sbjct: 423 VDLGAAVIAARQAGLLLAGGGHAMAAGFTVEAARLDDLRAFLRERIGAQLAEAGPLVPTL 482

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            +DG +        L+  LE   PYG GNP P FA  + ++    VV   H++      D
Sbjct: 483 SLDGAIAVRGAGTDLLQHLERLAPYGTGNPEPRFAVTDARIVRADVVGANHVRCILTGPD 542

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
              L+ IAFR     LGE L++S G  +H+ G L  + W G +  QL + DA+P
Sbjct: 543 GARLKGIAFRALDGALGEALLRSGGMPLHLAGTLRADRWNGQEGVQLFIDDAAP 596


>gi|310816884|ref|YP_003964848.1| single-stranded-DNA-specific exonuclease RecJ [Ketogulonicigenium
           vulgare Y25]
 gi|308755619|gb|ADO43548.1| single-stranded-DNA-specific exonuclease RecJ [Ketogulonicigenium
           vulgare Y25]
          Length = 581

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 268/597 (44%), Positives = 356/597 (59%), Gaps = 32/597 (5%)

Query: 5   AFLGVECSISGFRWVSL-LGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +FLGV  S++G  WV   L  + +  AL  +Q+  +   +A +L  R +  D A+ FL P
Sbjct: 2   SFLGVTDSVTGRAWVGPDLETDRLTEAL--SQQLGLSRPLAALLAQRGIDADGAEGFLTP 59

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
            +R LMPDP  L D +KAA R+V A+   ++I IFGDYDVDG AS AL++ +L +  + A
Sbjct: 60  RLRDLMPDPRSLRDMEKAAARLVLAVQTRQRIAIFGDYDVDGGASSALLIDWLRNFGLQA 119

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M         LII VDCG+ S++AL  AT    DVIV+DHH 
Sbjct: 120 TLYIPDRIDEGYGPNVPAMADLAAR-HDLIICVDCGTLSHEALGAAT--AADVIVLDHHL 176

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLL 242
                 PA A+VNPNR D+     +LCAAGVVFL LV   R LR    + P   DL SLL
Sbjct: 177 GGETLPPALAVVNPNRQDESGDLTYLCAAGVVFLALVEANRQLRAGGLQGP---DLTSLL 233

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL+GLNRA V +GL V  R+  PGL AL +   I S  ++ +LGY++G
Sbjct: 234 DLVALATVADVAPLVGLNRALVRQGLAVMGRRARPGLVALADVARIDSAPSSYHLGYILG 293

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKV 358
           P +NAGGRIG ++LG+RLL + D  E   +A +LD LN  RR +ESA+    + QAEA+ 
Sbjct: 294 PRVNAGGRIGRADLGARLLATTDPHEAAAMAAQLDALNTERRAIESAVRDAAIAQAEARG 353

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           L       +A ++    + WHPG+VG++AAR+KE   RPS  I F + G G GSGRS+ G
Sbjct: 354 L-------EAPLVWAASEGWHPGVVGIVAARIKEATNRPSVVIGF-DGGIGKGSGRSVSG 405

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQKFAHNIVPALITT 474
            D+G  +     EG+L+KGGGH MAAGLTV R N      RL +   +       A    
Sbjct: 406 VDLGAAIQRVAAEGLLLKGGGHKMAAGLTVTRENLEPAMARLSELLARQG-----AGAGG 460

Query: 475 PV-FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
           P   +ID +L   A  +A+I+ LE AGP+GA  P P FA P+  +Q ++ V   HL++T 
Sbjct: 461 PSDLRIDALLMPGAATVAMIEQLEQAGPFGASAPAPRFALPDVVVQYVKPVGSDHLKVTL 520

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                  L AIAF    +PLG  L  S  +R+HV G L VN+W+G    QLR+ DA+
Sbjct: 521 GDGLGARLDAIAFNAAQSPLGHLLTHSGSQRVHVVGRLEVNHWQGRASAQLRIEDAA 577


>gi|163742989|ref|ZP_02150372.1| single-stranded-DNA-specific exonuclease RecJ [Phaeobacter
           gallaeciensis 2.10]
 gi|161383672|gb|EDQ08058.1| single-stranded-DNA-specific exonuclease RecJ [Phaeobacter
           gallaeciensis 2.10]
          Length = 580

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 255/596 (42%), Positives = 363/596 (60%), Gaps = 29/596 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S+SG RW+     E    A  + Q+ A+P  V +VL  R V    A  FL P 
Sbjct: 2   SFLGVETSLSGRRWIGP-DVEVARAAEMMEQQTALPAAVCQVLARRGVPSHEASGFLTPQ 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   E+I +F DYDVDG +S AL++ +L+   ++A 
Sbjct: 61  LKELLPDPRRMKDMEPAAARFLQAVERRERIAVFADYDVDGGSSAALLLVWLNQVGLSAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN + M     E   LI+ VDCG+ S+  +  A  +G DVIV+DHH +
Sbjct: 121 LYVPDRIDEGYGPNDAAMAALARE-HDLIVCVDCGTLSHGPI--AAAKGADVIVLDHH-L 176

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +P   A+VNPNR D+    G+ CAAGVVFL+LV + R +R D  +    DL++LLD
Sbjct: 177 GGETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVELRRQMR-DKGLGTGPDLMALLD 235

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PLI  NRA V +GL V   +  PGL AL +   + S  +  +LG+++GP
Sbjct: 236 LVALATVADVAPLIEANRALVRQGLKVMATRQRPGLVALADVSRMDSAPSTYHLGFLLGP 295

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVL 359
            +NAGGRIG+++LG+RLL + D  E E +A +LD LN  RR +E+A+    LEQAEA+ L
Sbjct: 296 RVNAGGRIGKADLGARLLATSDPAEAEAIAARLDELNTERRDIENAVRAAALEQAEARGL 355

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A ++   G+ WHPG+VG++A+RLKE  GRP+  I  + D +G GSGRS+ G 
Sbjct: 356 -------DAPLVWAAGEGWHPGVVGIVASRLKEAAGRPAIVIGLDGD-EGKGSGRSVSGI 407

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALITT 474
           D+G  +  A  EG+L+KGGGH MAAGLTV R        RL +   K  A ++ P+ +  
Sbjct: 408 DLGASIQRAAAEGLLIKGGGHKMAAGLTVAREQLEPAMARLSELLAKQGAGDLGPSDL-- 465

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K+DG+L   A  + LI+ +E AGP+GAG P P + FP+ +++  + V  +HL+++  
Sbjct: 466 ---KLDGMLMPGAATVPLIEQIEQAGPFGAGAPAPRYGFPDLQVRFAKRVGESHLKLSLS 522

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              S  + AI F  + T LG  L+   G R H  G L +N W G +  QLR+ DA+
Sbjct: 523 DGLSSGIDAICFGAFDTALGSRLLDHGGARFHFAGRLEINTWGGRQSVQLRLEDAA 578


>gi|83593743|ref|YP_427495.1| RecJ exonuclease [Rhodospirillum rubrum ATCC 11170]
 gi|83576657|gb|ABC23208.1| RecJ exonuclease [Rhodospirillum rubrum ATCC 11170]
          Length = 606

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 251/596 (42%), Positives = 364/596 (61%), Gaps = 13/596 (2%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            D AFLGVE S  G RWV   G E   +ALAI+Q+  +P++V RVL  R V ++ A  FL
Sbjct: 16  RDAAFLGVERSRGGRRWVLRPGDE--RQALAISQRLGVPEVVGRVLTGRGVQVEEADGFL 73

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P++R L+PDP  L D DKA  R+ +A+ + E I IFGDYDVDGA S ALM RF      
Sbjct: 74  TPTLRALLPDPGHLLDMDKAVARLSKAVRDKETIAIFGDYDVDGATSTALMHRFFRSLGA 133

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDR+++GYGPN   +E    +GA++++TVDCG +++DAL+ A   G+DV+V DH
Sbjct: 134 RVLIHIPDRVLEGYGPNAPALEALAAKGARVVLTVDCGISAFDALRAAKAAGLDVVVCDH 193

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ------DNKVPLN 235
           H+ ++E   A A+VNP RLD+ S   HL A GV FL+ V I R LR       + + P  
Sbjct: 194 HEARTELPAAVAVVNPKRLDEASPHTHLAAVGVAFLMAVAINRDLRDSGWFAAEQRPPP- 252

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DL++LLDLVAL TVCD+VPLIG+NRA V +GL V  ++ NPG+ AL E   +   + A 
Sbjct: 253 -DLMALLDLVALGTVCDMVPLIGVNRALVQQGLKVIAKRTNPGIAALAEVSGVRDRVDAF 311

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
           +LG+M+GP +NAGGR+G++ +G+ LL S+D  E    A +LD  N  R+ +E+A+L QA 
Sbjct: 312 HLGFMLGPRVNAGGRVGQAGMGAALLSSEDPLECLDFARQLDAFNGARKEIEAAVLHQAI 371

Query: 356 AKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRS 415
            +V  +        ++   G  WHPG+VG++A+RLKE++G P+ A++  + G   GSGRS
Sbjct: 372 EQV--EAAPANDLPLVFASGTDWHPGVVGIVASRLKERYGLPACAVAL-DGGLAKGSGRS 428

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           + G D+G++V  A E G+L  GGGHAMAAG ++          F  +   + V AL    
Sbjct: 429 VGGVDLGRVVIAAREAGVLEAGGGHAMAAGFSLRTDRLEEFRQFLGERLKDQVAALALVA 488

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              +DGVL+    N  L+  L  AGPYG+GNP P FA  N ++  + VV + H++     
Sbjct: 489 SLDLDGVLDVRGANAQLVRALSQAGPYGSGNPEPRFAVANARVGKVDVVGMGHVRCFLNG 548

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
               +L+A+AF+   + +G  L+ + G  +HV G L ++ ++G +   L V D +P
Sbjct: 549 PSGGSLKAMAFKAADSEIGHALLTAHGASLHVAGTLRLDSFQGRETVVLVVDDVAP 604


>gi|163738625|ref|ZP_02146039.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Phaeobacter
           gallaeciensis BS107]
 gi|161387953|gb|EDQ12308.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Phaeobacter
           gallaeciensis BS107]
          Length = 580

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 255/596 (42%), Positives = 363/596 (60%), Gaps = 29/596 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S+SG RW+     E    A  + Q+ A+P  V +VL  R V    A  FL P 
Sbjct: 2   SFLGVETSLSGRRWIGP-DVEVARAAEMMEQQTALPAAVCQVLARRGVPSHEASGFLTPQ 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   E+I +F DYDVDG +S AL++ +L+   ++A 
Sbjct: 61  LKELLPDPRRMKDMEPAAARFLQAVERCERIAVFADYDVDGGSSAALLLVWLNQVGLSAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN + M     E   LI+ VDCG+ S+  +  A  +G DVIV+DHH +
Sbjct: 121 LYVPDRIDEGYGPNDAAMAALARE-HDLIVCVDCGTLSHGPI--AAAKGADVIVLDHH-L 176

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +P   A+VNPNR D+    G+ CAAGVVFL+LV + R +R D  +    DL++LLD
Sbjct: 177 GGETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVELRRQMR-DKGLGTGPDLMALLD 235

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PLI  NRA V +GL V   +  PGL AL +   + S  +  +LG+++GP
Sbjct: 236 LVALATVADVAPLIEANRALVRQGLKVMATRQRPGLVALADVSRMDSAPSTYHLGFLLGP 295

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVL 359
            +NAGGRIG+++LG+RLL + D  E E +A +LD LN  RR +E+A+    LEQAEA+ L
Sbjct: 296 RVNAGGRIGKADLGARLLATSDPAEAEAIAARLDELNTERRDIENAVRAAALEQAEARGL 355

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A ++   G+ WHPG+VG++A+RLKE  GRP+  I  + D +G GSGRS+ G 
Sbjct: 356 -------DAPLVWAAGEGWHPGVVGIVASRLKEAAGRPAIVIGLDGD-EGKGSGRSVSGI 407

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALITT 474
           D+G  +  A  EG+L+KGGGH MAAGLTV R        RL +   K  A ++ P+ +  
Sbjct: 408 DLGASIQRAAAEGLLIKGGGHKMAAGLTVARDQLEPAMARLSELLAKQGAGDLGPSDL-- 465

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K+DG+L   A  + LI+ +E AGP+GAG P P + FP+ +++  + V  +HL+++  
Sbjct: 466 ---KLDGMLMPGAATVPLIEQIEQAGPFGAGAPAPRYGFPDLQVRFAKRVGESHLKLSLS 522

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              S  + AI F  + T LG  L+   G R H  G L +N W G +  QLR+ DA+
Sbjct: 523 DGLSSGIDAICFGAFDTALGSRLLDHGGARFHFAGRLEINTWGGRQSVQLRLEDAA 578


>gi|149202133|ref|ZP_01879106.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp.
           TM1035]
 gi|149144231|gb|EDM32262.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp.
           TM1035]
          Length = 582

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 253/597 (42%), Positives = 355/597 (59%), Gaps = 27/597 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S++  RWV   G E    A A+ Q  A+P  + + L    V  D A+ +L P+
Sbjct: 4   AFLGVESSLTSRRWVGP-GVEADRLAEAMAQATALPRPLCQTLARLGVPEDAAEAYLTPT 62

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV-NA 123
           +R L+PDP  L D ++AA R ++A+   E+I IF DYDVDG  S AL++ +L      + 
Sbjct: 63  LRDLLPDPRALRDMEQAAARFLKALRGGERIAIFADYDVDGGTSAALLIDWLRQMRAPSP 122

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M         LI+ VDCG+ S++A+  AT  G DV+V+DHH 
Sbjct: 123 TLYIPDRIDEGYGPNVPAMSDLAAR-HDLIVCVDCGTLSHEAIAAAT--GADVVVLDHHL 179

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
                 PA+A+VNPNR D+     HLCAAGVVFL+LV   R LR         DL+++LD
Sbjct: 180 GGETLPPAHAVVNPNRQDESGDLAHLCAAGVVFLMLVEAGRQLRDSGAQ--GPDLMAMLD 237

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PLIG+NRA+V +GL V   +  PGL AL +   + +   A +LG+++GP
Sbjct: 238 LVALATVADVAPLIGVNRAFVRQGLRVMATRARPGLVALADVARMDTAPNAYHLGFLLGP 297

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMES----AMLEQAEAKVL 359
            +NAGGRIG+++LG+RLL  D+  E   +A +LD LN  RR +E+    A L QAEA+ L
Sbjct: 298 RVNAGGRIGKADLGARLLACDNPAEARAMAERLDQLNTERREVEAQVRDAALAQAEARGL 357

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A ++   G+ WHPG+VG++A+RLKE+  RP+  I  + D +G GSGRS+ G 
Sbjct: 358 -------DAPLVWAAGEGWHPGVVGIVASRLKERANRPAIVIGLDGD-EGKGSGRSVSGV 409

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVER----VNFGRLCDFFQKFAHNIVPALITTP 475
           D+G  +     EG+L+KGGGH MAAGLTV R        RL +   K    +  A     
Sbjct: 410 DLGAAIQRLASEGLLIKGGGHKMAAGLTVARERLEAAMARLSELLAKQGAGVGGAAD--- 466

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
             ++DG+L   A  + L++ +E+AGP+GAG P P + FP+ ++   + ++ AHL++ F  
Sbjct: 467 -LRLDGLLMPGAAAVELVEQIEAAGPFGAGAPGPRYVFPDCQITFAKALSGAHLKLRFGD 525

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
               +L AIAF     PLG  L+   G R H+ G L +N W G +  QLR+ DA+P 
Sbjct: 526 GMGASLDAIAFGALDGPLGPALLNHGGARFHLAGRLDLNSWGGRQTVQLRLEDAAPA 582


>gi|114764216|ref|ZP_01443454.1| single-stranded-DNA-specific exonuclease RecJ [Pelagibaca
           bermudensis HTCC2601]
 gi|114543368|gb|EAU46384.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp.
           HTCC2601]
          Length = 581

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 249/591 (42%), Positives = 354/591 (59%), Gaps = 12/591 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           ++LGVE S++G RWV   G E   +A A+ Q+  +P  + +VL    V       +L P+
Sbjct: 2   SYLGVEASLTGRRWVGP-GVEQERQAEALAQQSNLPRGLCQVLARLGVEAPEVAGYLAPT 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R++ A+   E+I +F DYDVDG  S AL++ +L    + A 
Sbjct: 61  LRDLLPDPRSLRDMETAATRVLAAVKRRERIAVFADYDVDGGTSAALLLDWLHQLGLGAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   MEK  + G  LII VDCG+ S+  +  A  +G DV+V+DHH +
Sbjct: 121 LYIPDRIDEGYGPNEPAMEKLAS-GHDLIICVDCGTLSHGPI--AAAKGADVVVLDHH-L 176

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +P   A+VNPNR D+     HLCAA VVFL+LV   R +R+  +     DL+++LD
Sbjct: 177 GGETLPDCVAVVNPNRQDEDGALAHLCAAAVVFLMLVECGRQMREAGQ--RGPDLMAMLD 234

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL G+NRA V +GL V  R+  PGL AL +   + +  ++ +LGY++GP
Sbjct: 235 LVALATVADVAPLKGVNRALVRQGLAVMARRARPGLVALSDVARLDTAPSSYHLGYVLGP 294

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            +NAGGRIG++++G+RLL S D  E E LA +LD LN  RR +E A+   A A+   +  
Sbjct: 295 RVNAGGRIGQADIGARLLASRDRHESEALAARLDQLNTERREVEEAVRAAALAQAEARGL 354

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           D   A ++   G+ WHPG+VG++A+RLKE   RP+  I  + D +G GSGRS+ G D+G 
Sbjct: 355 D---APLVWAAGEGWHPGVVGIVASRLKELTNRPAVVIGLDGD-EGKGSGRSVSGVDLGA 410

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +     +G+L+KGGGH MAAGLTV R       +   +               K+DG+L
Sbjct: 411 SIQRLAADGLLLKGGGHKMAAGLTVARDGLEAAMERLSELLAKQGAGQGGAADLKLDGLL 470

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
              A NI L + +E AGP+GAG P P FA P+ ++   + V   HL+++F       + A
Sbjct: 471 MPGAANIELCEQMEQAGPFGAGAPAPRFAMPDVQVGFAKQVGSGHLKVSFGDGLGAKIDA 530

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
           I F  +  PLG+ L   RG+R HV G L +N W G +  Q+R+ DA+P EG
Sbjct: 531 ICFGAFDGPLGQALCDHRGRRFHVAGRLEINEWNGRRSVQMRLEDAAPAEG 581


>gi|89069140|ref|ZP_01156513.1| probable single-stranded DNA-specific exonuclease [Oceanicola
           granulosus HTCC2516]
 gi|89045313|gb|EAR51379.1| probable single-stranded DNA-specific exonuclease [Oceanicola
           granulosus HTCC2516]
          Length = 591

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 266/600 (44%), Positives = 364/600 (60%), Gaps = 34/600 (5%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           +AFL V  S++G RWV      G +R   A+ Q   + D VARVLV  NV+ + A  +L+
Sbjct: 13  EAFLSVATSVTGRRWVGP--APGADRLTEALVQATGLADPVARVLVRLNVAPETATAYLS 70

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R L+PDPL L D   AA R +QA+  +E+I IF DYDVDG AS AL++ +L      
Sbjct: 71  PALRDLLPDPLTLRDMHAAAARFLQAVARNERIAIFADYDVDGGASAALLLTWLRAMGRR 130

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPN   M     E   LI+ VDCG+ S++ +  A  +G DV+++DHH
Sbjct: 131 ATLYIPDRIDEGYGPNVPAMRALARE-HDLIVCVDCGTLSHEPV--AAAEGADVVILDHH 187

Query: 183 QVKSEEIPA-YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-QDNKVPLNFDLLS 240
            +  E +PA  A+VNPNR D+    GHLCAA VVFL+LV   R LR Q  K P   +LL 
Sbjct: 188 -LGGETLPAALAVVNPNRQDEDGALGHLCAAAVVFLMLVEAGRQLREQGAKGP---NLLE 243

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATV DV PLIG+NRA V +GL V  ++  PGL AL +   + +  T+  LGY+
Sbjct: 244 FLDLVALATVADVAPLIGVNRALVRQGLAVMAQRRRPGLVALADVARLDTAPTSYTLGYV 303

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEA 356
            GP +NAGGRIG ++LG+RLL +DD  E   LA +LD LN  RR +E+A+    LEQAE 
Sbjct: 304 FGPRVNAGGRIGAADLGARLLATDDPHEAAALAQRLDALNTERREIEAAVRDAALEQAEG 363

Query: 357 KVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSI 416
           + L          ++   G+ WHPG+VG++AARLKE  GRP+  I  + D +G GSGRS+
Sbjct: 364 RGL-------DGPLVWAAGEGWHPGVVGIVAARLKEATGRPAVVIGLDGD-EGKGSGRSV 415

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFF-QKFAHNIVPAL 471
            G D+G  +     EG+L+KGGGH MAAGLTV R        RL +   ++ A  + PA 
Sbjct: 416 GGIDLGAAIHKVAGEGLLLKGGGHRMAAGLTVARDRLEPAMTRLSELLARQGAGRLGPAD 475

Query: 472 ITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQM 531
           +     ++DG+L   A  + L + LE  GP+G G P P FAFP  ++   R V   HL++
Sbjct: 476 L-----RLDGLLMPGAATVELCESLERCGPFGQGAPAPRFAFPGVRITQAREVGTGHLKV 530

Query: 532 TFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            F+      + AIAF     P+G+ L+Q  G R H+ G L +N W+G +R Q+++ DA+P
Sbjct: 531 RFDDGFGGGIDAIAFNALEGPMGQCLVQHGGARFHLAGRLEINVWQGRQRVQVKLEDAAP 590


>gi|119384612|ref|YP_915668.1| single-stranded-DNA-specific exonuclease RecJ [Paracoccus
           denitrificans PD1222]
 gi|119374379|gb|ABL69972.1| exonuclease RecJ [Paracoccus denitrificans PD1222]
          Length = 580

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 257/590 (43%), Positives = 360/590 (61%), Gaps = 15/590 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEG-INRAL-AITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           AFL VE S++G  W    G E  + RA  A+ Q   +P  V+RVL  R V    A  +L+
Sbjct: 3   AFLSVESSLTGRLW---RGPEATLERAAEALAQDSRLPLPVSRVLAARGVPAHEAPLYLD 59

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R L+PDP  L D DKAA R+V A+   ++I IF DYDVDG AS AL++ +L     +
Sbjct: 60  PKLRDLLPDPSSLRDMDKAAERLVAAVLAGQRIAIFADYDVDGGASAALLLDWLRRQGRD 119

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPN   +   +++G  LII VDCG+ S++AL  A+    DVIV+DHH
Sbjct: 120 ATLYIPDRIDEGYGPNAPAIAS-LSQGHDLIICVDCGTLSHEALAAAS---CDVIVLDHH 175

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
           Q      P  A+VNPNR D+    GHLCAAGVVFL LV    +LR+D       DL+ LL
Sbjct: 176 QGGETLPPVLAVVNPNRADEDGSLGHLCAAGVVFLTLVRCNSLLRRDGHP--QPDLIPLL 233

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL+G+NRA+V +GL+V  R+  PGL AL +   + S   A +LG+++G
Sbjct: 234 DLVALATVADVAPLVGVNRAFVRQGLLVMARRERPGLVALSDVARLDSAPNAFHLGFLLG 293

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGR+G ++LG+  L   D ++ E LA +LDVLN++RR +E+A+ ++A A+V  + 
Sbjct: 294 PRINAGGRVGRADLGALCLSCTDGRQAERLAAELDVLNRDRRAIEAAVRDEALAQVEARA 353

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D   + V    GD WHPG+VG++AAR+KE  G PS  I   E G G GS RS+ G D+G
Sbjct: 354 SD---SLVAWAAGDGWHPGVVGIVAARVKEATGLPSVVIGV-EGGIGKGSARSVPGVDLG 409

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           + +     EG+L+KGGGHAMAAGLT+E        +   +     +         +I G+
Sbjct: 410 RAIQRLSAEGLLLKGGGHAMAAGLTIEEAKIPAAMERLSQLLSREMAERPGAGELRISGL 469

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           ++ +   + L+ MLE AGP+G   P P FAF    + S   +  +HL++ F S  S  L+
Sbjct: 470 MDPAGATVELMQMLERAGPFGQAAPAPRFAFAEQLIDSAGAMGDSHLRLRFRSPGSPVLE 529

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           A+A+     PLG  L+ +RG+  H+ G L ++ W G +R +LR+ DA+PV
Sbjct: 530 AVAWGAMNGPLGPALLGARGRCFHLAGKLELSQWGGRERVRLRLDDAAPV 579


>gi|259416462|ref|ZP_05740382.1| single-stranded-DNA-specific exonuclease RecJ [Silicibacter sp.
           TrichCH4B]
 gi|259347901|gb|EEW59678.1| single-stranded-DNA-specific exonuclease RecJ [Silicibacter sp.
           TrichCH4B]
          Length = 580

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 253/599 (42%), Positives = 359/599 (59%), Gaps = 35/599 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALA---ITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
           +FLGVE S++G  W+      G+ +A A   + Q+  +P  V +VL  R V    A  FL
Sbjct: 2   SFLGVETSLTGRSWIG----PGVEQARAGEHLAQETGLPPAVCQVLARRGVPAHEATGFL 57

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P ++ L+PDP  + D + AA R +QA+   E+I IF DYDVDG +S AL++ +L     
Sbjct: 58  TPQLKELLPDPRRMKDMETAAARFLQAVERRERIAIFADYDVDGGSSAALLLVYLRQMGQ 117

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
            A +YIPDRI +GYGPN   M     +   LI+ VDCG+ S+  +  A  +G DV+V+DH
Sbjct: 118 QATLYIPDRIDEGYGPNDEAMAALARD-HDLIVCVDCGTLSHGPI--AAAKGADVVVLDH 174

Query: 182 HQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           H +  E +P   A+VNPNR D+    G+ CAAGVVFL+LV + R  R+   +    DL++
Sbjct: 175 H-LGGETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVEVRRQAREKG-LGAGPDLMA 232

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATV DV PLIG NRA V +GL V  R+   GL AL +   + S  +  +LG++
Sbjct: 233 MLDLVALATVADVAPLIGANRALVRQGLKVMGRRQRAGLVALADVSRMDSAPSTYHLGFL 292

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEA 356
           +GP +NAGGRIG+++LG+RLL +D+  E   LA +LD LN  RR +E+A+    LEQAE 
Sbjct: 293 LGPRVNAGGRIGKADLGARLLSTDNPHEAAALAERLDQLNTERRDIENAVRAAALEQAEE 352

Query: 357 KVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSI 416
           +          A ++   G+ WHPG+VG++A+RLKE  GRP+  I  + D +G GSGRS+
Sbjct: 353 RGF-------DAPLVWAAGEGWHPGVVGIVASRLKEATGRPAVVIGLDGD-EGKGSGRSV 404

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPAL 471
            G D+G  +     EG+L+KGGGH MAAGLTV R        RL +   K  A ++ PA 
Sbjct: 405 SGIDLGASIQKVAMEGLLLKGGGHKMAAGLTVARDQLEPAMARLAELLDKQGAGDLGPAD 464

Query: 472 ITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQM 531
           +     K+DG+L   A  + LI+ +E AGP+GAG P P + FP+  ++  + V  +HL++
Sbjct: 465 L-----KLDGMLMPGAATVELIEQIEQAGPFGAGAPAPRYGFPDLAVRFAKRVGESHLKV 519

Query: 532 TFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +F       + AIAF  + T LG  L++  G R HV G L VN W G +  QLR+ DA+
Sbjct: 520 SFTDGMGGNIDAIAFGAFDTNLGPRLLEHGGARFHVAGRLEVNTWGGRQSAQLRLEDAT 578


>gi|254486182|ref|ZP_05099387.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           GAI101]
 gi|214043051|gb|EEB83689.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           GAI101]
          Length = 579

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 256/598 (42%), Positives = 362/598 (60%), Gaps = 30/598 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGV+ S++G RWV   G E    +  + Q+ ++P  + +VL  R V    A+ FL PS
Sbjct: 2   SFLGVDASLTGRRWVGP-GVEVERASEVLGQQTSLPPALCQVLARRGVGPAEAEGFLAPS 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D +KAA R + A+   ++I +F DYDVDG +S AL++ +L     +A 
Sbjct: 61  LRDLLPDPRSLRDMEKAATRFLAAVKARQRIAVFADYDVDGGSSAALLLVWLRDMGCSAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN   M     +   LI+ VDCG+ S+  +  A   G +VIV+DHH +
Sbjct: 121 LYVPDRIDEGYGPNDEAMAALAAK-HDLIVCVDCGTLSHGPIAAAV--GAEVIVLDHH-L 176

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLL 242
            +E +P A+A+VNPNR D+     HLCAAGVVFL+LV   R LR+   K P   DL++LL
Sbjct: 177 GAETLPDAHAVVNPNRQDEDGALAHLCAAGVVFLMLVEAGRQLREAGAKGP---DLMALL 233

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PLIG+NRA+V +GL V  R+   GL AL +   + +  ++ +LG+++G
Sbjct: 234 DLVALATVADVAPLIGVNRAFVRQGLRVMARRDRLGLAALADAARMDTAPSSYHLGFLLG 293

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKV 358
           P INAGGRIG+++LG+RLL   D  E   LA +LD LN  RR +E+A+    L+QAE + 
Sbjct: 294 PRINAGGRIGQADLGARLLACSDPHEAAALAERLDTLNTERRDVEAAVRAAALDQAEVRG 353

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
                    A ++   GD WHPG+VG++A+RLKE   RPS  I F EDG G GSGRS+ G
Sbjct: 354 F-------DAPLVWASGDGWHPGVVGIVASRLKEASNRPSIVIGF-EDGIGKGSGRSVSG 405

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVE----RVNFGRLCDFFQKFAHNIVPALITT 474
            D+G  +     EG+L+KGGGH MAAGLTV          RL +   K   ++  A    
Sbjct: 406 IDLGAPIQRLAAEGLLIKGGGHKMAAGLTVAEDKLEAAMARLSELLAKQGAHLGGAAD-- 463

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              ++DG+L  +A  + L + +E AGP+GAG P P +AF + +++    V  +HL+++F 
Sbjct: 464 --LRLDGMLMPAAATVELAEQIEQAGPFGAGAPAPRYAFADMQIRYANRVGESHLKISFG 521

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
                 L AIAF  +  P+G  L    G R H+ G L +N WRG +  QLR+ DA+P 
Sbjct: 522 DGSGTKLDAIAFGAFDGPMGPALENHGGARFHLAGRLDINSWRGRQSVQLRLEDAAPA 579


>gi|260434121|ref|ZP_05788092.1| single-stranded-DNA-specific exonuclease RecJ [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417949|gb|EEX11208.1| single-stranded-DNA-specific exonuclease RecJ [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 580

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 260/594 (43%), Positives = 361/594 (60%), Gaps = 26/594 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALA-ITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +FL VE S++G RWV    +  ++RA   + Q+  +P  + +VL  R V+   A+ FL P
Sbjct: 2   SFLSVEHSLTGRRWVGPPPE--MDRAAEMLAQQTDLPRPLCQVLARRGVTPAEAESFLAP 59

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
            +R L+PDP  L D + AA R +QA+   ++I IF DYDVDG +S AL++ +L    +NA
Sbjct: 60  KLRDLLPDPRELKDMETAAARFLQAVRQKQRIAIFADYDVDGGSSAALLIVWLRQMGLNA 119

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN   M +       LII VDCG+ S+DA+  A  QG DVIV+DHH 
Sbjct: 120 TLYVPDRIDEGYGPNAPAMAQLAAT-HDLIICVDCGTLSHDAI--AAAQGADVIVLDHH- 175

Query: 184 VKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSL 241
           +  E +P   A+VNPNR D+     +LCAA VVFL+LV   R LR    K P   DL+++
Sbjct: 176 LGGETLPDCVAVVNPNRQDESGDLAYLCAAAVVFLMLVEAGRQLRAAGTKGP---DLMAM 232

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATV DV PL+G+NRA V +GL V  R+  PGL AL +   + +   + +LG+++
Sbjct: 233 LDLVALATVADVAPLVGVNRALVQQGLKVMARRQRPGLVALSDVARMDTAPNSYHLGFLL 292

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP +NAGGRIG+++LG+RLL +D   E E LA +LD LN  RR +E+A+   A A+   +
Sbjct: 293 GPRVNAGGRIGQADLGARLLSTDSPAEAEALAKRLDALNTERRDIENAVRAAALAQAEDR 352

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
             D   A ++   GD WHPG+VG++A+RLKE   RP+  I F+ D +G GSGRS+ G D+
Sbjct: 353 GLD---APLVWAAGDGWHPGVVGIVASRLKETANRPAIVIGFDGD-EGKGSGRSVSGVDL 408

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALITTPV 476
           G  +     EG+LVKGGGH MAAGLTV R        RL +   K  A    PA +    
Sbjct: 409 GAAIHRLASEGLLVKGGGHKMAAGLTVMRDQLEPAMARLSELLAKQGAGEGGPADL---- 464

Query: 477 FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ 536
            K+DGVL   A  +ALI+ +E AGP+GAG P P FA P+ +++  + V   HL+++    
Sbjct: 465 -KLDGVLMPGAATVALIEQIEQAGPFGAGAPAPRFALPDLQIRFAKRVGETHLKLSLSDG 523

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
               + AIAF  +  P+G+ L    G R H  G L VN W G +  QLR+ DA+
Sbjct: 524 MGGGIDAIAFGAFDGPMGDRLANHGGARFHFAGRLEVNTWGGRQSVQLRLEDAA 577


>gi|163746061|ref|ZP_02153420.1| single-stranded-DNA-specific exonuclease RecJ [Oceanibulbus
           indolifex HEL-45]
 gi|161380806|gb|EDQ05216.1| single-stranded-DNA-specific exonuclease RecJ [Oceanibulbus
           indolifex HEL-45]
          Length = 579

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 258/594 (43%), Positives = 357/594 (60%), Gaps = 26/594 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAI-TQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +FLGVE S++G RW+    +  + RA  +  Q+  +PD V +VL  R V    A  FL P
Sbjct: 2   SFLGVETSLTGRRWIGPDVE--LTRATELLVQRAGLPDPVCQVLARRGVVDTEAAGFLAP 59

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDP  L D + AA R ++A++  E+I IF DYDVDG +S AL++ +L      A
Sbjct: 60  ALRDLLPDPRSLRDMEAAATRFLEALHKRERIAIFADYDVDGGSSAALLLVWLRDMGHRA 119

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M     E   LI+ VDCG+ S+  +  A  +G DVIV+DHH 
Sbjct: 120 TLYIPDRIDEGYGPNDEAMSALAAE-HDLIVCVDCGTLSHGPI--AAAKGADVIVLDHH- 175

Query: 184 VKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
           +  E +P A A+VNPNR D+     HLCAA VVFL+LV   R LR+ ++     DL+S+L
Sbjct: 176 LGGETLPDALAVVNPNRQDEDGTLAHLCAAAVVFLMLVEAGRQLRETSRK--GPDLMSML 233

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLV LATV DV PLIG+NRA+V +GL V  R+  PGL AL +   + +  TA +LG+++G
Sbjct: 234 DLVGLATVADVAPLIGVNRAFVRQGLKVMARRARPGLAALADVARMDTAPTAYHLGFLLG 293

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG+++LG+RLL + D  E   LA +LD LN +RR +E+A+     A  + Q 
Sbjct: 294 PRINAGGRIGQADLGARLLATADPNEAAALAERLDQLNTDRREVEAAV----RASAMAQA 349

Query: 363 DDIQ-QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
           +D      +    G  WHPG+VG++A+RLKE   RPS  I   EDG G GSGRSI G D+
Sbjct: 350 EDRGFDGPLAWAAGPGWHPGVVGIVASRLKEASNRPSIVIGV-EDGIGKGSGRSISGIDL 408

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVE----RVNFGRLCDFFQK-FAHNIVPALITTPV 476
           G  +     EG+L+KGGGH MAAGLTV          RL +   K  AH   PA +    
Sbjct: 409 GAPIQRLAAEGLLMKGGGHKMAAGLTVAEDKIEAAMKRLGELLSKQGAHLAGPADLN--- 465

Query: 477 FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ 536
             + G++   A  + L +M++ AGP+GAG P P +AF + +++  + V   HL+++F   
Sbjct: 466 --LCGMMMPGAATVELAEMVDQAGPFGAGAPAPRYAFADMQIRFAKRVGENHLKVSFGDG 523

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
               L+AIAF  Y  PLG  L    G R H+ G L +N +RG +  QLR+ DA+
Sbjct: 524 LGANLEAIAFGAYDGPLGPALENHGGARFHLAGRLDINNFRGRRSVQLRLEDAA 577


>gi|254512010|ref|ZP_05124077.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacteraceae
           bacterium KLH11]
 gi|221535721|gb|EEE38709.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacteraceae
           bacterium KLH11]
          Length = 580

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 261/594 (43%), Positives = 362/594 (60%), Gaps = 26/594 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+SG RWV   G E    A  + Q+  +P  V +VL  R V    A  FL P 
Sbjct: 2   AFLGVEQSLSGRRWVGP-GVEVERAAEMMVQQTDLPRAVCQVLARRGVPAMEATGFLEPR 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP ++ D ++AA R ++A+ N ++I +F DYDVDG +S AL++ +L    V A 
Sbjct: 61  LKELLPDPRLMKDMEQAATRFLEAVRNRQRIAVFADYDVDGGSSAALLLVWLRQMGVQAT 120

Query: 125 MYIPDRIVDGYGPN-PSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           +Y+PDRI +GYGPN P++ E  +     LII VDCG+ S++ +  A  +G DVIV+DHH 
Sbjct: 121 LYVPDRIDEGYGPNIPAMQE--LAAAHDLIICVDCGTLSHEPI--AAAKGADVIVLDHH- 175

Query: 184 VKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSL 241
           +  E +P   A+VNPNR D+    G+ CAA VVFL+LV   R +R    K P   DL++L
Sbjct: 176 LGGETLPDCVAVVNPNRQDESGDLGYFCAAAVVFLMLVEAGRQVRAAGAKGP---DLMAL 232

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATV DV PLIG NRA V +GL V  R+  PGL AL +   + S  ++ +LG+++
Sbjct: 233 LDLVALATVADVAPLIGANRALVRQGLKVMARRQRPGLVALSDVSRMDSAPSSYHLGFLL 292

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP +NAGGRIG+++LG+RLL +D   E E L+ +LD LN  RR +E+A+   A A+   +
Sbjct: 293 GPRVNAGGRIGQADLGARLLSTDSITEAEALSQRLDALNTERREIENAVRAAALAQAEER 352

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
             D   A ++   G+ WHPG+VG++A+RLKE   RP+  I F+ D +G GSGRSI G D+
Sbjct: 353 GLD---APLVWAAGEGWHPGVVGIVASRLKEAANRPAIVIGFDGD-EGKGSGRSISGVDL 408

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALITTPV 476
           G  +     EG+LVKGGGH MAAGLTV R        RL +   K  A    PA +    
Sbjct: 409 GASIQRLASEGLLVKGGGHKMAAGLTVMRDQLEPAMARLSELLAKQGAGQSGPADL---- 464

Query: 477 FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ 536
            K+DG L  +A  + LI+ +E AGP+GAG P P +A P+ +++  + V   HL+++    
Sbjct: 465 -KLDGTLMPAAATVDLIEQIEQAGPFGAGAPAPRYALPDLQVRFAKRVGETHLKLSLSDG 523

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            S  L AIAF  +  PLG+ L    G R H  G L VN W G +  QLR+ DA+
Sbjct: 524 MSGGLDAIAFGAFDGPLGDRLSNHGGARFHFAGRLEVNSWGGRQSVQLRLEDAA 577


>gi|254461162|ref|ZP_05074578.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium HTCC2083]
 gi|206677751|gb|EDZ42238.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 580

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 256/599 (42%), Positives = 355/599 (59%), Gaps = 34/599 (5%)

Query: 6   FLGVECSISGFRWVS---LLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           FL VE S++G RWV     + ++G     AI Q   +P  +  VL  R V+   A  FL 
Sbjct: 4   FLNVERSLTGRRWVGPDLKVARQG----EAIAQATGLPAPLCNVLAKRGVTPQDADAFLA 59

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+++ L+P+P  L D +KA  RI+ A+   +KI IF DYDVDG  S AL++ +L H   +
Sbjct: 60  PTLKDLLPNPRSLRDMEKATARILAAVKARQKIAIFADYDVDGGTSAALIIDWLRHFDQS 119

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPN   M   +     LII VDCG+ S+  +  A   G DV+V+DHH
Sbjct: 120 ATLYIPDRIDEGYGPNDEAM-AMLAAAHDLIICVDCGTLSHGPITAAV--GADVVVLDHH 176

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
                  PA+A+VNPNR D+     HLCAAGVVFL+LV   R LR DN    N  LL++L
Sbjct: 177 LGGETLPPAHAVVNPNRADETGDLAHLCAAGVVFLMLVEAGRQLRIDNATGPN--LLNML 234

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVAL TV DV PLIG+NRA V +GL V  R+   G+ AL +   + +  ++ +LG+++G
Sbjct: 235 DLVALGTVADVAPLIGVNRALVRQGLTVMARRERTGITALADVSRMDTAPSSYHLGFLLG 294

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLME----SAMLEQAEAKV 358
           P +NAGGRIG+++LG+RLL + D  E + +A +LD+LN  RR +E    +A LEQAE + 
Sbjct: 295 PRVNAGGRIGKADLGARLLATRDPHEAKAMAERLDMLNTERREIENNVRAAALEQAEERG 354

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
             +        ++   G+ WH G+VG++A+RLK+   RP+  I F+ D  G GSGRSI G
Sbjct: 355 FDE-------PLVWAAGEGWHAGVVGIVASRLKDAAHRPAIVIGFDGD-AGKGSGRSISG 406

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALIT 473
            D+G  +     EG++ KGGGH MAAGL++ R        RL +   K  A +  PA + 
Sbjct: 407 VDLGAAIQKLAHEGLIEKGGGHKMAAGLSLSRAQLEPAMARLSELMAKQGAGDAGPADL- 465

Query: 474 TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
               ++DG+L   A  I LI+ LE AGP+GAG P P FAFP+ +L+  + V   HL+++F
Sbjct: 466 ----RLDGMLMPGAAQIELIEQLEKAGPFGAGAPAPRFAFPDVELKFTKRVGETHLKISF 521

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
                  + AI F    TPLG  L +  GKR H+ G L VN W G +  QLR+ DA+P 
Sbjct: 522 GDGLGARIDAICFGAMDTPLGPALEKHGGKRFHLAGRLEVNSWGGRQNPQLRLEDAAPA 580


>gi|149914303|ref|ZP_01902834.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           AzwK-3b]
 gi|149811822|gb|EDM71655.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           AzwK-3b]
          Length = 580

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 244/588 (41%), Positives = 352/588 (59%), Gaps = 12/588 (2%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           +LG+  S++G RW+   G E   RA A+ Q   +P  + + L    V    A+ +L PS+
Sbjct: 4   YLGIAQSLTGRRWIGP-GAEVERRAEAMAQSTGLPRPLCQTLARLGVPETEAEPYLEPSL 62

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R L+PDP  L D + AA R + A+   E+I IF DYDVDG +S AL++ +L    + A +
Sbjct: 63  RDLLPDPRSLRDMETAAGRFIAAVRARERIAIFADYDVDGGSSAALLIDWLRQMGLAATL 122

Query: 126 YIPDRIVDGYGPN-PSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           YIPDRI +GYGPN P++ E  +     LII VDCG+ S+DA+  A  +G DV+++DHH  
Sbjct: 123 YIPDRIDEGYGPNEPAMAE--LAAAHDLIICVDCGTLSHDAI--AAARGADVVILDHHLG 178

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                PA A+VNPNR D+     HLCAA VVFL+LV   R LR+  +     DL+++LDL
Sbjct: 179 GETLPPALAVVNPNRQDETGDLAHLCAAAVVFLMLVEAGRQLRERGET--RPDLMAMLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL G+NRA+V +GL +   +  PGL AL +   + +  +A +LG+++GP 
Sbjct: 237 VALATVADVAPLRGVNRAFVRQGLRIMAHRDRPGLVALSDVARLDTAPSAYHLGFVMGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL + D  E   LA +LD LN  RR +E+ +   A A+   +  D
Sbjct: 297 VNAGGRIGKADLGARLLATRDISEARSLAERLDQLNSERRDIEAGVRAAALAQAEARGLD 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE   RP+  I  + D +G GSGRSI G D+G  
Sbjct: 357 ---APLVWAAGEGWHPGVVGIVASRLKELTNRPAIVIGMDGD-EGKGSGRSISGVDLGAS 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV R       +   +               ++DGVL 
Sbjct: 413 IQRLAAEGLLIKGGGHRMAAGLTVARDRLEAAMERLSELLDRQGSGAAGPADLRLDGVLM 472

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + L++ +E+AGP+GAG P P + FP+ ++   + V  AHL++ F    S  L AI
Sbjct: 473 PGAATVELVERIEAAGPFGAGAPGPRYVFPDMQIGFAKRVGDAHLKLRFGDGLSGQLDAI 532

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AF  + +PLG+ LM   G R H+ G + +N W G +  QL++ DA+P 
Sbjct: 533 AFGAFDSPLGQALMSHGGARFHLAGRIGINEWGGRRSPQLQLEDAAPA 580


>gi|83951463|ref|ZP_00960195.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius
           nubinhibens ISM]
 gi|83836469|gb|EAP75766.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius
           nubinhibens ISM]
          Length = 579

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 250/597 (41%), Positives = 359/597 (60%), Gaps = 32/597 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +FLG+  S++G RW+    +  I+R A A+ Q   +P  + ++L  R V    A+ FL P
Sbjct: 2   SFLGIAQSLTGRRWIGPTTE--IDRLAEAMAQTTDLPRALCQILARRGVEPQEAESFLTP 59

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
            IR L+PDP  L D + AA+R + A+   E+I IF DYDVDG +S AL++ +L      A
Sbjct: 60  QIRDLLPDPRGLKDMEAAAQRFLLAVQRGERIAIFADYDVDGGSSAALLIDWLRQMGRAA 119

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN + M +  +    LII VDCG+ S+  +  A +   DV+++DHH 
Sbjct: 120 TLYVPDRIDEGYGPNDAAMAELAST-HDLIICVDCGTLSHGPVAAAKD--ADVVILDHH- 175

Query: 184 VKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSL 241
           +  E +P A A+VNPNR D+     HLCAA VVFL+LV   R LR+   K P   DL+++
Sbjct: 176 LGGETLPEAVAVVNPNRQDEDGALAHLCAAAVVFLMLVEAGRQLREAGQKGP---DLMAM 232

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATV DV PLIG+NRA+V +GL V  R+  PGL AL +   +  P  A +LG+++
Sbjct: 233 LDLVALATVADVAPLIGVNRAFVRQGLRVMARRERPGLVALADAARLDRPPAAYHLGFVL 292

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLME----SAMLEQAEAK 357
           GP +NAGGRIG+++LG+RLL +D+  E   LA +L+ LN+ RR +E    +A L+QAEA+
Sbjct: 293 GPRVNAGGRIGQADLGARLLSTDNPAEARALADRLEELNRERRDVEAQVRAAALDQAEAR 352

Query: 358 VLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIE 417
            L        A ++   GD WHPG+VG++A+RLKE   RP+  I F+ D +G GSGRSI 
Sbjct: 353 GL-------DAPLVWAAGDGWHPGVVGIVASRLKEAANRPAIVIGFDGD-EGKGSGRSIS 404

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER----VNFGRLCDFFQKFAHNIVPALIT 473
           G D+G  +     EG+L+KGGGH MAAGLTV R        RL +   K           
Sbjct: 405 GVDLGASIQKLAAEGLLIKGGGHKMAAGLTVARDQLDAAMARLSELLDKQGAGAA----G 460

Query: 474 TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
               ++DG+L   A    LID ++ AGP+GAG   P + F + ++   + +  +HL++ F
Sbjct: 461 AADLRLDGLLMPGAATPELIDQIDGAGPFGAGASAPRYVFSDMQISFAKRIGESHLKLRF 520

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                 +L+AI+F  +  PLG  L +  G R H+ G L +N+W G +  QLR+ DA+
Sbjct: 521 GDGMGASLEAISFAAFDGPLGPVLSEHGGARFHLAGRLEINHWGGRQSVQLRLEDAA 577


>gi|254466495|ref|ZP_05079906.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium Y4I]
 gi|206687403|gb|EDZ47885.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium Y4I]
          Length = 580

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 259/598 (43%), Positives = 363/598 (60%), Gaps = 34/598 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S+SG RWV   G E    +  + Q+  +P  V +VL  R V    AK FL P 
Sbjct: 3   SFLGVEQSLSGRRWVGP-GVEVDRASEMMAQQTGLPRSVCQVLARRGVPAMEAKGFLEPK 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   ++I +F DYDVDG +S AL++ +L    + A 
Sbjct: 62  LKELLPDPREMKDMEAAAARFLQAVQRKQRIAVFADYDVDGGSSAALLLVWLRQMGLEAT 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M++ +     LII VDCG+ S++ +  A  +G DVIV+DHH +
Sbjct: 122 LYIPDRIDEGYGPNVPAMQE-LAAAHDLIICVDCGTLSHEPI--AAAKGADVIVLDHH-L 177

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLL 242
             E +P   A+VNPNR D+    G+ CAAGVVFL+LV   R +R+   K P   DL++LL
Sbjct: 178 GGETLPDCVAVVNPNRQDESGDLGYFCAAGVVFLMLVEAGRQMREAGAKGP---DLMALL 234

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PLIG NRA V +GL V   +  PGL AL +   + S  +  +LG+++G
Sbjct: 235 DLVALATVADVAPLIGANRALVRQGLKVMAARKRPGLVALSDVSRMDSAPSTYHLGFLLG 294

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKV 358
           P +NAGGRIG+++LG+RLL +D+  E   LA +LD LN  RR +E+A+    L+QAEA+ 
Sbjct: 295 PRVNAGGRIGKADLGARLLSTDNPHEAAALAERLDQLNTERRDIENAVRAAALDQAEARG 354

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIE 417
           L       +A ++   G+ WHPG+VG++A+RLKE  GRP+  I F+ E+GK  GSGRS+ 
Sbjct: 355 L-------EAPLVWAAGEGWHPGVVGIVASRLKEAAGRPAVVIGFDGEEGK--GSGRSVS 405

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALI 472
           G D+G  +     EG+LVKGGGH MAAGLTV R        RL +   K  A    PA +
Sbjct: 406 GVDLGASIQRLAAEGLLVKGGGHKMAAGLTVMRDKLEPAMERLSELLAKQGAGQGGPADL 465

Query: 473 TTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMT 532
                K+DG L   A  + LI  +E AGP+GAG P P +A P+ +++  + V  +HL+++
Sbjct: 466 -----KLDGALMPGAATVELIGQIEQAGPFGAGAPAPRYALPDLQVRFAKKVGESHLKLS 520

Query: 533 FESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                   + AI F  + T LG  L++  G R H  G L +N W G +  QLR+ DA+
Sbjct: 521 LSDGMGGGVDAICFGAFDTALGPRLLEHGGARFHFAGRLEINTWGGRQSPQLRLEDAA 578


>gi|260575454|ref|ZP_05843453.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter sp. SW2]
 gi|259022374|gb|EEW25671.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter sp. SW2]
          Length = 581

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 252/594 (42%), Positives = 348/594 (58%), Gaps = 19/594 (3%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           M ++AFL VE S +G RWV   G E    A A+ Q   +P  +   LV R V+   A  +
Sbjct: 1   MTNRAFLNVEASATGRRWVGP-GTEQDRLAEAMAQVTHLPLALCHTLVKRGVAPGEAAAY 59

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L PS+R L+PDPL L D  KAA R VQA+   ++I +F DYDVDG AS AL++ +L    
Sbjct: 60  LAPSLRDLLPDPLSLRDMGKAAARFVQAVKARQRIAVFADYDVDGGASAALLLVWLRAMG 119

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
             A +YIPDRI +GYGPN +     +     +II VDCG+ S++ +  A  +  DV+V+D
Sbjct: 120 QGATLYIPDRIDEGYGPN-APAMAALAAAHDVIICVDCGTLSHEPI--AAAKAADVLVLD 176

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HH       PA A+VNPNR D+    GHLCAA VVFL+LV   R LR +       DL++
Sbjct: 177 HHLGAETLPPALAVVNPNRQDEDGSLGHLCAASVVFLLLVEANRQLRAEGTP--GPDLMA 234

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATV DV PL+G+NRA+V +GL V  R+   GLKAL +   +    T   LG++
Sbjct: 235 MLDLVALATVADVAPLLGVNRAFVRQGLRVMARRERIGLKALADVARMDQAPTPYALGFL 294

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEA 356
           +GP INAGGRIG ++LG+RLL +DD  E   LA +LDVLN  RR +E+A+    L QAEA
Sbjct: 295 LGPRINAGGRIGAADLGARLLATDDPHEAAALAERLDVLNTERREIEAAVRASALAQAEA 354

Query: 357 KVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSI 416
           +            ++   G+ WHPG+VG++AARLKE   RP+  I F+ D +G GSGRS+
Sbjct: 355 RGF-------DGPLVWAAGEGWHPGVVGIVAARLKEGANRPAVVIGFDGD-EGKGSGRSV 406

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPV 476
            G D+G  +     EG++ +GGGH MAAGL++ R       +                  
Sbjct: 407 SGVDLGAAIQRLASEGLIGRGGGHKMAAGLSLSRAQLEPAMERLGALLAKQGAGQGGPAD 466

Query: 477 FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ 536
            +IDG+L   A  +AL++ LE+AGPYGA +P P FAF +  + S R +  +HL+++F   
Sbjct: 467 LRIDGLLMPGAATMALVEQLEAAGPYGAASPAPRFAFADQAV-SARRMGESHLRLSFSDG 525

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
               L+A+AF  +  PLG  L      R H+ G L +N + G  + QLR+ DA+
Sbjct: 526 LGARLEAVAFGAFDGPLGPMLENPGAARFHLAGRLEINSYGGRNKVQLRLEDAA 579


>gi|297717882|gb|ADI50084.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus Odyssella
           thessalonicensis L13]
          Length = 591

 Score =  438 bits (1127), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 232/577 (40%), Positives = 340/577 (58%), Gaps = 11/577 (1%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + S+ G RWV    +     AL + Q H I    A +L+ R ++   A  FL P++R LM
Sbjct: 17  QISVGGRRWV--FDEVNPREALQLAQNHQISTFAATILLKRGINFQNAASFLQPTLRELM 74

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D      R+V+AI + E I +FGDYDVDGA + AL+ R+     ++  +YIP 
Sbjct: 75  PDPSHLKDLSVGVDRVVKAIQSQETIAVFGDYDVDGATATALLKRYFRDIGISLRVYIPQ 134

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP    M++   EG   ++ VDCG+T++  L+ A   G+DVIV+DHH  ++   
Sbjct: 135 RIEEGYGPTVPAMQQLAKEGTTTLLMVDCGTTAFTPLEAAVQLGMDVIVLDHHVSQASLP 194

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLLSLLDLVAL 247
           PA A++NPNR+D+ S   +LCAAGV F+ LV ++R LR +         DL   LDLVAL
Sbjct: 195 PATAIINPNRIDENSPLTNLCAAGVSFIFLVALHRQLRLEGWFAQRPEPDLRQYLDLVAL 254

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCDV+ L GLNRA+V +GL V  R+ N GL+ L +   +    +A +LG+++GP INA
Sbjct: 255 GTVCDVMTLTGLNRAFVAQGLKVMARRSNHGLRCLADLAGMDDTPSAYHLGFLLGPRINA 314

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGR+G +  GSRLL + D  E + LA +LD+ N+ R+ +E+ +LE+A  ++ TQ   + +
Sbjct: 315 GGRVGRAEYGSRLLSTLDELEAQQLARELDLYNKERQAIETLVLEEAIHQIETQ--GLHR 372

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
             +I+V  + WHPG++G++A RLKE++ RP+  + F+ D  G GSGRSI G ++G  +  
Sbjct: 373 QPLILVGQEGWHPGVIGIVAGRLKERYNRPACVVGFDAD-IGKGSGRSIAGVNLGAAMHA 431

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           A   G+L  GGGH MAAG TV R  F    +F +    + +  L   P  +IDG+L  S 
Sbjct: 432 ACHHGLLTAGGGHLMAAGFTVMRDQFDNFYNFLKDNLKHQLETL--EPTLEIDGILTPSG 489

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
             + L+  L+   P+G GNP P F     K+     V + H++ T E +D   L+A+AFR
Sbjct: 490 ATLDLVHELKRLEPFGNGNPTPKFCIHKAKVTYAEPVGVNHIRCTLEGEDGTRLKAMAFR 549

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
              TPLG+ +M    K + V G L V+ W G  RC +
Sbjct: 550 ALETPLGDAIMARSNKSIQVAGTLKVDTWNG--RCSV 584


>gi|85705202|ref|ZP_01036301.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp. 217]
 gi|85670075|gb|EAQ24937.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp. 217]
          Length = 582

 Score =  438 bits (1127), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 251/598 (41%), Positives = 354/598 (59%), Gaps = 29/598 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S++G RW+   G E    A A+ Q   +P  + + L    V+ + A+ +L+P+
Sbjct: 4   AFLGVEQSLTGRRWIGP-GVETDRLAEAMAQTTTLPRPLCQTLARLGVAEEDAEAYLSPA 62

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV-NA 123
           +R L+PDP  L D ++AA R ++A+   E+I +F DYDVDG  S AL++ +L        
Sbjct: 63  LRDLLPDPRSLRDMERAAARFLKAVKTGERIAVFADYDVDGGTSAALLIDWLRQMQAPTP 122

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M         LI+ VDCG+ S++A+  A  +G DV+V+DHH 
Sbjct: 123 TLYIPDRIDEGYGPNVPAMTDLAAR-HDLILCVDCGTLSHEAI--AAAKGADVVVLDHHL 179

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
                 PA A+VNPNR D+     HLCAAGVVFL+LV   R LR         DL++LLD
Sbjct: 180 GGETLPPALAVVNPNRQDESGDLAHLCAAGVVFLMLVEAGRQLRAGGTQ--GPDLMALLD 237

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PLIG+NRA+V +GL +  R+  PGL AL +   + +   A +LG+++GP
Sbjct: 238 LVALATVADVAPLIGVNRAFVRQGLRIMARRDRPGLVALADVARMDTAPNAYHLGFLLGP 297

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRR----LMESAMLEQAEAKVL 359
            +NAGGRIG+++LG+RLL  D++ E   LA +LD LN  RR    L+ +A L QAE + L
Sbjct: 298 RVNAGGRIGKADLGARLLACDNASEARALAERLDHLNTERRDVEALVRAAALAQAEERGL 357

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A ++   G+ WHPG+VG++A+RLKE   RP+  I  + D +G GSGRS+ G 
Sbjct: 358 -------DAPLVWAAGEGWHPGVVGIVASRLKEVSNRPAIVIGLDGD-EGKGSGRSVSGV 409

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVER----VNFGRLCDFFQK-FAHNIVPALITT 474
           D+G  +     EG+L+KGGGH MAAGLTV R        RL +   K  A    PA    
Sbjct: 410 DLGVAIQRLASEGLLIKGGGHKMAAGLTVARERLEAAMARLSELLAKQGAGQNGPA---- 465

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              ++DG+L   A  + L+  ++SAGP+GAG P P + FP+ ++   + ++ AHL++ F 
Sbjct: 466 -DLRLDGLLMPGAATVDLVAQIDSAGPFGAGAPGPRYVFPDCQITFAKALSGAHLKLRFG 524

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
                +L AI F     PLG  L+   G R H+ G L +N W G +  QLR+ DA+P 
Sbjct: 525 DGMGASLDAICFGALDGPLGPALLAHGGARFHLAGRLDINSWGGRQTVQLRLEDAAPA 582


>gi|330814098|ref|YP_004358337.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487193|gb|AEA81598.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 584

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 234/589 (39%), Positives = 361/589 (61%), Gaps = 21/589 (3%)

Query: 9   VECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLL 68
           ++ S+S   W+  L +   N+    TQ+  + +++ R+L  RNV  D + DFLNP I+  
Sbjct: 2   IKNSVSDRNWI--LSKFDENKVKKATQELGVSEVLCRLLAIRNVEADQSLDFLNPKIKNS 59

Query: 69  MPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP 128
           MP+P +L   D+A + I++ I     I I+GDYDVDGA+S +++ RFL + + N  ++IP
Sbjct: 60  MPNPFLLKSMDEAVKLIIKHIKEESHICIYGDYDVDGASSTSILARFLRNFTNNFFIFIP 119

Query: 129 DRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE 188
           DRI DGYGPN  + E   ++G +LIITVDCG+TS++ ++YA ++ IDV+VIDHHQ  +E 
Sbjct: 120 DRIQDGYGPNLKIFEDIASKGVKLIITVDCGTTSFEPIEYAKSKNIDVVVIDHHQ-STET 178

Query: 189 IP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN----KVPLNFDLLSLLD 243
           +P A A+VNPNR D+ S   +LCAAGV FLVL  I   LR+++    K     +LL+ LD
Sbjct: 179 LPIANAIVNPNRFDETSNLTYLCAAGVAFLVLSGIVTRLREEDFFKKKNIQEPNLLNYLD 238

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TVCDVVPL GLNRA+V +GL V +++ N G+K L +  NI+S I+  +LGY+IGP
Sbjct: 239 LVALGTVCDVVPLQGLNRAFVFQGLKVLQKRNNLGIKTLSDVANINSKISTYHLGYIIGP 298

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG+++ G+ LL+++D +    ++ +L+ LN+ R+ +E  +LE+A    +    
Sbjct: 299 KINAGGRIGKADHGANLLLTEDPEIAFKISKELNQLNEKRKNIEGIILEEA----INIAK 354

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
                 V+VV  + WH GI+G++A+RLK+ F +P+F I+FE D  G GS RS+ GFDIG 
Sbjct: 355 HKDNNPVLVVSSNTWHEGIIGIIASRLKDHFNKPTFVINFEGD-YGKGSARSLPGFDIGS 413

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGR----LCDFFQKFAHNIVPALITTPVFKI 479
            V  A +  I+ KGGGH MAAG ++ +         L D F K       +     ++ I
Sbjct: 414 AVVKAKQSEIITKGGGHKMAAGFSINQDKADEFEIFLIDLFNKSG---CQSSKEKDLY-I 469

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           D VL +SAVN    + ++   P+G+ N  P F   N  +    ++  +H++   ++ ++ 
Sbjct: 470 DSVLASSAVNEKFFNEIDKLAPFGSANREPRFVIENVSITKSLILKESHIKAFCKTSNNS 529

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            +  I+F    TP+G +L+ ++ K+  + G L +N W G +  Q  + D
Sbjct: 530 KINLISFNSVNTPIGSYLLNAKNKKYDIAGRLSLNEWNGKREVQFLLDD 578


>gi|254441408|ref|ZP_05054901.1| single-stranded-DNA-specific exonuclease RecJ [Octadecabacter
           antarcticus 307]
 gi|198251486|gb|EDY75801.1| single-stranded-DNA-specific exonuclease RecJ [Octadecabacter
           antarcticus 307]
          Length = 589

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 262/594 (44%), Positives = 352/594 (59%), Gaps = 22/594 (3%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFL V  S +G RWV     E    A A+ Q  A+P  V R LV R V    A  FL P
Sbjct: 10  RAFLDVAQSATGRRWVGP-SVEDDRLAEAMAQDTALPLPVCRTLVRRGVVAQDAAAFLAP 68

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP  L D + AA RIV A +  ++I IF DYDVDG  S AL++ +L    V  
Sbjct: 69  TLRDLMPDPRSLRDMEPAAARIVAAAHGRQRIAIFADYDVDGGTSAALLIDWLRGFGVTP 128

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN + M     +   LII VDCG+ S+  +  A  +G DV+V+DHH 
Sbjct: 129 TLYVPDRIDEGYGPNDNAMFALARD-HDLIICVDCGTLSHGPI--AAAKGADVVVLDHHL 185

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLL 242
                 PA A+VNPNR D+     HLCAAGVVFLVLV   R LR   +K P   DL++LL
Sbjct: 186 GGEMLPPALAVVNPNRQDETGDLAHLCAAGVVFLVLVEANRQLRDAGSKTP---DLMALL 242

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVAL TV DV PLIG+NRA+V +GL V  R+   GL AL +   + +  ++ +LG+++G
Sbjct: 243 DLVALGTVADVAPLIGVNRAFVRQGLTVMARRQRVGLVALADVARMDTAPSSYHLGFLLG 302

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P +NAGGRIG+++LG+RLL S D  E + +A +LD LN  RR +E+ + E A  +   + 
Sbjct: 303 PRVNAGGRIGKADLGARLLASTDPHEAQSMAQRLDELNTERREIENQVREMAIEQAEQRG 362

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D     ++   G+ WHPG+VG++AARLKE   RP+  I  + D  G GSGRS+ G D+G
Sbjct: 363 TD---RPLVWAAGEGWHPGVVGIVAARLKEASNRPAIVIGLDGD-TGKGSGRSVSGIDLG 418

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVER----VNFGRLCDFFQK-FAHNIVPALITTPVF 477
             +     EG+L+KGGGH MAAGLTV R        RL +   K  A +I PA +     
Sbjct: 419 AAIQRCTAEGLLIKGGGHKMAAGLTVARDKVDAAMERLSELLAKQGAGDIGPADL----- 473

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
           K+DGVL   A  + LI+++E AGP+GAG P P F FP+  +   +VV   HL++TF    
Sbjct: 474 KVDGVLMPGAATVDLIEIMEQAGPFGAGAPAPRFVFPDCTINFTKVVGANHLKVTFGDGI 533

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           S  + AI F     P+G  L    G R H+ G L +N W+G +  QLR+ DA+P
Sbjct: 534 SGRVDAICFGAMDGPIGPMLRDHGGARFHLAGRLEINTWQGRQSPQLRLEDAAP 587


>gi|126727763|ref|ZP_01743594.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium HTCC2150]
 gi|126703019|gb|EBA02121.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium HTCC2150]
          Length = 582

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 245/593 (41%), Positives = 354/593 (59%), Gaps = 22/593 (3%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           + VE S++G RWV L G + +  A A+ Q+  +   ++R+L  R V+ D +  FL PS+R
Sbjct: 3   IAVENSLTGRRWVGL-GTDTVRAAEALAQQTGLSLPLSRILARRGVAADESTSFLAPSLR 61

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            LMPDP  + D +KAA R + A+  ++KI IF DYDVDG +S AL++ +L    + A +Y
Sbjct: 62  DLMPDPRSMLDMEKAAGRFLAAVKANQKIAIFADYDVDGGSSAALLVWWLRDFGIQATVY 121

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           +PDRI +GYGPN + M +       L+I VDCG+ S+  +Q    +G DVIV+DHH +  
Sbjct: 122 VPDRIDEGYGPNDAAMAELAAT-HDLVICVDCGTLSHGPIQ--ATKGADVIVLDHH-LGG 177

Query: 187 EEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-QDNKVPLNFDLLSLLDL 244
           E +P A A+VNPNR D+     HLCAAGVVFL+LV   R  R    K P   DL++LLDL
Sbjct: 178 ETLPDALAVVNPNRQDETGDLAHLCAAGVVFLMLVEANRQRRVLGEKSP---DLMALLDL 234

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG+NRA+V +GL +   +  PGL AL +   + S  T+ +LG+++GP 
Sbjct: 235 VALATVADVAPLIGVNRAFVRQGLKIMAARQRPGLVALADVARMDSAPTSYHLGFLLGPR 294

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVLT 360
           +NAGGRIG ++LG+RLL +D+  E   +A +LD LN  RR +E+ +    LEQA+++ L 
Sbjct: 295 VNAGGRIGAADLGARLLSTDNPHEAGAMAERLDQLNSERRAIENQVREGALEQAQSRDLA 354

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                  A +I    D WHPG+VG++A+RLKE   RPS  I FE D +G GSGRS+ G D
Sbjct: 355 -------APLIWAADDGWHPGVVGIVASRLKESTNRPSVVIGFEGD-EGKGSGRSVSGVD 406

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  +   V EG+L KGGGH MAAGL++ R       +   +         +       D
Sbjct: 407 LGASIQKLVAEGLLTKGGGHKMAAGLSLTRAQLEPAMERLGELLAKQGAGELGPRDLHYD 466

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
            +L  +A    LI+ +E+AGP+GA    P F FP+ ++   + V  +HL+ +F  +    
Sbjct: 467 SILMPTAATTDLIEQIENAGPFGASAAAPRFVFPDQRITFAKPVGESHLRFSFGDETGTR 526

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           L  IAF  + + +G  L  +     H+ G L +N W G ++ QLR+ DA+P +
Sbjct: 527 LDGIAFGAFDSEIGNSLQNAGHNLFHLAGRLELNTWGGRQKVQLRLEDAAPAD 579


>gi|83942968|ref|ZP_00955428.1| single-stranded-DNA-specific exonuclease RecJ [Sulfitobacter sp.
           EE-36]
 gi|83845976|gb|EAP83853.1| single-stranded-DNA-specific exonuclease RecJ [Sulfitobacter sp.
           EE-36]
          Length = 579

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 255/598 (42%), Positives = 362/598 (60%), Gaps = 30/598 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAI-TQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +FLGV+ S++G RWV   G E + RA  +  Q+ ++P  + +VL  R V+ + A+ FL P
Sbjct: 2   SFLGVDASLTGRRWVGP-GVE-VERATEVLVQQTSLPLALCQVLARRGVAAEEAEAFLAP 59

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           S+R L+PDP  L D +KAA R + A+   ++I +F DYDVDG +S AL++ +L      A
Sbjct: 60  SLRDLLPDPRSLRDMEKAATRFLAAVKARQRIAVFADYDVDGGSSAALLLVWLREMGCAA 119

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN + M +       LI+ VDCG+ S+  +  A     DV+++DHH 
Sbjct: 120 TLYVPDRIDEGYGPNDAAMAELAAS-HDLIVCVDCGTLSHGPVAAAVGA--DVVILDHH- 175

Query: 184 VKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
           +  E +P A A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL++LL
Sbjct: 176 LGGETLPDALAVVNPNRQDEDGALAHLCAAAVVFLMLVEAGRQLREAGA--RGPDLMALL 233

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLV LATV DV PLIG+NRA+V +GL V  R+   GL AL +   + +   A +LG+++G
Sbjct: 234 DLVGLATVADVAPLIGVNRAFVRQGLRVMARRDRLGLAALADVARMDTAPAAYHLGFLLG 293

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKV 358
           P INAGGRIG+++LG+RLL  DD  E + LA KLD+LN  RR +E+A+    L+QAEA+ 
Sbjct: 294 PRINAGGRIGQADLGARLLACDDPHEAQSLAEKLDLLNTERRDVETAVRAAALDQAEARG 353

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
                    A ++   G  WHPG+VG++A+RLKE   RPS  I F EDG G GSGRS+ G
Sbjct: 354 F-------DAPLVWASGAGWHPGVVGIVASRLKEASNRPSIVIGF-EDGIGKGSGRSVSG 405

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVER----VNFGRLCDFFQKFAHNIVPALITT 474
            D+G  +     EG+L+KGGGH MAAGLTV          RL +   K   ++  A    
Sbjct: 406 IDLGAPIQRLAAEGLLIKGGGHKMAAGLTVAEDKLDAAMARLSELLAKQGAHLAGA---- 461

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K+DG+L  +   + L   +E AGP+GAG P P +AF + +++  + V  +HL+++F 
Sbjct: 462 ADLKLDGMLMPATATVELAQQVEQAGPFGAGAPAPRYAFADMQIRFAKRVGESHLKISFG 521

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
             ++  + AIAF  +  PLG  L    G R H+ G L +N WRG +  QLR+ DA+P 
Sbjct: 522 DGNNTKMDAIAFGAFDGPLGPALENHGGARFHLAGRLDINTWRGRQSVQLRLEDAAPA 579


>gi|159044818|ref|YP_001533612.1| single-stranded-DNA-specific exonuclease [Dinoroseobacter shibae
           DFL 12]
 gi|157912578|gb|ABV94011.1| single-stranded-DNA-specific exonuclease [Dinoroseobacter shibae
           DFL 12]
          Length = 585

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 256/599 (42%), Positives = 355/599 (59%), Gaps = 30/599 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALA-ITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           AFLGVE S++G RW+ L   +  +RA   + Q   +PD V R L  R V+ + A+DFL P
Sbjct: 6   AFLGVESSLTGRRWIGLSPDQ--DRAAERLVQITGLPDAVCRTLARRGVAPEEAEDFLAP 63

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDP  L D ++AA R+  AI  +E+I IF DYDVDG +S AL++ +L      A
Sbjct: 64  TLRALLPDPRSLRDMERAAARVNAAIARNERIAIFADYDVDGGSSAALLIDWLRAQGRTA 123

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN   ME  + +   LII VDCG+ S+D +  A  QG DV+++DHH 
Sbjct: 124 TLYVPDRIDEGYGPNIPAMEA-LADAHDLIICVDCGTLSHDPV--AAAQGTDVVILDHHL 180

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            +     A+A+VNPNR D+     HLCAA VVFL+LV   R  R   +     DL++LLD
Sbjct: 181 AEECLPAAHAVVNPNRQDEDGSLSHLCAAAVVFLLLVEANRQQRAAGQP--GQDLMALLD 238

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL G+NRA+V +GL V  R+  PGL AL +   +    ++ +LG+++GP
Sbjct: 239 LVALATVADVAPLSGVNRAFVRQGLTVMGRRERPGLTALSDSAGLDRAPSSYHLGFVLGP 298

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLME----SAMLEQAEAKVL 359
            INAGGRIG ++LG+RLL + D  E   LA +L+ LN  RR +E    ++ LEQAE + L
Sbjct: 299 RINAGGRIGAADLGARLLATRDPHEAAALAERLEKLNAERRDIEAQVRASALEQAETRGL 358

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A +    G+ WHPG+VG++A+RLKE   RP+  I  E D +G GSGRS+ G 
Sbjct: 359 N-------APLAWAAGEGWHPGVVGIVASRLKETANRPAIVIGLEGD-EGKGSGRSVPGI 410

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVER----VNFGRLCDFF-QKFAHNIVPALITT 474
           D+G  +     EG+L+KGGGH MAAGLTV R        RL +    + A  + P     
Sbjct: 411 DLGAAIQRLAHEGLLLKGGGHKMAAGLTVRRDLLEPAMARLSELLAAQGADRLGPK---- 466

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
               +DGVL+  A+   LI  +E AGP+GA  P P FA P+  ++  + V  +HL+ +F 
Sbjct: 467 -GLHVDGVLSPRAITTELITRIEDAGPFGASAPAPRFALPSVTIRYAKPVGESHLRFSFA 525

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                 +  IAF  + TP+G  L QS     H+ G L +N W G  + QLR+ DA+  E
Sbjct: 526 GPCGTRMDGIAFGAFDTPIGPALSQSARGTFHLAGRLEINSWGGQHKAQLRLDDAAAAE 584


>gi|89055493|ref|YP_510944.1| single-stranded-DNA-specific exonuclease RecJ [Jannaschia sp. CCS1]
 gi|88865042|gb|ABD55919.1| exonuclease RecJ [Jannaschia sp. CCS1]
          Length = 582

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 255/596 (42%), Positives = 351/596 (58%), Gaps = 31/596 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +FLGVE S++G RW+     + + R A  + Q+  +   VA +L  R V  D    FL P
Sbjct: 4   SFLGVEASLTGRRWIGP--SDDVERLAQTLIQRADLDPAVAAILARRGVQPDDVASFLAP 61

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDP+ L D   AA R+V+A    ++I IF DYDVDG +S AL++ +L      A
Sbjct: 62  ALRDLLPDPMSLKDMAPAATRLVEAARKGKRIAIFADYDVDGGSSAALLIWWLRALGRQA 121

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M   +  G  LII VDCG+ S+  +  A  +G DV+V+DHH 
Sbjct: 122 TLYIPDRIDEGYGPNDEAMAA-LARGHDLIICVDCGTLSHGPI--AAAKGADVMVLDHHL 178

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             +E     A+VNPNR D+    GHLCAAGVVFLVLV   R +R+  +     DL+ LLD
Sbjct: 179 ATAELPECVAVVNPNRQDEDGASGHLCAAGVVFLVLVDANRRMREAGEQ--GPDLMGLLD 236

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PLIG+NRA VV+GL V  R+  PGL AL +   +    T+ +LG+++GP
Sbjct: 237 LVALATVADVAPLIGVNRALVVQGLKVMARRQRPGLVALSDVGRLDRAPTSYHLGFVLGP 296

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLME----SAMLEQAEAKVL 359
            +NAGGRIG ++LG+R L +DD  E   LA +LD LN +RR +E     A L QAEA+ L
Sbjct: 297 RVNAGGRIGAADLGARCLSTDDMAEAVKLAAQLDTLNTDRREIEQRVREAALVQAEARGL 356

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  +A ++    D WHPG+VG++A+RLK+   RP+  I F+ D  G GSGRS+ G 
Sbjct: 357 -------EAPLVWAAEDGWHPGVVGIVASRLKDHTRRPAIVIGFDGD-DGKGSGRSMAGV 408

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQKFAHNIVPALITTP 475
           D+G  +     EG++ KGGGH MAAGL++ R        RL +   K       A    P
Sbjct: 409 DLGASIQKLAAEGLIQKGGGHKMAAGLSLSRAQLEPAMERLTELLAKQG-----AGTGGP 463

Query: 476 V-FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              ++DG +  SA    LI+ +E+AGPYGAG P P FA P  +++  R V   HL++T  
Sbjct: 464 ADLRLDGTIMTSAATPELIEKIEAAGPYGAGAPAPRFALPALRIRHTRPVGETHLKLTLG 523

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                T+ AI F    + L E L    G+ +HV G + +N+W+G  R QLR+ DA+
Sbjct: 524 DGGPVTIDAICFDAVRSGLDE-LQAHNGRSVHVAGRVELNHWQGRTRVQLRLDDAA 578


>gi|254294222|ref|YP_003060245.1| single-stranded-DNA-specific exonuclease RecJ [Hirschia baltica
           ATCC 49814]
 gi|254042753|gb|ACT59548.1| single-stranded-DNA-specific exonuclease RecJ [Hirschia baltica
           ATCC 49814]
          Length = 609

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 226/589 (38%), Positives = 362/589 (61%), Gaps = 10/589 (1%)

Query: 5   AFLGVECSISGFRW-VSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           AFLGVE S++G RW V  +  E   +A  I+++ + PD++ ++L  R V++D A  + +P
Sbjct: 21  AFLGVEHSLTGRRWRVRPVDDE---KATEISRRLSKPDLIGKLLAGRGVTLDEADTYFSP 77

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +++ L PDP    D D A   I++A+ +  K  +  DYDVDG  S A++ ++        
Sbjct: 78  TLKALFPDPSSFADMDAACEVILEALVSGRKCAVLADYDVDGGTSAAILTKYFKAWDREL 137

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDR+ +GYGP+    E    +GA+L++TVDCG+ + +AL+ A + G+DV+V+DHH 
Sbjct: 138 ILYVPDRLTEGYGPSVEAFESLKEQGAELVMTVDCGAAAVEALEAAHSLGLDVVVLDHHL 197

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF--DLLSL 241
           ++SE  PA A+VNPNR D  SG GH+ AAGVVF++   + R+ RQ +  P     D +  
Sbjct: 198 MQSEPPPAAAVVNPNRPDCKSGCGHMAAAGVVFVLTAGLNRLARQKSVAPAGGLPDPMKW 257

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDL AL T+CD+ PL G+NRA+V  GL V +R  N GL AL +   + +P +  +  +++
Sbjct: 258 LDLCALGTLCDMAPLKGVNRAFVNAGLKVLQRMDNVGLAALSQVSGVEAPKSVYHATFLL 317

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP +NAGGRIG+  + ++LL ++D +E   LA +L  LN+ R+ +E+ +L++A     ++
Sbjct: 318 GPRLNAGGRIGDPWIAAKLLATEDRKEALALAERLQALNEARKEIEAEILDEATRIAESR 377

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGF 419
             +   A  IVV G+ WHPG++G++A RLKEKF RP+  I + E+   +  GSGRS+ G 
Sbjct: 378 LVEKPDAGAIVVGGEGWHPGVIGIVAGRLKEKFHRPTIVIGWGEELGPVAKGSGRSVAGV 437

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           ++G +++ A +EGI++ GGGHAMAAGL++E        D+ ++        L    V ++
Sbjct: 438 NLGNLIAKASKEGIILSGGGHAMAAGLSLEPSQLEAFRDYMEESTAEAKKELEQARVLEL 497

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG+L+ ++ +  L+  ++ AGPYGAG+P P+FA  N +  ++R V + HL      +D  
Sbjct: 498 DGLLSPASADGELLLSVDGAGPYGAGSPEPIFAMANVRSHNVRRVGVDHLSFEILGEDGG 557

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            L+AIAFR     LG+ ++   G+ MH+ G L  + WRG+ + Q  V D
Sbjct: 558 KLRAIAFRAADADLGQAILS--GQMMHLAGKLKPDEWRGAGKVQFEVSD 604


>gi|254449696|ref|ZP_05063133.1| single-stranded-DNA-specific exonuclease RecJ [Octadecabacter
           antarcticus 238]
 gi|198264102|gb|EDY88372.1| single-stranded-DNA-specific exonuclease RecJ [Octadecabacter
           antarcticus 238]
          Length = 588

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 259/594 (43%), Positives = 353/594 (59%), Gaps = 22/594 (3%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            AFL V  S +G RWV     E    A A+ Q  A+P  V R LV R ++   A  FL P
Sbjct: 9   HAFLDVAQSTTGRRWVGP-SVEDDRLAEAMAQDTALPLPVCRTLVRRGITAQDAASFLAP 67

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP  L D + AA RIV A  + +KI IF DYDVDG  S AL++ +L    V  
Sbjct: 68  TLRDLMPDPRSLRDMEPAAARIVAAANSGQKIAIFADYDVDGGTSAALLIDWLRGFGVTP 127

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN   M     +   LII VDCG+ S+  ++ A  +G DV+V+DHH 
Sbjct: 128 TLYVPDRIDEGYGPNDDAMSTLARD-HDLIICVDCGTLSHGPIEAA--KGADVVVLDHHL 184

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLL 242
                 PA A+VNPNR D+     HLCAAGVVFLVLV   R LR   +K P   DL+SLL
Sbjct: 185 GGETLPPALAVVNPNRQDEAGDLAHLCAAGVVFLVLVEANRQLRDAGSKTP---DLMSLL 241

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVAL TV DV PLIG+NRA+V +GL V  R+   GL  L +   + +  ++ +LG+++G
Sbjct: 242 DLVALGTVADVAPLIGVNRAFVRQGLTVMARRQRVGLVTLADVARMDTAPSSYHLGFLLG 301

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG+++LG+RLL + D ++ + +A +LD LN  RR +E+ + E A  +   + 
Sbjct: 302 PRINAGGRIGKADLGARLLATIDPRQAQSMAERLDELNTERREIENQVREMAIEQAEQRG 361

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D     ++   G+ WHPG+VG++AARLKE   RP+  I  + D  G GSGRS+ G D+G
Sbjct: 362 TD---RPLVWAAGEGWHPGVVGIVAARLKEASNRPAIVIGLDGD-IGKGSGRSVFGIDLG 417

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVER----VNFGRLCDFFQK-FAHNIVPALITTPVF 477
             +     EG+L+KGGGH MAAGLTV R        RL +   K  A++I PA +     
Sbjct: 418 AAIQRCAAEGLLIKGGGHKMAAGLTVARDKVDAAMDRLSELLAKQGANDIGPADL----- 472

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
           ++DG+L   A  + LI+++E AGP+GAG P P F FP+  +   +VV   HL++TF    
Sbjct: 473 RVDGLLMPGAATVDLINIMEQAGPFGAGAPAPRFVFPDCAINFTKVVGANHLKVTFGDGI 532

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           S  + AI F     P+G  L    G R H+ G L +N W+G +  QLR+ DA+P
Sbjct: 533 SARIDAICFGAMDGPIGPMLRDHGGARFHLAGRLEINTWQGRQSPQLRLEDAAP 586


>gi|254475596|ref|ZP_05088982.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria sp. R11]
 gi|214029839|gb|EEB70674.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria sp. R11]
          Length = 580

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 245/596 (41%), Positives = 356/596 (59%), Gaps = 29/596 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RW+     +    A  + Q+  +P  V +VL  R V    A+ FL P 
Sbjct: 2   SFLGVETSLTGRRWIGP-DLDTARAAEMMEQQIGLPPAVCQVLARRGVPAHEAQGFLTPQ 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   ++I +F DYDVDG +S AL++ +L    + A 
Sbjct: 61  LKELLPDPRRMKDMEIAAARFLQAVEKRQRIAVFADYDVDGGSSAALLLVWLQQAGLGAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN   M     +   LI+ VDCG+ S+  +  A   G DVIV+DHH +
Sbjct: 121 LYVPDRIDEGYGPNDEAMAALARD-HDLIVCVDCGTLSHGPI--AAAMGADVIVLDHH-L 176

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +P   A+VNPNR D+    G+ CAAGVVFL+LV + R +R D  +    DL++LLD
Sbjct: 177 GGETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVEVRRQMR-DKGLGTGPDLMALLD 235

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL+  NRA V +GL V   +  PGL AL +   + S  +  +LG+++GP
Sbjct: 236 LVALATVADVAPLVDANRALVRQGLKVMAARQRPGLVALADVSRMDSAPSTYHLGFLLGP 295

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVL 359
            +NAGGRIG+++LG+RLL + +  E E +A +LD LN  RR +E+A+    LEQAEA+  
Sbjct: 296 RVNAGGRIGKADLGARLLATTNPAEAEAIAARLDELNTERREIENAVRAAALEQAEARGF 355

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A ++   G+ WHPG+VG++A+RLKE  GRP+  I  + D +G GSGRS+ G 
Sbjct: 356 -------DAPLVWAAGEGWHPGVVGIVASRLKEATGRPAVVIGLDGD-EGKGSGRSVSGI 407

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALITT 474
           D+G  +     EG+ VKGGGH MAAGLTV R        RL +   K  A ++ PA +  
Sbjct: 408 DLGASIQRVAAEGLFVKGGGHKMAAGLTVSRDKLEPAMERLAELLAKQGAGDLGPADL-- 465

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K+DG+L   A  + LI+ ++ AGP+GAG P P + FP+ +++  + +  +HL+++  
Sbjct: 466 ---KLDGMLMPGAATVPLIEQIDQAGPFGAGAPAPRYGFPDLQVRFAKRIGESHLKLSLS 522

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              S  + AI F  + T LG  L+   G R H  G L +N W G +  QLR+ DA+
Sbjct: 523 DGLSSGIDAICFGAFDTALGPRLLDHGGARFHFAGRLEINTWGGRQSVQLRLEDAA 578


>gi|84687257|ref|ZP_01015137.1| single-stranded-DNA-specific exonuclease RecJ [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664690|gb|EAQ11174.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium HTCC2654]
          Length = 582

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 248/595 (41%), Positives = 353/595 (59%), Gaps = 26/595 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFL V+ S++G RW    G E   +A A+ Q   +P  V  VL  R V  D A  FL P+
Sbjct: 3   AFLDVDNSLTGRRWTGP-GVELERQAEALVQATGLPAPVCAVLARRGVQADEAAGFLAPT 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR  +PDP  + D D+AA R++ A+  +E++ +F DYDVDG +S AL++ ++     +  
Sbjct: 62  IRDTLPDPRSMRDMDRAAARLLAAVDKNERVAVFADYDVDGGSSAALLIDWMRRMGRDIT 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   ME  + E   LI+ VDCG+ S++ +  A  +G +V+V+DHH  
Sbjct: 122 LYIPDRIDEGYGPNVPAMEA-LAETHSLIVCVDCGTLSHEPIAAANAKGAEVVVLDHHLG 180

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                PA A+VNPNR D++   G+LCAAGVVFL+LV   R LR+  +     DL+ +LDL
Sbjct: 181 GETLPPALAVVNPNRQDEVDAPGYLCAAGVVFLMLVEAGRQLREAGR--RGPDLMGMLDL 238

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+G NRA V +GL +  ++G PG+ AL +   ++      +LG+++GP 
Sbjct: 239 VALATVADVAPLVGANRALVTQGLKIMAQRGRPGMVALADVARMNEAPRPYHLGFLMGPR 298

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMES----AMLEQAEAKVLT 360
           +NAGGRIG+++LG+RLL   D  E   LA +LD LN  RR +E     A L+QAEA+ L 
Sbjct: 299 VNAGGRIGKADLGARLLACTDPAEAGALAARLDQLNTERREIEEQVRLAALDQAEARGL- 357

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                  A ++    D WHPG+VG++A+RLK+   RP+  I F+ D +G GSGRS+ G D
Sbjct: 358 ------DAPLVWAAADGWHPGVVGIVASRLKDAAHRPAIVIGFDGD-EGKGSGRSVSGVD 410

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQKFAHNIVPALITTPV 476
           +G  +     EG++ KGGGH MAAGL++ R        RL +   +       A    P 
Sbjct: 411 LGASIQKLAAEGLIEKGGGHKMAAGLSLSRAQLEPAMARLSELLARQG-----AGAGGPR 465

Query: 477 -FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              +DG+L   A  + LID +E+AGP+GAG P P FAFP+ ++   + V   HL+++F  
Sbjct: 466 DLAVDGILMPGAATVDLIDEIEAAGPFGAGAPAPRFAFPDVQISFAKRVGDRHLKVSFGD 525

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                + AIAF  Y  PLG  L    G R H+ G L +N+W+G    QLR+ DA+
Sbjct: 526 GLGAKIDAIAFGAYDGPLGPALEGHGGARFHLAGRLEINHWQGRSIPQLRLEDAA 580


>gi|84502743|ref|ZP_01000862.1| probable single-stranded DNA-specific exonuclease [Oceanicola
           batsensis HTCC2597]
 gi|84389138|gb|EAQ01936.1| probable single-stranded DNA-specific exonuclease [Oceanicola
           batsensis HTCC2597]
          Length = 582

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 248/590 (42%), Positives = 347/590 (58%), Gaps = 14/590 (2%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRAL-AITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           FL V  S++G RWV    +  ++RA  A+ Q       + +VL  R V+ + A  FL P+
Sbjct: 3   FLNVASSLTGRRWVGPSVE--LDRAAEALAQARGFDRAICQVLARRGVTAEAADLFLAPA 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R +QA+   E+I IF DYDVDG +S AL++ +L      A 
Sbjct: 61  LRDLLPDPRRLRDMEPAAARFLQAVKRRERIAIFADYDVDGGSSAALLIDWLRQMGREAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN   M+  +     LI+ VDCG+ S+D +  A   G DV+++DHH +
Sbjct: 121 LYVPDRIDEGYGPNVPAMQA-LGRTHDLIVCVDCGTLSHDPVAAA---GCDVVILDHH-L 175

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +P   A VNPNR D+     HLCAA VVFL+LV   R  R +    L  DL+++LD
Sbjct: 176 GGETLPDCVACVNPNRQDEDGALAHLCAAAVVFLMLVEANRQARAEGATSLP-DLMAMLD 234

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL G+NRA+V +GL +  R+  PGL AL +   + S  TA +LGY++GP
Sbjct: 235 LVALATVADVAPLTGVNRAFVRQGLAIMARRERPGLAALADVARMDSAPTAYHLGYLLGP 294

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG+++LG+RLL + D  E + LA +L+ LN  RR +E+A+   A A+   +  
Sbjct: 295 RINAGGRIGKADLGARLLAATDRHEAQALADRLNELNAERREIEAAVTAAAMAQAEERGL 354

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           D   A ++   G+ WHPG+VG++A+RLKE   RP+  I  + D +G GSGRS+ G D+G 
Sbjct: 355 D---APLVWASGEGWHPGVVGIVASRLKEATNRPAVVIGLDGD-EGKGSGRSVAGVDLGA 410

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V     EG+L+KGGGH MAAGLTV R       +                   ++DG+L
Sbjct: 411 SVQRLAAEGLLIKGGGHRMAAGLTVARDAIPEAMERLGALLAKQGAGTGGAADLRLDGLL 470

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
              A  + LI  +E+AGP+GAG P P F FP+  +   + V  +HL++ F       L A
Sbjct: 471 MPGAATVPLIQQIETAGPFGAGAPAPRFVFPDVAVSFAKRVGESHLKLRFGDGMGAALDA 530

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           IAF  Y  PLG  L    G R+H+ G L +N W G +  QLR+ DA+P +
Sbjct: 531 IAFGAYEGPLGTALSDRSGARVHLAGRLELNSWGGRQSVQLRIEDAAPAD 580


>gi|83954144|ref|ZP_00962864.1| single-stranded-DNA-specific exonuclease RecJ [Sulfitobacter sp.
           NAS-14.1]
 gi|83841181|gb|EAP80351.1| single-stranded-DNA-specific exonuclease RecJ [Sulfitobacter sp.
           NAS-14.1]
          Length = 579

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 255/598 (42%), Positives = 361/598 (60%), Gaps = 30/598 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAI-TQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +FLGV+ S++G RWV   G E + RA  +  Q+ ++P  + +VL  R V+ + A+ FL P
Sbjct: 2   SFLGVDASLTGRRWVGP-GVE-VERATEVLVQQTSLPLALCQVLARRGVAAEEAEAFLAP 59

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           S+R L+PDP  L D +KAA R + A+   ++I +F DYDVDG +S AL++ +L      A
Sbjct: 60  SLRDLLPDPRSLRDMEKAATRFLAAVKARQRIAVFADYDVDGGSSAALLLVWLREMGCAA 119

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN       +     LI+ VDCG+ S+  +  A     DV+++DHH 
Sbjct: 120 TLYVPDRIDEGYGPN-DAAMAELAAAHDLIVCVDCGTLSHGPVAAAVGA--DVVILDHH- 175

Query: 184 VKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
           +  E +P A A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL++LL
Sbjct: 176 LGGETLPDALAVVNPNRQDEDGALAHLCAAAVVFLMLVEAGRQLREAGA--RGPDLMALL 233

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLV LATV DV PLIG+NRA+V +GL V  R+   GL AL +   + +   A +LG+++G
Sbjct: 234 DLVGLATVADVAPLIGVNRAFVRQGLRVMARRDRLGLAALADVARMDTAPAAYHLGFLLG 293

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKV 358
           P INAGGRIG+++LG+RLL  DD  E + LA KLD+LN  RR +E+A+    L+QAEA+ 
Sbjct: 294 PRINAGGRIGQADLGARLLACDDPHEAQSLAEKLDLLNTERRDVETAVRAAALDQAEARG 353

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
                    A ++   G  WHPG+VG++A+RLKE   RPS  I F EDG G GSGRS+ G
Sbjct: 354 F-------DAPLVWASGAGWHPGVVGIVASRLKEASNRPSIVIGF-EDGIGKGSGRSVSG 405

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVER----VNFGRLCDFFQKFAHNIVPALITT 474
            D+G  +     EG+L+KGGGH MAAGLTV          RL +   K   ++  A    
Sbjct: 406 IDLGAPIQRLAAEGLLIKGGGHKMAAGLTVAEDKLDAAMARLSELLAKQGAHLAGA---- 461

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K+DG+L  +A  + L   +E AGP+GAG P P +AF + +++  + V  +HL+++F 
Sbjct: 462 ADLKLDGMLMPAAATVELAQQVEQAGPFGAGAPAPRYAFADMQIRFAKRVGESHLKISFG 521

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
             ++  + AIAF  +  PLG  L    G R H+ G L +N WRG +  QLR+ DA+P 
Sbjct: 522 DGNNTKMDAIAFGAFDGPLGPALENHGGARFHLAGRLDINTWRGRQSVQLRLEDAAPA 579


>gi|87200288|ref|YP_497545.1| single-stranded-DNA-specific exonuclease RecJ [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135969|gb|ABD26711.1| exonuclease RecJ [Novosphingobium aromaticivorans DSM 12444]
          Length = 573

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 239/561 (42%), Positives = 337/561 (60%), Gaps = 18/561 (3%)

Query: 41  DIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           DIV ++L++R V  +       P++R  +PDP I  D D AARR+  AI + E+I I+GD
Sbjct: 17  DIVTQLLLSRGVGREDLDRHRRPTLRDFLPDPSIFQDMDNAARRLTDAILSGERITIYGD 76

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDGA S AL++R L    V+A  YIPDR+++GYGP+   + +   EG+ LI+TVDCG+
Sbjct: 77  YDVDGATSAALLIRLLRELGVDAGHYIPDRLLEGYGPSGEALVRLAREGSNLIVTVDCGA 136

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDL---SGQGHLCAAGVVFL 217
            +++AL  A  +G+DVIV+DHH+   E   A ALVNPNRLD+    +  GHL A GV FL
Sbjct: 137 MAHEALAAAAAEGVDVIVVDHHKCAPELPRAAALVNPNRLDECDEAAAHGHLAAVGVAFL 196

Query: 218 VLVLIYRILR-----QDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
           + V   R LR        K P   DL++LLDLVAL TV DV  L GLNRA V +GL +  
Sbjct: 197 LAVATVRELRGRGFFDGRKAP---DLMALLDLVALGTVADVAQLKGLNRALVSQGLKIMA 253

Query: 273 RQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           R+ N GL ALI+   +S   T  +LG+ +GP INAGGR+GE+ LG RLL ++D +E   +
Sbjct: 254 RRENVGLSALIDASRLSRAPTCSDLGFALGPRINAGGRVGEATLGVRLLTTEDPEEARAI 313

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           + +L  LN  RR +E A+ E AEA+V  Q       +V+V+ G  WHPG++G++A R+KE
Sbjct: 314 SAQLSRLNDERRAIEQAVQEAAEAQVDAQ----HNRAVMVLAGSGWHPGVIGIVAGRIKE 369

Query: 393 KFGRPSFAISFEED--GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
           K G+P+  I+ + D  G G GSGRSI G D+G  +  A E G+LV GGGHAMA GLT+E 
Sbjct: 370 KTGKPTLVIALDADEAGHGKGSGRSISGVDLGAAIIAAREAGLLVAGGGHAMACGLTIEP 429

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
               RL D+  +     V A  ++    +D  L+   +   L++ LE+AGP+G G P P 
Sbjct: 430 SALSRLADWLDERLSRDVTAAQSSQALLLDLSLSPGGLTPDLVETLEAAGPFGVGWPGPR 489

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTG 569
            A    +L    +V   H++M     D  + +AIAFR   + LG+ L+  SRG++  + G
Sbjct: 490 VAVGPVRLVKCDLVGTDHVRMVAAGADGRSFKAIAFRAAQSELGQVLLNASRGRQFWLAG 549

Query: 570 HLCVNYWRGSKRCQLRVLDAS 590
              ++ W      +L V DA+
Sbjct: 550 RARIDDWASRPAAELHVEDAA 570


>gi|260426541|ref|ZP_05780520.1| single-stranded-DNA-specific exonuclease RecJ [Citreicella sp.
           SE45]
 gi|260421033|gb|EEX14284.1| single-stranded-DNA-specific exonuclease RecJ [Citreicella sp.
           SE45]
          Length = 579

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 253/597 (42%), Positives = 351/597 (58%), Gaps = 28/597 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           ++LGVE S++G RWV   G E   +A A+ Q+   P  +  VL    V       +L P 
Sbjct: 2   SYLGVESSLNGRRWVGP-GVEQERQAEAMAQQTGQPRALCAVLARLGVEPAEVPGYLEPK 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R ++A+   E+I +F DYDVDG +S AL++ +L      A 
Sbjct: 61  LRELLPDPRGLRDMETAAARFLEAVKRRERIAVFADYDVDGGSSAALLIDWLHQMGREAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M++       LI+ VDCG+ S++ +  A     DV+V+DHH +
Sbjct: 121 LYIPDRIDEGYGPNVPAMQQLAG-AHDLIVCVDCGTLSHEPIAAAAG--ADVVVLDHH-L 176

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +P   A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL+S+LD
Sbjct: 177 GGETLPDCVAVVNPNRQDEDGTLAHLCAAAVVFLMLVECGRQLREAGA--RGPDLMSMLD 234

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PLIG+NRA V +GL V  R+  PGL AL +   + +  ++ +LGY++GP
Sbjct: 235 LVALATVADVAPLIGVNRALVRQGLAVMARRQRPGLVALSDVARLDTAPSSYHLGYVLGP 294

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVL 359
            +NAGGRIG++++G+RLL S D  E E LA +LD LN  RR +E A+    L QAEA+ L
Sbjct: 295 RVNAGGRIGQADIGARLLASRDRHEAEALAERLDRLNTERREVEEAVRASALAQAEARGL 354

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A ++   GD WHPG+VG++A+RLKE   RP+  I   + G+G GSGRS+ G 
Sbjct: 355 -------DAPLVWAAGDGWHPGVVGIVASRLKEMTNRPAVVIGL-DGGEGKGSGRSVSGV 406

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQKFAHNIVPALITTP 475
           D+G  V   V EG+L+KGGGH MAAGLTV          RL +   K       A     
Sbjct: 407 DLGASVQRLVAEGLLLKGGGHKMAAGLTVAEAQLEAAMARLAELLAKQGAGKGGAAD--- 463

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
             ++DG+L   A  + L +MLE AGP+GAG P+P FAFP+ ++   + V   HL+++   
Sbjct: 464 -LRLDGMLMPGAATVELCEMLERAGPFGAGAPSPRFAFPDVQVSFAKQVGSGHLKLSLGD 522

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
                L AI F  +  PLG+ L   +G+R  + G L +N W G +  QLR+ DA+P 
Sbjct: 523 GLGARLDAICFGAFEGPLGQALTDHKGQRFQMAGRLEINEWNGRRAVQLRLEDAAPA 579


>gi|146276882|ref|YP_001167041.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555123|gb|ABP69736.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 583

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 263/593 (44%), Positives = 359/593 (60%), Gaps = 24/593 (4%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S +G RWV    +E    A A+ Q   +P  + R LV R VS   A+ FL P
Sbjct: 7   RAFLGVEASATGRRWVGPSPEED-RLAEAMAQTTRLPLALCRTLVRRGVSATEAESFLAP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDPL L D   AA R++QA+   EKI IF DYDVDG +S AL++ +L      A
Sbjct: 66  ALRDLLPDPLTLKDMAPAAARLLQAVARREKIAIFADYDVDGGSSAALLIVWLRAMGRAA 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M+  +     LI+ VDCG+ S++ +  AT  G DV+V+DHH 
Sbjct: 126 TLYIPDRIDEGYGPNVPAMQA-LAAAHDLILCVDCGTLSHEPIAAAT--GADVVVLDHHL 182

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLL 242
                 PA A+VNPNR D+    GHLCAA VVFL+LV   R LR +  + P   DL+++L
Sbjct: 183 GTETLPPALAVVNPNRQDEDGSLGHLCAASVVFLLLVEANRRLRAEGVQGP---DLMAML 239

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL G+NRA V +GL V  R+  PGL AL +   ++S      LG+++G
Sbjct: 240 DLVALATVADVAPLTGVNRALVRQGLKVMARRERPGLVALADVSRMNSAPNCYALGFLLG 299

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P +NAGGRIG+++LG+RLL +DD +E + LA +LD LN  RR +E+ + E+A A+   + 
Sbjct: 300 PRVNAGGRIGQADLGARLLATDDPREAQALAERLDQLNTERREIEARVREEALAQAEARG 359

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
                  ++   G+ WHPG+VG++AARLKE   RP+  I   E+G G GSGRSI G D+G
Sbjct: 360 ---TSGPLVWAAGEGWHPGVVGIVAARLKEATNRPAIVIGL-ENGIGKGSGRSISGVDLG 415

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFG----RLCDFF-QKFAHNIVPALITTPVF 477
             V     EG+L+KGGGH MAAGLTVE    G    RL D   ++ A +  PA       
Sbjct: 416 AAVHRVAHEGLLLKGGGHRMAAGLTVEEGRLGAAMERLSDLLARQGAASAGPA-----DL 470

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
           ++DGVL  SA   A ++ +ESAGPYGAG   P FA  + ++ + R +   HL++T    +
Sbjct: 471 RLDGVLMPSAATAAFVEQIESAGPYGAGAAAPRFALASQRVVT-RRMGEKHLRLTIGGAE 529

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              L+A+AF  +  PLG  L        H+ G L ++ W GS R Q+R+ DA+
Sbjct: 530 GR-LEAVAFGCFDGPLGPLLEGGGAGLFHLAGRLEIDTWGGSARVQMRLEDAA 581


>gi|114570056|ref|YP_756736.1| single-stranded-DNA-specific exonuclease RecJ [Maricaulis maris
           MCS10]
 gi|114340518|gb|ABI65798.1| exonuclease RecJ [Maricaulis maris MCS10]
          Length = 603

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 234/590 (39%), Positives = 340/590 (57%), Gaps = 10/590 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
            LGV  S+SG RW      +G    +A  ++ +IPD +ARV+  R V+ D A  FL+P +
Sbjct: 15  LLGVSRSLSGKRWRLREADDGAVAMMA--RQQSIPDALARVMAARGVAPDQAAAFLSPRL 72

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R   PDP    D DKAA  +  AI     + +F DYDVDGA S A ++R+  H    A +
Sbjct: 73  RDSFPDPSDFADMDKAAGLVWDAIEAERPMAVFADYDVDGATSAAQLIRYFRHFDRTAEI 132

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           Y+PDR+ +GYGP+ +  +     GA+L+ITVDCG+ +  AL +A + G+DVIVIDHH + 
Sbjct: 133 YVPDRVEEGYGPSGTAFDTLKARGAELVITVDCGAAARIALTHAASIGLDVIVIDHHLMD 192

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLSLLD 243
            +  PA ALVNPNR DD SG GHL AAGV F+ L  + R  R+   +  + +  LL  +D
Sbjct: 193 DDMPPAAALVNPNRPDDRSGCGHLAAAGVTFVFLAALNREGRRRGTITPDNEPSLLDWID 252

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           L AL T+CDVVPL G+NRA   +GL       + GL+ L E   +    +  + G++IGP
Sbjct: 253 LAALGTICDVVPLTGVNRAITAQGLKAMSGWRHLGLRCLAETSGVDGEASTYHAGFLIGP 312

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGR+G ++LG+ LL ++D      +A +LD LN  RR +E+ +LE A A++  Q  
Sbjct: 313 RINAGGRVGRADLGATLLTTEDETLARRIAGELDGLNSERRAIEADVLEAASAQLDGQSA 372

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK---GIGSGRSIEGFD 420
           D    ++++  G+ WHPG++G++A RLKE+F +P   I  + + +   G GSGRS+ G +
Sbjct: 373 D---RAILIAAGEGWHPGVIGVVAGRLKERFDKPVIVIGIDREARPPVGKGSGRSVPGVN 429

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  ++ A E G+L  GGGHAMA GL+++      L  F  +     + A       K D
Sbjct: 430 LGGAIAAAREAGLLTSGGGHAMAGGLSMDPDRITELVAFLDERLAPELAAAADDMALKAD 489

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           GVL AS V++ L  MLE A P+G GN  P FA P+ ++   + V   H++ T    D   
Sbjct: 490 GVLTASGVSLDLARMLERAAPFGQGNAEPRFALPDMRVSFAKRVGTDHVRFTLSDPDGRR 549

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +  I FR   TP+GE L+ +     H  G L ++ W+G +R QL + D S
Sbjct: 550 VDGICFRCADTPIGEALLAAGPGLFHAFGRLKLDAWQGRERVQLHLEDLS 599


>gi|126729046|ref|ZP_01744860.1| single-stranded-DNA-specific exonuclease RecJ [Sagittula stellata
           E-37]
 gi|126710036|gb|EBA09088.1| single-stranded-DNA-specific exonuclease RecJ [Sagittula stellata
           E-37]
          Length = 581

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 248/593 (41%), Positives = 352/593 (59%), Gaps = 20/593 (3%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           A+LGV+ S+SG RWV     E   +A  + Q+  +   +  +L    V  + A+ +L P 
Sbjct: 2   AYLGVKNSLSGRRWVGP-DVETERQAELLAQQTGLARPLCAILARLGVPPEEAQPYLEPR 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R ++A+   E+I +F DYDVDG +S AL++ +L      A 
Sbjct: 61  LRDLLPDPRSLKDMETAATRFLKAVSGRERIAVFADYDVDGGSSAALLIDWLRQMGRPAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPNP+ M     +   LI+ VDCG+ S+DA+  A  +G DV+V+DHH +
Sbjct: 121 LYVPDRIDEGYGPNPTAMAALARD-HDLIVCVDCGTLSHDAI--AAAKGADVVVLDHH-L 176

Query: 185 KSEEIPA-YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +PA  A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL+ +LD
Sbjct: 177 GGETLPACVAVVNPNRQDEDGELAHLCAAAVVFLMLVEAGRQLREAGA--RGPDLMKMLD 234

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL G+NRA V +GL V  R+   GL AL +   +     + +LG+++GP
Sbjct: 235 LVALATVADVAPLRGVNRALVQQGLKVMGRRERVGLVALSDVARLERAPESYHLGFVLGP 294

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            +NAGGRIG+++LG+RLL SD+  E + +A +L+ LN  RR +E+A+   A A+   +  
Sbjct: 295 RVNAGGRIGQADLGARLLASDNPAEAQAMAERLEALNAERREIEAAVRAAALAQAEARGL 354

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           D   A +I   G+ WHPG+VG++A+RLKE  GRPS  I   +  +G GSGRS+ G D+G 
Sbjct: 355 D---APLIWAAGEGWHPGVVGIVASRLKEHTGRPSIVIGL-DGAEGKGSGRSVAGVDLGA 410

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQKFAHNIVPALITTPVFKI 479
            V     EG+L+KGGGH MAAGLTV R        RL +  +K       A       ++
Sbjct: 411 SVQRLAAEGLLIKGGGHRMAAGLTVARDRLEEAMARLSELLEKQGAGSGGA----SDLRV 466

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DGVL   A  + L++ LE AGP+G G P P F  P+ +L   +VV   HL++T       
Sbjct: 467 DGVLMPGAAQVDLVEDLERAGPFGQGAPGPRFVVPDVRLSFAKVVGAGHLKITCGDGLGA 526

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            L+AI F     PLG+ L+  +G+R H+ G L VN W+G    Q+R+ DA+P 
Sbjct: 527 RLEAICFNAMDGPLGQTLLNHQGRRFHLAGKLDVNTWQGRHTVQMRLDDAAPA 579


>gi|190571037|ref|YP_001975395.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019558|ref|ZP_03335364.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|190357309|emb|CAQ54738.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212994980|gb|EEB55622.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 579

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 242/575 (42%), Positives = 358/575 (62%), Gaps = 28/575 (4%)

Query: 24  QEGINRAL-AITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAA 82
           QE   R +  + Q+  +P+I+AR+LV R V+I+ A DFL+P IR L+PDP  L D DKA 
Sbjct: 18  QEADQREIFTLIQRFELPEILARILVARGVNIENAHDFLHPLIRSLLPDPFHLLDMDKAV 77

Query: 83  RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLM 142
             I++AI N+E I IFGDYDVDGA S AL+ R+L     ++ +YIPDR+ +GYG N   +
Sbjct: 78  SHIIKAINNNENIAIFGDYDVDGATSSALINRYLRAIGTHSIIYIPDRVDEGYGLNTDAL 137

Query: 143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLD 201
            +    G  L I+VDCG+ +Y  ++ A   G+D+IV+DHH + +E++P A A+VNPNRLD
Sbjct: 138 LQLKKNGIDLCISVDCGTLAYQPIEDAKVFGLDIIVVDHH-LGTEKLPSAVAVVNPNRLD 196

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPL 256
           + S   +L A GV FL++V + RILR+     + K P   DL  LLDLVAL TVCDV+ +
Sbjct: 197 ESSPYNNLAAVGVSFLLIVALNRILREQGFFTNKKEP---DLFDLLDLVALGTVCDVMQI 253

Query: 257 IGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNL 316
            GLNRA+V++GL V   + N GL+ L + + I    +   LG+ IGP INAGGRIGE++L
Sbjct: 254 TGLNRAFVLQGLKVMSARKNVGLRVLFDALGILEKPSVSRLGFSIGPCINAGGRIGEASL 313

Query: 317 GSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV--IVVE 374
           G+RLL +DD  +   +A+KL  LN  R+++E+  + +A     TQ ++     V  I+V 
Sbjct: 314 GARLLSTDDDDDAHSIALKLIDLNNARKMLENEAILEAT----TQAENFAHLGVNFIMVS 369

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
           G+ WH GI+G++A+RLKE+F  P+  IS   +G G  S RSI G DIG  V  A    ++
Sbjct: 370 GN-WHQGIIGIIASRLKEQFHLPTIVISL-NNGIGKASCRSISGVDIGAAVLSAKFTNLI 427

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           ++GGGH+MAAG +++      L DFF ++FA++         + K DG++ A A+N++L 
Sbjct: 428 IEGGGHSMAAGFSIKEDKISDLHDFFTERFANS-----TNDKIIKADGIVTAKAINLSLW 482

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           + L+   P+GAGNP P F     K++   V+ + H++  F + D+  ++AIAFR   T L
Sbjct: 483 NQLQRLEPFGAGNPEPRFIIQGAKIRKPEVIGVDHIK-CFIADDNVMVKAIAFRCANTEL 541

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           G  +MQ  G    + G + +NYW G++  Q  + D
Sbjct: 542 GSAIMQ--GNVKAILGKISMNYWNGNEFVQFLIED 574


>gi|42520197|ref|NP_966112.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42409935|gb|AAS14046.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 579

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 241/573 (42%), Positives = 355/573 (61%), Gaps = 24/573 (4%)

Query: 24  QEGINRA-LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAA 82
           QE   R  L +TQ+  +P+I+AR+LV R V+I+ A DFL P IR L+PDP  L D DKA 
Sbjct: 18  QEADQRQILTLTQRFELPEILARILVTRGVNIENASDFLYPLIRSLLPDPFHLLDMDKAV 77

Query: 83  RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLM 142
            RI++AI N E + IFGDYDVDGA S AL+ R+L    +++ +YIPDR+ +GYG N   +
Sbjct: 78  SRIIRAIKNDENLAIFGDYDVDGATSSALINRYLRAIDIHSIIYIPDRVDEGYGLNTDAL 137

Query: 143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLD 201
            +    G  L I+VDCG+ +Y  ++ A   G+D+IV+DHH + +E++P A A+VNPNRLD
Sbjct: 138 LQLKKNGIDLCISVDCGTLAYQPIEDAKAFGLDIIVVDHH-LGTEKLPSAVAVVNPNRLD 196

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPL 256
           + S   +L A GV FL++V + + LR+     + K P   DL  LLDLVAL TVCDV+ +
Sbjct: 197 ESSPYNNLAAVGVSFLLIVALNKSLREQGFFTNKKEP---DLFDLLDLVALGTVCDVMQI 253

Query: 257 IGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNL 316
            GLNRA V +GL V   + N GL+ L + + I    +   LG+ IGP INAGGRIGE++L
Sbjct: 254 TGLNRALVSQGLKVMSTRKNVGLRVLFDALGILEKPSVSRLGFSIGPCINAGGRIGEASL 313

Query: 317 GSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGD 376
           G+RLL +DD +E   +A+KL  LN  R+++E+  L +A A+          A+ I++ G+
Sbjct: 314 GARLLSTDDDEEAHSIALKLIDLNNARKVLENEALLEATAQAEKSAQ--SGANFIMISGN 371

Query: 377 RWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVK 436
            WH GI+G++A+RLKE+F  P+  IS   +G G  S RSI G DIG  V  A    ++++
Sbjct: 372 -WHQGIIGIIASRLKEQFHLPTVVISL-NNGIGKASCRSILGVDIGAAVLSAKFINLIIE 429

Query: 437 GGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           GGGH+MAAG +++      L DFF ++F+++     I     K D ++ A A+N++L + 
Sbjct: 430 GGGHSMAAGFSIKEDKINDLHDFFTERFSNS-----INEKTLKADSIVTAKAINLSLWNQ 484

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGE 555
           L+  GP+G GNP P F     K++   V+ + H++  F + D+  ++AIAFR   T LG 
Sbjct: 485 LQRLGPFGVGNPEPRFIIQGAKIRKPEVIGVDHIK-CFIADDNVMVRAIAFRSANTHLGS 543

Query: 556 FLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            +MQ  G    + G + +NYW G++  Q  + D
Sbjct: 544 AIMQ--GNVKAILGKISMNYWNGNEFVQFLIED 574


>gi|326403489|ref|YP_004283571.1| single-stranded-DNA-specific exonuclease RecJ [Acidiphilium
           multivorum AIU301]
 gi|325050351|dbj|BAJ80689.1| single-stranded-DNA-specific exonuclease RecJ [Acidiphilium
           multivorum AIU301]
          Length = 594

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 238/592 (40%), Positives = 338/592 (57%), Gaps = 15/592 (2%)

Query: 7   LGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
            GVE S++G RW   L +   +R A AI Q+  +PD++ R+L  R V  D+A DFL P++
Sbjct: 12  FGVERSLTGRRW---LWRPAADRTAQAIAQRCGVPDVIGRLLAGRGVMPDHAADFLEPTL 68

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R  +PDP  LTD D AA RI  ++     I IFGDYDVDGA S ALM   L         
Sbjct: 69  RAYLPDPSALTDMDAAAARIADSVQRGATIAIFGDYDVDGACSGALMALGLGELGATTIN 128

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           Y+PDR+ +GYGPN   +     +GA+L++ VDCG+ +++AL  A +   D IV+DHH+ +
Sbjct: 129 YVPDRLREGYGPNAPALRALAGQGAELVVCVDCGTAAHEALA-ALDGRADAIVLDHHKSE 187

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLSLLD 243
                  A VNPNR DD SG G++CAA + FL LV + R LR+          DLLS+LD
Sbjct: 188 GAPPAIVATVNPNRADDASGLGNVCAATISFLTLVAVQRELRRRGFFATRREIDLLSMLD 247

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDV+PL GLNRA V +GL V  R+  PG+ AL++   +         G+ IGP
Sbjct: 248 LVALATVCDVMPLTGLNRALVTQGLKVMARRERPGIAALLDVAQVREAPGTMTCGFAIGP 307

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INA GRI E++LG R L++ +     +LA +LD +N+ R+ +E+ +L++A      Q  
Sbjct: 308 RINAAGRIAEADLGLRTLLAAEPATAMVLARRLDEINRERQAVEAGLLDEAMTDAEAQF- 366

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               A V +V G++WHPG+VG++A R+KE F RP+      E G+ +GSGRS+ G D+G 
Sbjct: 367 -AAGAPVALVAGEQWHPGVVGIVAGRIKETFNRPALVAGIAE-GRAVGSGRSVPGVDLGS 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGV 482
            +  A E G+L+KGGGHAMAAG TVE      L  F  ++ A  +   L       I+G+
Sbjct: 425 AIIAAREAGLLIKGGGHAMAAGFTVEAGRIEALRGFLAERLA--VAATLPDAADLPIEGM 482

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHK-LQSIRV-VNLAHLQMTFESQDSET 540
                ++ AL   +   GP+GAGN  PVF  P  + L++ R+  N A ++   E +    
Sbjct: 483 AAVGGIDEALAAAIGRVGPFGAGNEEPVFVVPRARVLRADRIGRNEATIRAFVEGEAGGR 542

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           L+ I FR     L   L +  G  +++ GH+    W G     L ++DA+P 
Sbjct: 543 LKTILFRAGDGDLAAALARPGGAPLNLAGHIRAEQWNGRTSVSLILIDAAPA 594


>gi|88658434|ref|YP_507899.1| single-stranded-DNA-specific exonuclease RecJ [Ehrlichia
           chaffeensis str. Arkansas]
 gi|88599891|gb|ABD45360.1| single-stranded-DNA-specific exonuclease RecJ [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 589

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 242/597 (40%), Positives = 355/597 (59%), Gaps = 35/597 (5%)

Query: 9   VECSISGFRWVSLLG------QEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           + C++    ++ + G             L ITQK  I +IVARVL  R V+I+   DFL 
Sbjct: 2   LHCNLENLEYIGVTGALWKPYNVNFRDVLTITQKLGISEIVARVLSTRKVNIEEINDFLY 61

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R  +PDP  L D DKA +RI  AIYN E+I+IFGDYDVDGA S AL+ ++L+   V 
Sbjct: 62  PTLRSSLPDPFHLLDMDKAIQRICHAIYNKERIVIFGDYDVDGATSSALIKQYLTQIGVP 121

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +YIPDRI +GYGPN   + K    G  L ITVDCG+ +++ +  A +  +DVIVIDHH
Sbjct: 122 TTIYIPDRICEGYGPNTQALLKLQEIGHSLCITVDCGTIAHEPISVAKSVNLDVIVIDHH 181

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFD 237
              +    A A++NPNRLD+ S   +L   GV FL+LV + + L++     +N  P   +
Sbjct: 182 MGLNTLPDAIAVINPNRLDENSPYTYLAGVGVSFLMLVALNKTLKEKGFFTNNNEP---N 238

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           L++ LDLVAL TVCDV+P+IGLNRA+V +GL +   + N GLK L + + +        L
Sbjct: 239 LINYLDLVALGTVCDVMPIIGLNRAFVKQGLKIMATRQNIGLKVLSDVIGLEDKPNTYQL 298

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLME----SAMLEQ 353
           G+ IGP INAGGR+G ++LG+RLL S+  +E   ++ KL   N  R+ +E    +  +EQ
Sbjct: 299 GFNIGPHINAGGRVGNASLGARLLSSNSEEEALEISEKLQNFNLERKELEHRSFNEAVEQ 358

Query: 354 AEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSG 413
           AEA + T  +      +I+V G+ WHPGI+G++A RLK+KF  PS  IS ++ G G  S 
Sbjct: 359 AEALISTNTN------LIIVAGN-WHPGIIGIVAGRLKDKFFLPSIVISLDK-GIGKASA 410

Query: 414 RSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALIT 473
           RSI   D+G  +  A  EGI+ +GGGHAMAAG +++      L +F  +  HNI      
Sbjct: 411 RSIPDVDLGAAILSAKLEGIITEGGGHAMAAGFSIQEDKIKTLNEFLSQRFHNIN----K 466

Query: 474 TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
             VFK+DG++ A+AVN+ L   L+   P+G GNP P F   N K+++  ++  +H++   
Sbjct: 467 QKVFKVDGIITAAAVNLTLWKELQFLEPFGIGNPEPRFILTNIKIKNPEIIGDSHIRCLI 526

Query: 534 ESQDSET-LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
              D++T ++ I FR   T LG  L++     + + G + VNYW+G++  Q  + DA
Sbjct: 527 --HDNKTFIKGICFRCTDTELGLALLERTA--IMLLGKISVNYWKGNENIQFIIEDA 579


>gi|148260299|ref|YP_001234426.1| single-stranded-DNA-specific exonuclease RecJ [Acidiphilium cryptum
           JF-5]
 gi|146401980|gb|ABQ30507.1| exonuclease RecJ [Acidiphilium cryptum JF-5]
          Length = 594

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 238/592 (40%), Positives = 338/592 (57%), Gaps = 15/592 (2%)

Query: 7   LGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
            GVE S++G RW   L +   +R A AI Q+  +P+++ R+L  R V  D+A DFL P++
Sbjct: 12  FGVERSLTGRRW---LWRPAADRTAQAIAQRCGVPEVIGRLLAGRGVMPDHAADFLEPTL 68

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R  +PDP  LTD D AA RI  ++     I IFGDYDVDGA S ALM   L         
Sbjct: 69  RAYLPDPSALTDMDAAAARIADSVQRGATIAIFGDYDVDGACSGALMALGLGELGATTIN 128

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           Y+PDR+ +GYGPN   +     +GA+LI+ VDCG+ +++AL  A +   D IV+DHH+ +
Sbjct: 129 YVPDRLREGYGPNAPALRALAGQGAELIVCVDCGTAAHEALA-ALDGRADAIVLDHHKSE 187

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLSLLD 243
                  A VNPNR DD SG G++CAA + FL LV + R LR+          DLLS+LD
Sbjct: 188 GAPPAIVATVNPNRADDASGLGNVCAATISFLTLVAVQRELRRRGFFATRREIDLLSMLD 247

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDV+PL GLNRA V +GL V  R+  PG+ AL++   +         G+ IGP
Sbjct: 248 LVALATVCDVMPLTGLNRALVTQGLKVMARRERPGIAALLDVAQVREAPGTMTCGFAIGP 307

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INA GRI E++LG R L++ +     +LA +LD +N+ R+ +E+ +L++A      Q  
Sbjct: 308 RINAAGRIAEADLGLRTLLAAEPATAMVLARRLDEINRERQAVEAGLLDEAMTDAEAQF- 366

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
               A V +V G++WHPG+VG++A R+KE F RP+      E G+ +GSGRS+ G D+G 
Sbjct: 367 -AAGAPVALVAGEQWHPGVVGIVAGRIKETFNRPALVAGIAE-GRAVGSGRSVPGVDLGS 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGV 482
            +  A E G+L+KGGGHAMAAG TVE      L  F  ++ A  +   L       I+G+
Sbjct: 425 AIIAAREAGLLIKGGGHAMAAGFTVEAGRIEALRGFLAERLA--VAATLPDAADLPIEGM 482

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHK-LQSIRV-VNLAHLQMTFESQDSET 540
                ++ AL   +   GP+GAGN  PVF  P  + L++ R+  N A ++   E +    
Sbjct: 483 AAVGGIDEALAAAIGRVGPFGAGNEEPVFVVPRARVLRADRIGRNEATIRAFVEGEAGGR 542

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           L+ I FR     L   L +  G  +++ GH+    W G     L ++DA+P 
Sbjct: 543 LKTILFRAGDGDLAAALARPGGAPLNLAGHIRAEQWNGRTSVSLILIDAAPA 594


>gi|58698831|ref|ZP_00373706.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630248|ref|YP_002727039.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia sp. wRi]
 gi|58534647|gb|EAL58771.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592229|gb|ACN95248.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia sp. wRi]
          Length = 579

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 240/573 (41%), Positives = 355/573 (61%), Gaps = 24/573 (4%)

Query: 24  QEGINRA-LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAA 82
           QE   R  L +TQ+  +P+I+AR+LV R V+I+ A DFL P IR L+PDP  L D DKA 
Sbjct: 18  QEADQRQILTLTQRFELPEILARILVTRGVNIENASDFLYPLIRSLLPDPFHLLDMDKAV 77

Query: 83  RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLM 142
            RI++AI N E + IFGDYDVDGA S AL+ R+L    +++ +YIPDR+ +GYG +   +
Sbjct: 78  SRIIRAIKNDENLAIFGDYDVDGATSSALINRYLRAIDIHSIIYIPDRVDEGYGLSTDAL 137

Query: 143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLD 201
            +    G  L I+VDCG+ +Y  ++ A   G+D+IV+DHH + +E++P A A+VNPNRLD
Sbjct: 138 LQLKKNGIDLCISVDCGTLAYQPIEDAKAFGLDIIVVDHH-LGTEKLPSAVAIVNPNRLD 196

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPL 256
           + S   +L A GV FL++V + + LR+     + K P   DL  LLDLVAL TVCDV+ +
Sbjct: 197 ESSPYNNLAAVGVSFLLIVALNKSLREQGFFTNKKEP---DLFDLLDLVALGTVCDVMQI 253

Query: 257 IGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNL 316
            GLNRA V +GL V   + N GL+ L + + I    +   LG+ IGP INAGGRIGE++L
Sbjct: 254 TGLNRALVSQGLKVMSTRKNVGLRVLFDALGILEKPSVSRLGFSIGPCINAGGRIGEASL 313

Query: 317 GSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGD 376
           G+RLL +DD +E   +A+KL  LN  R+++E+  L +A A+          A+ I++ G+
Sbjct: 314 GARLLSTDDDEEAHSIALKLIDLNNARKVLENEALLEATAQAEKSAQ--SGANFIMISGN 371

Query: 377 RWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVK 436
            WH GI+G++A+RLKE+F  P+  IS   +G G  S RSI G DIG  V  A    ++++
Sbjct: 372 -WHQGIIGIIASRLKEQFHLPTVVISL-NNGIGKASCRSILGVDIGAAVLSAKFINLIIE 429

Query: 437 GGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           GGGH+MAAG +++      L DFF ++F+++     I     K D ++ A A+N++L + 
Sbjct: 430 GGGHSMAAGFSIKEDKINDLHDFFTERFSNS-----INEKTLKADSIVTAKAINLSLWNQ 484

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGE 555
           L+  GP+G GNP P F     K++   V+ + H++  F + D+  ++AIAFR   T LG 
Sbjct: 485 LQRLGPFGVGNPEPRFIIQGAKIRKPEVIGVDHIK-CFIADDNVMVKAIAFRSANTHLGS 543

Query: 556 FLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            +MQ  G    + G + +NYW G++  Q  + D
Sbjct: 544 AIMQ--GNVKAILGKISMNYWNGNEFVQFLIED 574


>gi|163731960|ref|ZP_02139407.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Roseobacter litoralis Och 149]
 gi|161395414|gb|EDQ19736.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Roseobacter litoralis Och 149]
          Length = 580

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 261/598 (43%), Positives = 363/598 (60%), Gaps = 31/598 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRAL-AITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +FLG+E S++G RWV    +  + RA   + Q+  +P  V +VL  R V  + A+ FL P
Sbjct: 2   SFLGIERSLTGRRWVGPTAE--MERAAQTLEQRADLPAPVCQVLARRGVQAEDAQSFLAP 59

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP  L D  KAA R + A+   EKI IF DYDVDG +S AL++ +L      A
Sbjct: 60  ALRDLMPDPRSLKDMTKAATRFLDAVRKREKIAIFADYDVDGGSSAALLLSWLRQTGREA 119

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M + +     LI+ VDCG+ S+  +  A   G DV+V+DHH 
Sbjct: 120 TLYIPDRIDEGYGPNDEAMAQ-LARAHDLIVCVDCGTLSHGPIAAAV--GADVLVLDHH- 175

Query: 184 VKSEEIPA-YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
           + +EE+PA  A+VNPNR D+    GHLCAAGVVFL+LV + R+LR+  +   + DL+S L
Sbjct: 176 LGTEELPAALAVVNPNRQDESGDLGHLCAAGVVFLLLVELRRLLREAGQT--SPDLMSFL 233

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL+G+NRA+V +GL V  R+   GL AL +   + +   A +LG+++G
Sbjct: 234 DLVALATVADVAPLVGINRAFVRQGLKVLARRERIGLTALADVAGVDTEPNAYHLGFILG 293

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKV 358
           P +NAGGRIG ++LG+RLL ++D  E   LA +LD LN  RR +E+A+    L QAE + 
Sbjct: 294 PRVNAGGRIGAADLGARLLATNDPHEAAALAERLDKLNTERREIEAAVRATALAQAEERG 353

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           L +        ++   G  WHPG+VG++A+RLKE  GRPS  I    DG G GSGRS+ G
Sbjct: 354 LDR-------PLVWAAGADWHPGVVGIVASRLKEAAGRPSIVIGI-SDGIGKGSGRSVSG 405

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVE----RVNFGRLCDFFQKFAHNIVPALITT 474
            D+G+ +     EG+L+KGGGH MAAGLTVE         RL +  +K   + + A    
Sbjct: 406 IDLGQPIQRLAAEGLLLKGGGHKMAAGLTVEESKIETAMARLSELLEKQGASSIGA---- 461

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
               IDG+L   A  + L+  +E AGP+GA  P P + F N  ++  + V   HL+++F 
Sbjct: 462 ADLHIDGMLMPEAAAVELVQKIEQAGPFGAAAPAPRYVFANVAVRFAKRVGENHLKLSFG 521

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           S D+ ++ AI F  Y T LG  L    G R H+ G L +N WRG +  QLR+ DA+P 
Sbjct: 522 S-DAGSMDAICFGAYDTDLGPTLETHGGARFHLAGRLDINTWRGRQSVQLRLEDAAPA 578


>gi|77463976|ref|YP_353480.1| single-stranded DNA-specific exonuclease [Rhodobacter sphaeroides
           2.4.1]
 gi|77388394|gb|ABA79579.1| probable single-stranded DNA-specific exonuclease [Rhodobacter
           sphaeroides 2.4.1]
          Length = 583

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 256/595 (43%), Positives = 361/595 (60%), Gaps = 28/595 (4%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S +G RWV    +E    A A+ Q   +P  + R LV R V    A+ FL P
Sbjct: 7   RAFLGVEASATGRRWVGPSPEED-RLAEAMAQTTRLPLALCRTLVRRGVPASDAESFLAP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDPL L D   AA R++QA+   E+I IF DYDVDG +S AL++ +L     +A
Sbjct: 66  ALRDLLPDPLTLKDMAPAAARLLQAVARRERIAIFADYDVDGGSSAALLIVWLRALGRSA 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M+  + E   LI+ VDCG+ S++ +  A  +G DV+V+DHH 
Sbjct: 126 TLYIPDRIDEGYGPNVPAMQA-LAEAHDLILCVDCGTLSHEPI--AAAKGADVVVLDHHL 182

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLL 242
                 PA A+VNPNR D+    GHLCAA VVFL+LV   R LR +  + P   DL+++L
Sbjct: 183 GAETLPPALAVVNPNRQDEDGALGHLCAASVVFLLLVEANRRLRAEGVQGP---DLMAML 239

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL G+NRA V +GL V  R+  PGL AL +   + +   +  LG+++G
Sbjct: 240 DLVALATVADVAPLTGVNRALVRQGLKVMARRERPGLVALADVARMKTAPNSYALGFLLG 299

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLE----QAEAKV 358
           P +NAGGRIG+++LG+RLL ++D +E + LA +LD LN  RR +E+ + E    QAEA+ 
Sbjct: 300 PRVNAGGRIGQADLGARLLSTEDPREAQALAERLDQLNTERREIEARVREEALAQAEARG 359

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           ++         ++   G+ WHPG+VG++AARLKE   RP+  I F E+G G GSGRSI G
Sbjct: 360 IS-------GPLVWAAGEGWHPGVVGIVAARLKEATNRPAVVIGF-ENGIGKGSGRSIAG 411

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIV--PALITTPV 476
            D+G  +     EG+L+KGGGH MAAGLTVE    GRL    ++    +    A    P 
Sbjct: 412 VDLGASIHRVAHEGLLLKGGGHRMAAGLTVEE---GRLEAAMERLGELLARQGAAEAGPA 468

Query: 477 -FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
             ++DG+L  SA     ++ ++SAGPYGAG   P FA  + ++   R+ +  H+++T   
Sbjct: 469 DLRLDGLLMPSAATAEFVEQIDSAGPYGAGAAAPRFALADQRVTCRRMGD-KHMRLTIGG 527

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +   L+A+AF  +  PLG  L      R H+ G L ++ W GS R Q+R+ DA+
Sbjct: 528 AEGR-LEAVAFGCFDGPLGPLLEGGGAGRFHLAGRLEIDTWGGSARVQMRLEDAA 581


>gi|149184834|ref|ZP_01863152.1| single-stranded DNA-specific exonuclease [Erythrobacter sp. SD-21]
 gi|148832154|gb|EDL50587.1| single-stranded DNA-specific exonuclease [Erythrobacter sp. SD-21]
          Length = 594

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 235/596 (39%), Positives = 351/596 (58%), Gaps = 24/596 (4%)

Query: 6   FLGVECSISG--FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
             GV  S++G  +RW       G N  L          IV ++L+ R V+ D  +  L+P
Sbjct: 9   IFGVSQSLTGRAWRW------RGGNMDLGQGHFGDADAIVRQILLARGVAQDDLQRHLSP 62

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R  +PDP   +D + AA RI QA+ ++E+I I+GDYDVDGA S AL++R L    V A
Sbjct: 63  TLRDFLPDPSEFSDMETAADRIAQAVLSNERITIYGDYDVDGATSSALLIRLLRDLGVEA 122

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           + YIPDR+++GYGP+   + K    G+ LI+TVDCG+ +++AL  A++ G+DVIV+DHH+
Sbjct: 123 DYYIPDRLLEGYGPSGEALVKLAQAGSSLIVTVDCGAMAHEALAMASDAGVDVIVVDHHK 182

Query: 184 VKSEEIPAYALVNPNRLDD---LSGQGHLCAAGVVFLVLVLIYRILR-----QDNKVPLN 235
              E   A ALVNPNRLD+    +  GHL A GV FL+ + + R LR     +++K P  
Sbjct: 183 CSPELPRAAALVNPNRLDENDLAAAHGHLAAVGVAFLLAIALVRTLRGNGYFENHKEP-- 240

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DL +LLD+VAL TV DV  L GLNRA+V +GL +  R+ N G+ ALI+   +       
Sbjct: 241 -DLFALLDVVALGTVADVAALHGLNRAFVAQGLKIMGRRDNIGMAALIDASRLKRAPACS 299

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
           +LG+ +GP INAGGR+GES LG RLL + D++E + +A +L  LN+ RR +E+ + + AE
Sbjct: 300 DLGFALGPRINAGGRVGESTLGVRLLTTQDAEEAQQIAAQLSALNEERRAIEAEVQQAAE 359

Query: 356 AKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRS 415
            ++  Q       +V VV    WHPG++G++A R+KEK G+PS  I+ +E+G+G GSGRS
Sbjct: 360 EQLAAQ----HNRAVHVVAARGWHPGVIGIVAGRIKEKSGKPSLVIALDENGEGKGSGRS 415

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           I G D+G  +  A EEG+L+KGGGHAMAAGLTV         D+        V       
Sbjct: 416 IPGVDLGAAIIRAREEGLLIKGGGHAMAAGLTVAEDKLEAFSDWLDAHLEGPVSRASENR 475

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              +D  +    +   L++ L+  GPYG G P P  A    +L    +V   H+++    
Sbjct: 476 EMLLDLAVAPGGLTPDLVEALDRGGPYGVGWPGPRVAVGPVRLVKCDIVGTDHVRLIASG 535

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +D  + + IAFR   + +G+ L+  SRG+R+ + G + ++ W    + +L + DA+
Sbjct: 536 EDGRSFKGIAFRAAESDMGQALLHGSRGRRLWLAGRVKIDDWGSRPQAELHLEDAA 591


>gi|83858254|ref|ZP_00951776.1| single-stranded-DNA-specific exonuclease RecJ [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853077|gb|EAP90929.1| single-stranded-DNA-specific exonuclease RecJ [Oceanicaulis
           alexandrii HTCC2633]
          Length = 592

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 232/590 (39%), Positives = 335/590 (56%), Gaps = 10/590 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +   GV  S+ G  W   L     N   AI +   + D + R++  R ++ + A  FL P
Sbjct: 3   EPLFGVRQSLGGRSW--RLKAADDNAIQAICRATGVSDALGRLMAARGLTAEDAPAFLAP 60

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
            +R   PDP  L   D+AARRI  A+   ++I +F DYDVDGA S A +  +L     + 
Sbjct: 61  KLRDSFPDPSTLKGMDEAARRIWDALDAGDRIALFADYDVDGATSAAQLGGWLRTLGADP 120

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN   ++    +GA+L+IT+DCG+ S   L  A   G+ V+VIDHH 
Sbjct: 121 IIYVPDRIEEGYGPNAPALKSLKEQGARLVITLDCGAASVGPLTAAHEMGLPVVVIDHHL 180

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLSL 241
           +  E  PA ALVNPN+  D+SG GHL AAGV F++L  + R  R+    K     ++L  
Sbjct: 181 MDGEIPPADALVNPNQPGDVSGCGHLAAAGVTFVLLAALNREGRRRGAFKGQAEPNVLDF 240

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
            DL AL T+CDVV L G+NRA V +GL V      PG+ AL     +  P +  + G+++
Sbjct: 241 ADLAALGTICDVVSLTGVNRAIVAQGLKVMSAWSRPGMAALAAAAGVQGPASPYHAGFLL 300

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV--L 359
           GP INAGGR+G+S+LG+RL+++ D +E   +A  LD LN  RR +E+ +L+QA+A+V  L
Sbjct: 301 GPRINAGGRVGQSDLGARLMMTQDPKEAAHIAQTLDALNAERRAIETEVLDQAQAQVEAL 360

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEG 418
              DD     +++  G+ WHPG++G++A R+KE+F RP+  I  + E G G GSGRS  G
Sbjct: 361 KLEDDT---PILIASGEHWHPGVIGIVAGRIKERFNRPAIVIGVDPETGLGKGSGRSCTG 417

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            ++G  V+ A EEG+LV GGGHAMA GLTV+    G L D+          A      + 
Sbjct: 418 VNLGAAVAAAREEGLLVAGGGHAMACGLTVDVNRIGELTDYLTARLKQEWIAAEEARTYS 477

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +D V++ SAV+    + L +A PYG GNP P FAF + +    + V   H++ TFES   
Sbjct: 478 VDAVISPSAVSFEFCEALSAAEPYGMGNPEPRFAFSSLRRTYAQRVGTDHVRFTFESPGG 537

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
             L  I+FR    P+G+ L+       HV G L     R  ++ +L + D
Sbjct: 538 GRLTGISFRSADQPMGQALLNGPDGLWHVAGKLRAEDNRYGRKAELHLED 587


>gi|110679772|ref|YP_682779.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Roseobacter denitrificans OCh 114]
 gi|109455888|gb|ABG32093.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Roseobacter denitrificans OCh 114]
          Length = 579

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 261/595 (43%), Positives = 360/595 (60%), Gaps = 29/595 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLG+E S++G RW+     E    A  + Q+  +P  V +VL  R V  ++A+ FL P+
Sbjct: 2   SFLGIERSLTGRRWIGP-SVEIARAAKTLEQRTDLPAPVCQVLARRGVQAEHAEGFLAPA 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R LMPDP  L D  KAA R + A+   EKI IF DYDVDG +S AL++ +L      A 
Sbjct: 61  LRDLMPDPRSLKDMTKAATRFLNAVQKREKIAIFADYDVDGGSSAALLLAWLRQMGREAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M +       LI+ VDCG+ S+  +  A   G DV+V+DHH +
Sbjct: 121 LYIPDRIDEGYGPNDEAMAQLARS-HDLIVCVDCGTLSHGPIAAAA--GADVLVLDHH-L 176

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
            +EE+P A A+VNPNR D+    GHLCAAGVVFL+LV + R+LR+  +     DL++ LD
Sbjct: 177 GTEELPDALAVVNPNRQDESGDLGHLCAAGVVFLLLVELRRLLRETGQT--GPDLMAFLD 234

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL+G+NRA+V +GL V  R+   GL AL +   + +   A +LG+++GP
Sbjct: 235 LVALATVADVAPLVGVNRAFVRQGLKVLARRERVGLTALADVAGVDTEPNAYHLGFILGP 294

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVL 359
            +NAGGRIG ++LG+RLL SDD  E   LA +LD LN  RR +E+A+    L QAEA+ L
Sbjct: 295 RVNAGGRIGAADLGARLLASDDPHEAAALAERLDKLNTERRDIEAAVRATALAQAEARGL 354

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +        ++   G  WHPG+VG++A+RLKE  GRPS  I    DG G GSGRS+ G 
Sbjct: 355 DR-------PLVWAAGADWHPGVVGIVASRLKEAAGRPSIVIGI-TDGIGKGSGRSVAGI 406

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVN----FGRLCDFFQKFAHNIVPALITTP 475
           D+G+ +     EG+L+KGGGH MAAGLTVE         RL +  +K     + A     
Sbjct: 407 DLGQPIHRLAAEGLLLKGGGHKMAAGLTVEESKIEPAMARLSELLEKQGAGSIGA----A 462

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              IDG+L   A  + L+  +E AGP+GA  P P +AF +  ++  + V   HL+++F S
Sbjct: 463 DLHIDGMLMPQAAAVELVQKIEQAGPFGAAAPAPRYAFADVAIRYAKRVGENHLKISFGS 522

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            D+ ++ AI F  Y T LG  L    G R H+ G L +N WRG +  QLR+ DA+
Sbjct: 523 -DAGSMDAICFGAYDTELGPALEMHGGARFHLAGRLDINTWRGRQSVQLRLEDAA 576


>gi|294678579|ref|YP_003579194.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           capsulatus SB 1003]
 gi|294477399|gb|ADE86787.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           capsulatus SB 1003]
          Length = 577

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 259/593 (43%), Positives = 350/593 (59%), Gaps = 27/593 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FL V+ S++G RWV     E    A A+ Q   +P  +ARVLV R V+ + A  FL P+
Sbjct: 3   SFLNVDTSLTGRRWVGP-SLEADRLAEAMAQATHLPLPLARVLVARGVTPEAAAGFLEPT 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D +KAA R ++A+ + EKI IF DYDVDG +S AL++ FL    V   
Sbjct: 62  LRDLLPDPHRLKDMEKAAARFLRALRSREKIAIFADYDVDGGSSAALLICFLRAFGVTPT 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M+    E   LI+ VDCG+ S+  +  A     DV+++DHH  
Sbjct: 122 LYIPDRIDEGYGPNVPAMQALGREHG-LIVCVDCGTLSHAPVAAAAPA--DVVILDHHLG 178

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLLD 243
                PA A VNPNR D+    GHLCAA VVFL+LV   R LR +  K P   DL+++LD
Sbjct: 179 GETLPPAVACVNPNRQDEPGDLGHLCAASVVFLMLVEANRQLRAEGVKGP---DLMAMLD 235

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL+G+NRA V +GL V  R+  PGL AL +   +    TA +LG+++GP
Sbjct: 236 LVALATVADVAPLLGVNRALVRQGLKVMARRERPGLVALSDVARLDKAPTAYHLGFLLGP 295

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMES----AMLEQAEAKVL 359
            +NAGGRIG ++LG+RLL +D + E   LA +LD LN  RR +E+    A L QAEA+ L
Sbjct: 296 RVNAGGRIGAADLGARLLSTDSAAEAAALAERLDRLNSERREIENRVRDAALTQAEARGL 355

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                     ++   G+ WHPG+VG++AARLKE   RP+  I   E G G GS RS+ G 
Sbjct: 356 -------DGPLVWAAGEGWHPGVVGIVAARLKEATNRPAVVIGL-EGGLGKGSARSVAGV 407

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRL--CDFFQKFAHNIVPALITTPVF 477
           D+G  V     EG+L+KGGGH MAAGLT+ R    R    +     A +  PA +     
Sbjct: 408 DLGAAVQRVAAEGLLLKGGGHRMAAGLTLPRAVEPRWKAAECSPGRARHGGPADL----- 462

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
           ++DG+L   A   ALI+ L+ AGPYG   P+P FAFP   + + R +  +HL+++F    
Sbjct: 463 RLDGLLMPGAATPALIEDLDRAGPYGQAAPSPRFAFPAMAILNARRIGESHLRLSFGDGL 522

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              L AIAF  +  PLG  L      R H+ G L ++ W G  + QLR+ DA+
Sbjct: 523 GAKLDAIAFGAFDGPLGPALSAGGAGRFHLAGKLELDSWGGRSKVQLRLDDAA 575


>gi|126462820|ref|YP_001043934.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126104484|gb|ABN77162.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 583

 Score =  419 bits (1076), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 255/595 (42%), Positives = 360/595 (60%), Gaps = 28/595 (4%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S +G RWV    +E    A A+ Q   +P  + R LV R V    A+ FL P
Sbjct: 7   RAFLGVEASATGRRWVGPSPEED-RLAEAMAQTTRLPLALCRTLVRRGVPASDAESFLAP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDPL L D   AA R++QA+   E+I IF DYDVDG +S AL++ +L     +A
Sbjct: 66  ALRDLLPDPLTLKDMAPAAARLLQAVARRERIAIFADYDVDGGSSAALLIVWLRALGRSA 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M+  + E   LI+ VDCG+ S++ +  A  +G DV+V+DHH 
Sbjct: 126 TLYIPDRIDEGYGPNVPAMQA-LAEAHDLILCVDCGTLSHEPI--AAAKGADVVVLDHHL 182

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLL 242
                 PA A+VNPNR D+    GHLCAA VVFL+LV   R LR +  + P   DL+++L
Sbjct: 183 GAETLPPALAVVNPNRQDEDGALGHLCAASVVFLLLVEANRRLRAEGVQGP---DLMAML 239

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL G+NRA V +GL V  R+  PGL AL +   + +   +  LG+++G
Sbjct: 240 DLVALATVADVAPLTGVNRALVRQGLKVMARRERPGLVALADVARMKTAPNSYALGFLLG 299

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLE----QAEAKV 358
           P +NAGGRIG+++LG+RLL ++D +E + LA +LD LN  RR +E+ + E    QAEA+ 
Sbjct: 300 PRVNAGGRIGQADLGARLLSTEDPREAQALAERLDQLNTERREIEARVREEALAQAEARG 359

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           ++         ++    + WHPG+VG++AARLKE   RP+  I F E+G G GSGRSI G
Sbjct: 360 IS-------GPLVWAAAEGWHPGVVGIVAARLKEATNRPAVVIGF-ENGIGKGSGRSIAG 411

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIV--PALITTPV 476
            D+G  +     EG+L+KGGGH MAAGLTVE    GRL    ++    +    A    P 
Sbjct: 412 VDLGASIHRVAHEGLLLKGGGHRMAAGLTVEE---GRLEAAMERLGELLARQGAAEAGPA 468

Query: 477 -FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
             ++DG+L  SA     ++ ++SAGPYGAG   P FA  + ++ + R +   H+++T   
Sbjct: 469 DLRLDGLLMPSAATAEFVEQIDSAGPYGAGAAAPRFALADQRV-TCRRMGDKHMRLTIGG 527

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +   L+A+AF  +  PLG  L      R H+ G L ++ W GS R Q+R+ DA+
Sbjct: 528 AEGR-LEAVAFGCFDGPLGPLLEGGGAGRFHLAGRLEIDTWGGSARVQMRLEDAA 581


>gi|332558849|ref|ZP_08413171.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           sphaeroides WS8N]
 gi|332276561|gb|EGJ21876.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           sphaeroides WS8N]
          Length = 583

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 255/595 (42%), Positives = 359/595 (60%), Gaps = 28/595 (4%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S +G RWV    +E    A A+ Q   +P  + R LV R V    A+ FL P
Sbjct: 7   RAFLGVEASATGRRWVGPSPEED-RLAEAMAQTTRLPLALCRTLVRRGVPASDAESFLAP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDPL L D   AA R++QA+   E+I IF DYDVDG +S AL++ +L      A
Sbjct: 66  ALRDLLPDPLTLKDMAPAAARLLQAVARRERIAIFADYDVDGGSSAALLIVWLRALGRTA 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M+  + E   LI+ VDCG+ S++ +  A  +G DV+V+DHH 
Sbjct: 126 TLYIPDRIDEGYGPNVPAMQA-LAEAHDLILCVDCGTLSHEPI--AAAKGADVVVLDHHL 182

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLL 242
                 PA A+VNPNR D+    GHLCAA VVFL+LV   R LR +  + P   DL+++L
Sbjct: 183 GAETLPPALAVVNPNRQDEDGALGHLCAASVVFLLLVEANRRLRAEGVQGP---DLMAML 239

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL G+NRA V +GL V  R+  PGL AL +   + +   +  LG+++G
Sbjct: 240 DLVALATVADVAPLTGVNRALVRQGLKVMARRERPGLVALADVARMKTAPNSYALGFLLG 299

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLE----QAEAKV 358
           P +NAGGRIG+++LG+RLL ++D +E + LA +LD LN  RR +E+ + E    QAEA+ 
Sbjct: 300 PRVNAGGRIGQADLGARLLSTEDPREAQALAERLDQLNTERREIEARVREEALAQAEARG 359

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           ++         ++    + WHPG+VG++AARLKE   RP+  I F E+G G GSGRSI G
Sbjct: 360 IS-------GPLVWAAAEGWHPGVVGIVAARLKEATNRPAVVIGF-ENGIGKGSGRSIAG 411

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIV--PALITTPV 476
            D+G  +     EG+L+KGGGH MAAGLTVE    GRL    ++    +    A    P 
Sbjct: 412 VDLGASIHRVAHEGLLLKGGGHRMAAGLTVEE---GRLEAAMERLGELLARQGAAEAGPA 468

Query: 477 -FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
             ++DG+L  SA     ++ ++SAGPYGAG   P FA  + ++ + R +   H+++T   
Sbjct: 469 DLRLDGLLMPSAATAEFVEQIDSAGPYGAGAAAPRFALADQRV-TCRRMGDKHMRLTIGG 527

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +   L+A+AF  +  PLG  L      R H+ G L ++ W GS R Q+R+ DA+
Sbjct: 528 AEGR-LEAVAFGCFDGPLGPLLEGGGAGRFHLAGRLEIDTWGGSARVQMRLEDAA 581


>gi|163794637|ref|ZP_02188607.1| Single-stranded DNA-specific exonuclease [alpha proteobacterium
           BAL199]
 gi|159179910|gb|EDP64435.1| Single-stranded DNA-specific exonuclease [alpha proteobacterium
           BAL199]
          Length = 592

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 254/600 (42%), Positives = 356/600 (59%), Gaps = 23/600 (3%)

Query: 6   FLGVECSISGFRWVSLLGQEGIN---RALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            LGVE S++G RW++  G  G+      LAI Q+H +P+IV R++  R + +D  + FL 
Sbjct: 5   ILGVERSVTGKRWIAR-GGAGVEIERLGLAIAQRHGVPEIVGRLIAQRGIELDGVERFLE 63

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+++  +PDP +L D D AA R+  A+   + I +F DYDVDGA S ALM R+L      
Sbjct: 64  PTLKAELPDPSVLKDMDAAAGRLSDAVQGGQPIGLFADYDVDGATSAALMTRYLRAVGAT 123

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           + +++PDRI +GYGPN   +E    +GA +++ +DCG  + + L  A   GID++V+DHH
Sbjct: 124 SLLHVPDRIDEGYGPNLPAIEGLAGQGAGVVVCLDCGILAVETLGEARAAGIDMMVVDHH 183

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLS 240
               E   A A+VNPNRLD+  G G L A GV FLVLV + R LR+    K     DL  
Sbjct: 184 LAGPELPSAVAVVNPNRLDEPGGYGQLAACGVTFLVLVALNRELRRRGWFKQRPEPDLRV 243

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVAL TVCDVVPL GLNRA+V +G+ V   +GNPGL AL +   +       +LG++
Sbjct: 244 LLDLVALGTVCDVVPLAGLNRAFVAQGIRVMAGRGNPGLAALGDIAKLDRRPDPYHLGFV 303

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGR+G ++LG+RLL +DD+ E   LA +LD  N  RR +E+ +LE A A+   
Sbjct: 304 LGPRINAGGRVGRADLGARLLATDDAAEAATLAAELDRYNGERRTIEAEVLEAAIAQAEA 363

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           Q D     + +VV G+ WHPG+VG++A+RLK++F RP+  I   EDG G GSGRS+ G  
Sbjct: 364 QAD----GAALVVVGEGWHPGVVGIVASRLKDRFHRPACVIGV-EDGIGKGSGRSVAGVQ 418

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTV--ERVNFGRLCDFFQKFAHNIVPALIT----T 474
           +G  +  A + G+L+KGGGHAMAAG TV  +RV      + F+ F    V A +     T
Sbjct: 419 LGAAIIAAQQAGVLIKGGGHAMAAGFTVAADRV------EAFKAFLCERVAAELADGDRT 472

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
               +D  L  S     L+  +   GP+G GN  P FAFP  ++    VV   H++ T  
Sbjct: 473 ATLSVDAALAPSGATGDLVRTVGRIGPFGTGNAEPRFAFPAVRVVGAGVVGENHVRCTLT 532

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
             D   ++AIAFR     LG+ L+++     HV GHL  + +RG  + QL V DA+P  G
Sbjct: 533 GSDGARVKAIAFRALDGDLGQSLLKAGSTPFHVVGHLRADDFRGGDQVQLIVDDAAPATG 592


>gi|221639835|ref|YP_002526097.1| Single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           sphaeroides KD131]
 gi|221160616|gb|ACM01596.1| Single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           sphaeroides KD131]
          Length = 583

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 255/595 (42%), Positives = 358/595 (60%), Gaps = 28/595 (4%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S +G RWV    +E    A A+ Q   +P  + R LV R V    A+ FL P
Sbjct: 7   RAFLGVEASATGRRWVGPSPEED-RLAEAMAQTTRLPLALCRTLVRRGVPASDAESFLAP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDPL L D   AA R++QA+   E+I IF DYDVDG +S AL++ +L      A
Sbjct: 66  ALRDLLPDPLTLKDMAPAAARLLQAVARRERIAIFADYDVDGGSSAALLIVWLRALGRTA 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M+  + E   LI+ VDCG+ S++ +  A  +G DV+V+DHH 
Sbjct: 126 TLYIPDRIDEGYGPNVPAMQA-LAEAHDLILCVDCGTLSHEPI--AAAKGADVVVLDHHL 182

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSLL 242
                 PA A+VNPNR D+    GHLCAA VVFL+LV   R LR +  + P   DL+++L
Sbjct: 183 GAETLPPALAVVNPNRQDEDGSLGHLCAASVVFLLLVEANRRLRAEGVQGP---DLMAML 239

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL G+NRA V +GL V  R+  PGL AL +   + +      LG+++G
Sbjct: 240 DLVALATVADVAPLTGVNRALVRQGLKVMARRERPGLVALADVARMKTAPNGYALGFLLG 299

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLE----QAEAKV 358
           P +NAGGRIG+++LG+RLL ++D +E + LA +LD LN  RR +E+ + E    QAEA+ 
Sbjct: 300 PRVNAGGRIGQADLGARLLSTEDPREAQALAERLDQLNTERREIEARVREEALAQAEARG 359

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           ++         ++    + WHPG+VG++AARLKE   RP+  I F E+G G GSGRSI G
Sbjct: 360 IS-------GPLVWAAAEGWHPGVVGIVAARLKEATNRPAVVIGF-ENGIGKGSGRSIAG 411

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIV--PALITTPV 476
            D+G  +     EG+L+KGGGH MAAGLTVE    GRL    ++    +    A    P 
Sbjct: 412 VDLGASIHRVAHEGLLLKGGGHRMAAGLTVEE---GRLEAAMERLGELLARQGAAEAGPA 468

Query: 477 -FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
             ++DG+L  SA     ++ ++SAGPYGAG   P FA  + ++ + R +   H+++T   
Sbjct: 469 DLRLDGLLMPSAATAEFVEQIDSAGPYGAGAAAPRFALADQRV-TCRRMGDKHMRLTIGG 527

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +   L+A+AF  +  PLG  L      R H+ G L ++ W GS R Q+R+ DA+
Sbjct: 528 AEGR-LEAVAFGCFDGPLGPLLEGGGAGRFHLAGRLEIDTWGGSARVQMRLEDAA 581


>gi|73667504|ref|YP_303520.1| RecJ exonuclease [Ehrlichia canis str. Jake]
 gi|72394645|gb|AAZ68922.1| exonuclease RecJ [Ehrlichia canis str. Jake]
          Length = 584

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 236/569 (41%), Positives = 343/569 (60%), Gaps = 29/569 (5%)

Query: 31  LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           L I QK  + +I ARVL  R +SI+   DFL P+++  +PDP  L D DKA  RI +AIY
Sbjct: 30  LTIKQKFCLSEIAARVLSTRKISIEEIHDFLYPTLKASLPDPFHLLDMDKAVNRICEAIY 89

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
           N EKI++FGDYDVDGA S AL+ ++L+   V   +YIPDRI +GYGPN   + K    G 
Sbjct: 90  NKEKIVVFGDYDVDGATSSALIKQYLTQIGVPTTIYIPDRICEGYGPNTQALLKLKEIGN 149

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
            L ITVDCG+ +++ +  A +  +DVIVIDHH   +    A A++NPNRLD+ S   +L 
Sbjct: 150 SLCITVDCGTIAHEPISAAKSVNLDVIVIDHHIGMNTLPDAIAVINPNRLDENSPYTYLA 209

Query: 211 AAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVV 265
             GV FL+L+ + + L++     +N  P   +L++ LDLVAL TVCDV+P+IGLNRA+V 
Sbjct: 210 GVGVSFLMLIALNKTLKEKGFFTNNTEP---NLINYLDLVALGTVCDVMPIIGLNRAFVK 266

Query: 266 KGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDD 325
           +GL +   + N GLK L + + +        LG+ IGP INAGGR+G ++LG+RLL S++
Sbjct: 267 QGLKIIATRQNIGLKVLSDVIGLEEKPNVYQLGFSIGPHINAGGRVGNASLGARLLSSNN 326

Query: 326 SQELEMLAMKLDVLNQNRRLME----SAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPG 381
            +E   ++ KL   N  R+ +E    +  +EQAE  + T  +      +I+V G+ WHPG
Sbjct: 327 EEEALEISEKLQNFNLERKELEHQSFNEAVEQAETLMSTNTN------LIIVAGN-WHPG 379

Query: 382 IVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHA 441
           I+G++A RLK+KF  PS  IS   +G G  S RSI   D+G  +  A  EGI+ +GGGHA
Sbjct: 380 IIGIVAGRLKDKFFLPSIVISL-NNGIGKASARSIPDVDLGAAILSAKLEGIITEGGGHA 438

Query: 442 MAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGP 501
           MAAG ++       L +F  +  HNI        VFK+DGV+ ASA+N+ L   L+   P
Sbjct: 439 MAAGFSINEDKIKTLYEFLSQRFHNIN----KQKVFKVDGVITASAINLTLWKELQFLEP 494

Query: 502 YGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET-LQAIAFRVYGTPLGEFLMQS 560
           +G GNP P F   N K+++  ++  +H++      D++T ++ I FR   T LG  L++ 
Sbjct: 495 FGIGNPEPKFILTNIKIKNPEIIGDSHIRCLI--YDNKTFIKGICFRCVDTELGLALLER 552

Query: 561 RGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
               + + G + VNYWRG++  Q  + DA
Sbjct: 553 TA--VMLLGKISVNYWRGNENIQFIIEDA 579


>gi|114771174|ref|ZP_01448594.1| single-stranded-DNA-specific exonuclease RecJ [alpha
           proteobacterium HTCC2255]
 gi|114548099|gb|EAU50986.1| single-stranded-DNA-specific exonuclease RecJ [alpha
           proteobacterium HTCC2255]
          Length = 582

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 243/594 (40%), Positives = 349/594 (58%), Gaps = 19/594 (3%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKD 59
           MND  FL VE SISG RW        ++R A  I Q+      +A VL    V  +  K+
Sbjct: 1   MND-IFLDVESSISGRRWTG--PNISVDRQAEMILQETNFSSAMANVLARLGVEANQVKN 57

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           ++ PS+R LMP+PL + D +KAA RI  A+ N E+I IF DYDVDGA S AL+  +L+  
Sbjct: 58  YIKPSLRDLMPNPLKILDMEKAASRINIAVNNHERIAIFADYDVDGATSGALLHDWLTQL 117

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
                +Y+PDRI +GYGPN   ME   N    LII VDCG+ S++ +   TN   D+I++
Sbjct: 118 GNIPTLYVPDRIEEGYGPNIVAMETLANV-HDLIICVDCGTLSHETINKITN--TDIIIL 174

Query: 180 DHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNK-VPLNFD 237
           DHH +  E +P AYA+VNPNR D+     +LCAAGVVFL LV    I R +NK  P   D
Sbjct: 175 DHH-LGGETLPNAYAVVNPNRQDEKGDLYYLCAAGVVFLTLVAANSIRRNNNKSTP---D 230

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           LL++LDLVAL TV DV PLIG NRA V +GL V  ++   G+ AL +   +++  +  +L
Sbjct: 231 LLNMLDLVALGTVADVAPLIGFNRALVRQGLKVMAKRERIGITALSDIAKMNNAPSPYHL 290

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAK 357
           GY++GP INAGGR+G+++LG RLL   +  E   +A KL+ LN  RR +E+ +  QA   
Sbjct: 291 GYLLGPRINAGGRVGKADLGIRLLTCKNFDEANSIADKLNQLNDERRSIEATVQIQA--- 347

Query: 358 VLTQCDDIQQASVIV-VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSI 416
            L Q + +   S +    G+ WHPG+VG++A+R+KE   +P+  I  +E  +G GSGRSI
Sbjct: 348 -LEQVEKMDSNSALAWAAGEGWHPGVVGIVASRIKEITNKPTVVIGLDEH-EGKGSGRSI 405

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPV 476
            G D+G  ++    E ++++GGGH MAAGL++ER           +   N       T  
Sbjct: 406 SGIDLGSSIATLQRENLIIRGGGHKMAAGLSLEREKLEIAMSRLNELLANQGSKSFQTRE 465

Query: 477 FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ 536
            ++DG L+  A+ I L++ LE+AGP+GAG P P FA P  ++   +    +HL++     
Sbjct: 466 LQLDGALSLPAITIELLEQLETAGPFGAGAPGPKFALPFMRITFAKRAGESHLRLRLVDD 525

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              ++ AIAF  + + LG+ L   +G+  HV G L ++ W G  R +L + DA+
Sbjct: 526 SGASIDAIAFGAFKSDLGKTLENHKGQIFHVAGRLEIDTWNGRMRPKLNLEDAT 579


>gi|326387430|ref|ZP_08209039.1| single-stranded-DNA-specific exonuclease RecJ [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208086|gb|EGD58894.1| single-stranded-DNA-specific exonuclease RecJ [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 592

 Score =  412 bits (1058), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 242/596 (40%), Positives = 338/596 (56%), Gaps = 27/596 (4%)

Query: 9   VECSISG--FRWVSLLGQEGINRALAITQKHAIPD-IVARVLVNRNVSIDYAKDFLNPSI 65
           ++ S+SG  +RW       G N  +A      + D +V ++L+ R V          P++
Sbjct: 7   IDQSLSGQAWRW------RGGNMDVAADNPGNLGDNLVDQLLLARGVERSDLDRHRRPTL 60

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R  +PDP I  D DKAA R+  AI  +E I ++GDYDVDGA S AL++R L+ C V A  
Sbjct: 61  RDFLPDPSIFRDMDKAATRLADAIGRNEAIAVYGDYDVDGATSAALLVRLLASCGVRARP 120

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDR+++GYGP    + +   EGA LI+TVDCG+ +Y+AL  A + G++VIV+DHH+  
Sbjct: 121 YIPDRLLEGYGPTGEALVRLGAEGASLIVTVDCGAMAYEALAMAADAGVEVIVVDHHKCA 180

Query: 186 SEEIPAYALVNPNRL---DDLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFD 237
           +E   A ALVNPNRL   D+ +  GHL A G+ FL+ V   R LR      D + P   D
Sbjct: 181 AELPRAMALVNPNRLDESDEAAAFGHLAAVGMAFLLAVATLRELRARGFFGDRRPP---D 237

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           L+SLLDLVAL TV DV  L GLNRA V +GL V  R+ N GL ALI+   ++   T  +L
Sbjct: 238 LMSLLDLVALGTVADVAQLRGLNRALVAQGLKVLARRENTGLAALIDASRLNRSPTCSDL 297

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAK 357
           G+ +GP INA GRIG+S+LG RLL + D  E   +A +L  LN  RR +E A+ E AE  
Sbjct: 298 GFALGPRINAAGRIGDSSLGVRLLTTADPDEARDIAARLSELNDERRGIEQAVQEAAETA 357

Query: 358 VLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED--GKGIGSGRS 415
           +  Q    +  +V V+ G+ WHPG++G++A R+KEK G+P+  I+ + D  G G GSGRS
Sbjct: 358 LARQ----EGRAVHVLSGEGWHPGVIGIVAGRIKEKTGKPTVVIALDADEAGNGKGSGRS 413

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           I G D+G  V  A E G+LV GGGHAMA GLT+          F ++     V       
Sbjct: 414 IAGVDLGAAVIAAREAGLLVAGGGHAMACGLTIAPDRLEEFHTFLEERLTRDVARARAAQ 473

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              ID  L    +   L++ L++AGP+G G P P  A    +L    +V   H++M    
Sbjct: 474 TLLIDLSLTPGGLTPDLVETLDAAGPFGVGWPGPRVAVGPVRLIKCDLVGTDHVRMVAAG 533

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +D  + +AIAFR   T LG+ L+    G+   + G   ++ W      +L V DA+
Sbjct: 534 RDGRSFKAIAFRAATTDLGQALLHGYHGRHFWLAGRARIDDWASRPAAELHVEDAA 589


>gi|294084054|ref|YP_003550812.1| single-stranded DNA-specific exonuclease [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663627|gb|ADE38728.1| Single-stranded DNA-specific exonuclease [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 605

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 235/606 (38%), Positives = 344/606 (56%), Gaps = 21/606 (3%)

Query: 1   MNDQAFLGVECSISGFRWVSL---LGQEGINRALAITQKH--AIPDIVARVLVNRNVSID 55
           M   A LG+  S S  RW  +   L     +R  A  Q+H   +P  +AR+L +R +S  
Sbjct: 1   MTPDACLGITQSASDARWDHISASLNAHDTDRYTAGLQEHFADMPLPIARILASRGISAI 60

Query: 56  YAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRF 115
             +  ++P +R L+PDP    D DKA  RI  ++   + I IFGDYDVDGA++ AL +  
Sbjct: 61  EVETLIDPRLRDLLPDPSRFKDMDKAVARIADSVEAGDAIGIFGDYDVDGASAAALFVNV 120

Query: 116 LSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGID 175
           +    +   ++IPDR  +GYGPN + + +   +GA L++TVDCG +++  L    + G+D
Sbjct: 121 MRALHIETFVHIPDRFKEGYGPNANALTRLQEKGASLLLTVDCGISAHAPLAAVADSGMD 180

Query: 176 VIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-----DN 230
           VIVIDHH    E   A++++NPNRLD+    GHLCAAGV F+VLV + R LRQ     D 
Sbjct: 181 VIVIDHHIAGPELPRAHSVINPNRLDEDGRYGHLCAAGVCFIVLVGVLRALRQRGFFEDR 240

Query: 231 KVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS 290
           K P   DLL  LDLVALATVCDVVPL  LNRA+V +GL +   + N GL  L +   ++S
Sbjct: 241 KAP---DLLQQLDLVALATVCDVVPLTDLNRAFVAQGLKIMANRHNHGLARLADVAGMNS 297

Query: 291 PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM 350
                 LG++IGP INA GRIG S LG +LL      E   LA +LD +N+ RR +E  +
Sbjct: 298 APNPYALGFLIGPRINAAGRIGVSELGVKLLSCQREDEAIGLAARLDEMNKERRSIEDDI 357

Query: 351 LEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI 410
              A  +   Q D+     V+VV  + WH G++G++A RLK++F +P+  I+F  DG G 
Sbjct: 358 RAHAMDRASAQSDN----HVLVVGDEAWHEGVIGIVAGRLKDRFAKPACVIAFSPDGLGK 413

Query: 411 GSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPA 470
           GS RSI GF IG  +  A + G+L  GGGH MAAG ++ +        F  +   + +  
Sbjct: 414 GSARSIPGFAIGNAIIAAHQMGLLEGGGGHDMAAGFSIMKDKLAAFQAFMNQRLLDDLKG 473

Query: 471 LITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL--AH 528
            I     K+  +L+ +     + D L+  GP+G+GNP P F  P+ ++++IR+V    AH
Sbjct: 474 EIPKVSHKVSALLSVAGCQPEVSDWLDKLGPFGSGNPEPRFVLPDCRIKNIRLVGDAGAH 533

Query: 529 LQMTFESQDSETLQAIAFRVYGTPLGEFLMQSR-GKRMHVTGHLCVNYWRGSKRCQLRVL 587
           +    +      L AIAF+  G P+G+ L Q+  G+ +H+ G L  + +RG +  Q+ + 
Sbjct: 534 VSCRLDDGSGTALNAIAFQAGGAPIGQLLQQAADGRYLHILGKLRRDRYRGGRAMQIEIE 593

Query: 588 D-ASPV 592
           D A+P 
Sbjct: 594 DVATPA 599


>gi|296532974|ref|ZP_06895629.1| single-stranded-DNA-specific exonuclease RecJ [Roseomonas
           cervicalis ATCC 49957]
 gi|296266697|gb|EFH12667.1| single-stranded-DNA-specific exonuclease RecJ [Roseomonas
           cervicalis ATCC 49957]
          Length = 599

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 243/595 (40%), Positives = 340/595 (57%), Gaps = 17/595 (2%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +A LGV  S+ G RWV    Q      +AI Q+  +P+++ ++L  R V+ + A  FL P
Sbjct: 14  EAVLGVTRSVLGRRWV--WRQADTRIGMAIAQRLDLPELLGQLLAARGVTPEQAALFLEP 71

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDP +L D D+AA R+ QA+   E + +FGDYDVDGA++ ALM+RFL       
Sbjct: 72  TLRALLPDPSVLVDMDRAAERLAQAVRAREPVAVFGDYDVDGASAGALMLRFLRDLGCPV 131

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
             Y+PDR+ +GYGPNP  +    + GA L++ VDCG  ++ AL+ A  +  DV+V+DHH+
Sbjct: 132 RHYVPDRLKEGYGPNPGAIAALCDGGATLLVCVDCGIAAHAALEAARGRA-DVVVLDHHK 190

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLL 239
            +       A VNPNRLD  SG  HLCAA V F+  V   R LR+    + + P   DL 
Sbjct: 191 AEGPVPVVAAAVNPNRLDCGSGLKHLCAAAVSFMAAVATLRALRRSGFFEGREPP--DLR 248

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            LLDLVALATVCDV+PL GLNRA+V +GL V  R   PG+ AL+E        +A  LG+
Sbjct: 249 DLLDLVALATVCDVMPLTGLNRAFVTQGLKVMARGERPGIAALLEVAQAREAPSAYTLGF 308

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INA GRIGE +LG RLL  DD  E  ++A +LD +N+ R+ +ES +L  A A+  
Sbjct: 309 LLGPRINASGRIGEPDLGLRLLACDDPVEARIMAERLDAVNRRRQEVESEVLAAAFAQAE 368

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            Q        V+++ G+ WHPG+VG++A R+KEKF RP+  ++   DG   GSGRS+ G 
Sbjct: 369 AQAGAGH--PVLLICGEGWHPGVVGIVAGRVKEKFNRPT-CVAGISDGLAKGSGRSVPGI 425

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFK 478
           D+G  V  A + G+L  GGGHAMAAG +           F  ++ +H     L  +    
Sbjct: 426 DLGAAVIAARQSGLLETGGGHAMAAGFSFRLERQEEFHAFLNERLSH--AADLPGSADLV 483

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQ 536
           +DG L   A    L   +   GP+GAGN  PVF FP  ++     V      ++   E +
Sbjct: 484 VDGTLRVPAATAELATQVARLGPFGAGNEEPVFIFPRVRVVRADRVGKEGNTVRAFLEGE 543

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
               L+AI FR    PL E L+ SRG  +H+ G L   +W G+    L V D +P
Sbjct: 544 GGGRLKAICFRAKEGPLAELLLNSRGVPVHLAGALRAEHWNGNVSAGLHVQDGAP 598


>gi|58584384|ref|YP_197957.1| single-stranded DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418700|gb|AAW70715.1| Single-stranded DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 579

 Score =  409 bits (1050), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 241/573 (42%), Positives = 346/573 (60%), Gaps = 24/573 (4%)

Query: 24  QEGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAA 82
           QE   R  L +TQ+  +P+I+AR L  R V+I+ A +FL P IR L+PDP  L D DKA 
Sbjct: 18  QEADQREVLTLTQRFELPEILARTLAIRGVNIENAGNFLYPLIRSLLPDPFHLLDMDKAV 77

Query: 83  RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLM 142
            RI+QAI N E I IFGDYDVDGA S AL+ R+L    +++ +YIPDR+ +GYG N + +
Sbjct: 78  FRIIQAINNDENIAIFGDYDVDGATSSALISRYLRAIGIHSIIYIPDRVDEGYGLNSNAL 137

Query: 143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLD 201
            +   +G  L I+VDCG+ +Y  ++ A   G+DVIVIDHH + +E++P A A+VNPNRLD
Sbjct: 138 LQLKKKGIDLCISVDCGTLAYQPIEDAKGFGLDVIVIDHH-LGTEKLPSAIAVVNPNRLD 196

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQDN-----KVPLNFDLLSLLDLVALATVCDVVPL 256
           + S    L A GV FL+ V + + LR+ +     K P   DL  LLDLVAL TVCDV+ +
Sbjct: 197 ESSPYNSLAAVGVSFLLTVALNKSLREQDFFAGKKEP---DLFDLLDLVALGTVCDVMQI 253

Query: 257 IGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNL 316
            GLNRA+V +GL V   + N GL+ L + + I        L + IGP INAGGRIGE+ L
Sbjct: 254 TGLNRAFVSQGLKVMSARKNVGLRVLFDALGILERPNVSRLSFNIGPCINAGGRIGEALL 313

Query: 317 GSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGD 376
           G+RLL +DD +E + +A+KL  LN  R++ME+  L   EA +  +      A+ I+V G+
Sbjct: 314 GARLLSTDDKKEADSIALKLIDLNNARKMMENEAL--LEAIIQVEKSTQSGANFIMVSGN 371

Query: 377 RWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVK 436
            WH G++G++A+RLKEKF  P+  IS   +  G  S RSI G DIG  V  A    ++++
Sbjct: 372 -WHQGVIGIIASRLKEKFHLPTIVISL-NNRIGKASCRSIPGVDIGAAVLSAKCMNLIIE 429

Query: 437 GGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           GGGH+MAAG  +       L DF  ++FA++           K+DG++ A A+N++L + 
Sbjct: 430 GGGHSMAAGFLINEDKMSDLHDFLTERFAYS-----TNDKALKVDGIVTAKAINLSLWNQ 484

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGE 555
           L+   P+G GNP P F     K++   +V + H++  F   D   ++AIAFR   T LG 
Sbjct: 485 LQRLEPFGVGNPEPRFIIQGAKIRKPEIVGVDHIK-CFIVDDDVMVRAIAFRSANTHLGS 543

Query: 556 FLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            +M+  G    + G + +NYW G++  Q  + D
Sbjct: 544 AIME--GNIEAILGKISMNYWNGNEFVQFLIED 574


>gi|56417161|ref|YP_154235.1| single-stranded-DNA-specific exonuclease [Anaplasma marginale str.
           St. Maries]
 gi|222475526|ref|YP_002563943.1| single-stranded-DNA-specific exonuclease (recJ) [Anaplasma
           marginale str. Florida]
 gi|255003512|ref|ZP_05278476.1| single-stranded-DNA-specific exonuclease (recJ) [Anaplasma
           marginale str. Puerto Rico]
 gi|255004634|ref|ZP_05279435.1| single-stranded-DNA-specific exonuclease (recJ) [Anaplasma
           marginale str. Virginia]
 gi|56388393|gb|AAV86980.1| single-stranded-DNA-specific exonuclease [Anaplasma marginale str.
           St. Maries]
 gi|222419664|gb|ACM49687.1| single-stranded-DNA-specific exonuclease (recJ) [Anaplasma
           marginale str. Florida]
          Length = 586

 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 239/564 (42%), Positives = 337/564 (59%), Gaps = 18/564 (3%)

Query: 32  AITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
            I Q+  I ++VARVL  R + I+  ++FL P++RLL+PDP  L D DKA  RI  AI N
Sbjct: 34  TIMQRFGICEVVARVLATRGIPIEEMENFLFPTLRLLLPDPFHLLDMDKAVARIHDAIRN 93

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E I IFGDYDVDGA S A++ R+L    V+  +YIPDR+ +GYGPN + M K   EG  
Sbjct: 94  GESIAIFGDYDVDGATSSAMLCRYLRGLEVHTKIYIPDRVEEGYGPNSAAMLKLREEGYS 153

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           L ITVDCG+ +Y+ +  A +  +DVIV+DHH   +    A A+VNPNRLD+ S   +L A
Sbjct: 154 LCITVDCGTLAYEPILAARSVNLDVIVVDHHIGINTLPKAVAVVNPNRLDESSEHTYLSA 213

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNF--DLLSLLDLVALATVCDVVPLIGLNRAYVVKGLM 269
            G  FL+LV + + LR+          DL++ LDLVAL TVCDV+P+I LNRA V  GL 
Sbjct: 214 VGTSFLLLVALQKTLREAGVFAHRSEPDLMNYLDLVALGTVCDVMPMIKLNRAMVRHGLK 273

Query: 270 VARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQEL 329
           V   + N GL+ L + + I   I+  +LG+ IGP INAGGR+G ++LG+ LL SDD  E 
Sbjct: 274 VISARSNVGLRVLGDAIGIEEKISVYHLGFSIGPHINAGGRVGNASLGASLLSSDDESEC 333

Query: 330 EMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA--SVIVVEGDRWHPGIVGLLA 387
           E ++  L  LN  R+ +E   LE+A    L Q + +  A  +VI+V G  WH G++G++A
Sbjct: 334 ERISYMLLSLNAERKELEKRSLEEA----LHQAERLVAAGNNVIMVAGT-WHVGVIGIVA 388

Query: 388 ARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLT 447
           +RLKE+F  PS  +S   +  G  S RS+ G DIG  V  A  E ++ +GGGHAMAAG +
Sbjct: 389 SRLKERFHLPSIVVSLSGN-LGKASARSVSGIDIGAAVLAAKLEQLIPEGGGHAMAAGFS 447

Query: 448 VERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           V       L  FF ++F H+ +       V    G+L A AVN  L   L+   P+G GN
Sbjct: 448 VCADKLEALYSFFLERFKHSDI-----QKVSYACGILTAGAVNFPLWRELQMLEPFGPGN 502

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMH 566
           P P F   N +++   V+  +H++    S D+  ++ + F+  GT LG  L+Q RG+ +H
Sbjct: 503 PEPRFILKNVEIRKPEVMGGSHVRCLI-SGDNALVKGVCFKCIGTELGTTLLQ-RGRCVH 560

Query: 567 VTGHLCVNYWRGSKRCQLRVLDAS 590
           + G + VN WRG++  Q  + DA+
Sbjct: 561 LLGKISVNQWRGNEYVQFVIDDAA 584


>gi|269958438|ref|YP_003328225.1| single-stranded-DNA-specific exonuclease RecJ [Anaplasma centrale
           str. Israel]
 gi|269848267|gb|ACZ48911.1| single-stranded-DNA-specific exonuclease RecJ [Anaplasma centrale
           str. Israel]
          Length = 586

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 239/564 (42%), Positives = 337/564 (59%), Gaps = 18/564 (3%)

Query: 32  AITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
            I Q+  I ++VARVL  R + I+  ++FL P++RLL+PDP  L D DKA  RI  AI N
Sbjct: 34  TIMQRFGICEVVARVLATRGIPIEEMENFLFPTLRLLLPDPFHLLDMDKAVARIHDAIRN 93

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E I IFGDYDVDGA S A++ R+L    V+  +YIPDR+ +GYGPN + M K   EG  
Sbjct: 94  GESIAIFGDYDVDGATSSAMLCRYLRGLEVHTKIYIPDRVEEGYGPNSAAMLKLREEGYS 153

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           L ITVDCG+ +Y+ +  A +  +DVIV+DHH   +    A A+VNPNRLD+ S   +L A
Sbjct: 154 LCITVDCGTLAYEPILAARSVNLDVIVVDHHIGINTLPKAVAVVNPNRLDESSEHTYLSA 213

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNF--DLLSLLDLVALATVCDVVPLIGLNRAYVVKGLM 269
            G  FL+LV + + LR+          DL++ LDLVAL TVCDV+P+I LNRA V  GL 
Sbjct: 214 VGTSFLLLVALQKTLREAGVFAHRSEPDLMNYLDLVALGTVCDVMPMIKLNRAMVRHGLK 273

Query: 270 VARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQEL 329
           V   + N GL+ L + + I   I+  +LG+ IGP INAGGR+G ++LG+ LL SDD  E 
Sbjct: 274 VISARSNVGLRVLGDAIGIEEKISVYHLGFSIGPHINAGGRVGNASLGASLLSSDDESEC 333

Query: 330 EMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA--SVIVVEGDRWHPGIVGLLA 387
           E ++  L  LN  R+ +E   LE+A    L Q + +  A  +VI+V G  WH G++G++A
Sbjct: 334 ERISYMLLSLNAERKELEKRSLEEA----LHQAERLVAAGNNVIMVAGT-WHVGVIGIVA 388

Query: 388 ARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLT 447
           +RLKE+F  PS  +S   +  G  S RS+ G DIG  V  A  E ++ +GGGHAMAAG +
Sbjct: 389 SRLKERFHLPSIVVSLSGN-LGKASARSVSGIDIGAAVLAAKLEQLIPEGGGHAMAAGFS 447

Query: 448 VERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           V       L  FF ++F H+ +       V    G+L A AVN  L   L+   P+G GN
Sbjct: 448 VCADKLEALYSFFLERFKHSDI-----QKVSYACGILTAGAVNFPLWRELQMLEPFGPGN 502

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMH 566
           P P F   N +++   V+  +H++    S D+  ++ + F+  GT LG  L+Q RG+ +H
Sbjct: 503 PEPRFILKNVEIRKPEVMGGSHVRCLI-SGDNALVKGVCFKCIGTELGTTLLQ-RGRCVH 560

Query: 567 VTGHLCVNYWRGSKRCQLRVLDAS 590
           + G + VN WRG++  Q  + DA+
Sbjct: 561 LLGKISVNQWRGNEYVQFVMDDAA 584


>gi|126738787|ref|ZP_01754483.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           SK209-2-6]
 gi|126719968|gb|EBA16675.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           SK209-2-6]
          Length = 581

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 249/596 (41%), Positives = 356/596 (59%), Gaps = 29/596 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RW    G +    A  + Q+  +P  + +VL  R V    A  FL P 
Sbjct: 3   SFLGVETSLTGRRWTGP-GVDLERAAEHMQQQTGLPAPLCQVLARRGVPPHEAMGFLTPQ 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R ++A+   ++I IF DYDVDG +S AL++ +L    + + 
Sbjct: 62  LKELLPDPRRMKDMEAAAARFLEAVEKRQRIAIFADYDVDGGSSAALLIVWLRAMGLQST 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN + M     +   LII VDCG+ S+  +  A  +G DV+V+DHH +
Sbjct: 122 LYIPDRIDEGYGPNEAAMAGLARD-HDLIICVDCGTLSHGPI--AAAKGADVVVLDHH-L 177

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +P   A+VNPNR D+    G+ CAAGVVFL+LV   R  R    +    DLLSLLD
Sbjct: 178 GGETLPDCVAVVNPNRQDEEGDLGYFCAAGVVFLMLVETRRQAR-GKGLGAGPDLLSLLD 236

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL G NRA V +GL V   +  PGL AL +   + +  +A +LG+++GP
Sbjct: 237 LVALATVADVAPLTGANRALVRQGLKVMAGRQRPGLVALADVSRMDTAPSAYHLGFLLGP 296

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVL 359
            +NAGGRIG+++LG+RLL +D+  E   LA +LD LN  RR +E+A+    LEQAEA+  
Sbjct: 297 RVNAGGRIGKADLGARLLATDNPHEAAALAERLDQLNSERRDIENAVRAAALEQAEARGF 356

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A ++   G+ WHPG+VG++A+RLKE  GRP+  I    DG+G GSGRS+ G 
Sbjct: 357 -------DAPLVWAAGEGWHPGVVGIVASRLKEATGRPAVVIGL-NDGEGKGSGRSVTGI 408

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF----GRLCDFFQK-FAHNIVPALITT 474
           D+G  +     EG+L+KGGGH MAAGLT+   N      RL +   K  A ++ P+ +  
Sbjct: 409 DLGAAIQRTAAEGLLLKGGGHKMAAGLTLAEENLEPAMERLAELLAKQGAGDLGPSDL-- 466

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K++G+L   A  + LI+ +E AGP+GAG P P +A P+ +++  + V  +HL+++  
Sbjct: 467 ---KLEGMLMPGAATVDLIEQIEQAGPFGAGAPAPRYALPSLEVRFAKQVGESHLKLSLS 523

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                 + AI F  + TPLG  L+   G R H  G L VN W G +  QLR+ DA+
Sbjct: 524 DGLGGKIDAICFGAFDTPLGSRLLNHGGARFHFAGRLEVNTWGGRQSAQLRLEDAA 579


>gi|86137916|ref|ZP_01056492.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           MED193]
 gi|85825508|gb|EAQ45707.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           MED193]
          Length = 581

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 246/596 (41%), Positives = 357/596 (59%), Gaps = 29/596 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RW+ L G +    A  + Q+  +P  + +VL  R V    A+ FL P 
Sbjct: 2   SFLGVENSLTGRRWLGL-GIDLERAAEHMAQQTGLPSPLCQVLARRGVPAHEAQGFLTPH 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R ++A+   ++I IF DYDVDG +S AL++ +L    + A 
Sbjct: 61  LKDLLPDPRRMKDMELAAARFLEAVQTRQRIAIFADYDVDGGSSAALLLVWLRAMGLQAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M   + +   LI+ VDCG+ S+  +  A  +G DV+V+DHH +
Sbjct: 121 LYIPDRIDEGYGPNEEAMAG-LAQAHDLIVCVDCGTLSHGPI--AAAKGADVVVLDHH-L 176

Query: 185 KSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
             E +P   A+VNPNR D+    G+ CAAGVVFL+LV + R  R+   +    DL+ LLD
Sbjct: 177 GGETLPECVAVVNPNRQDEDGELGYFCAAGVVFLMLVEVRRQAREKG-LSTGPDLMGLLD 235

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL+G NRA V +GL V   +  PGL AL +   + +  +  +LG+++GP
Sbjct: 236 LVALATVADVAPLVGANRALVRQGLKVLGARQRPGLVALADVSRMDAAPSTYHLGFLLGP 295

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVL 359
            +NAGGRIG+++LG+RLL +++  E   LA +LD LN  RR +E+A+    +EQAEA+  
Sbjct: 296 RVNAGGRIGKADLGARLLATENPHEAAALAERLDQLNTERRDIENAVRAAAMEQAEARGF 355

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                   A ++   G+ WHPG+VG++A+RLKE  GRP+  I    +G+G GSGRS+ G 
Sbjct: 356 -------DAPLVWAAGEGWHPGVVGIVASRLKEAAGRPAVVIGL-HNGEGKGSGRSVSGI 407

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVE----RVNFGRLCDFFQK-FAHNIVPALITT 474
           D+G  +     EG+L+KGGGH MAAGLTV          RL D   K  A ++ PA    
Sbjct: 408 DLGIAIQRTAAEGLLIKGGGHKMAAGLTVAEDKLEAAMERLGDLLAKQGAGSLGPA---- 463

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              K+DG+L   A NI LI+ +E AGP+GAG   P ++FP+  ++  + +   HL+++  
Sbjct: 464 -DLKLDGMLMPGAANIDLIEQIEQAGPFGAGAAAPRYSFPDLAIRFAKRIGETHLKLSLT 522

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                 L AI F  + T LG  L++  G R H  G L +N W G +  QLR+ DA+
Sbjct: 523 DGVGGNLDAICFGAFDTALGPRLLEHGGARFHFAGRLEINSWGGRQSPQLRLEDAA 578


>gi|58039949|ref|YP_191913.1| single-stranded-DNA-specific exonuclease RecJ [Gluconobacter
           oxydans 621H]
 gi|58002363|gb|AAW61257.1| Single-stranded-DNA-specific exonuclease RecJ [Gluconobacter
           oxydans 621H]
          Length = 599

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 233/604 (38%), Positives = 340/604 (56%), Gaps = 30/604 (4%)

Query: 5   AFLGVECSISGFRWV---SLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
           A LGV  S    RW+     L +     ALA+ Q+  IP+++AR+L  R V+   A  FL
Sbjct: 8   AVLGVTRSAGHRRWIWRDPRLAEADNRLALALAQQAGIPELLARILSARGVAPPDASSFL 67

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           NP +R  MPDP  L D D+AA R+ QA+ N E + +FGDYDVDGA   AL+   L     
Sbjct: 68  NPRLRDAMPDPSCLQDMDRAAERLAQAVRNREHVGLFGDYDVDGACGTALVCDTLRELGC 127

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             + +IPDR+ +GYGPN + +E  +++GA L++ +DCG+ + D L   T++  D+IV+DH
Sbjct: 128 TVSTHIPDRLTEGYGPNTAALENLLSQGATLLVCIDCGTAAIDILNGLTDRA-DIIVLDH 186

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR------QDNKVPLN 235
           H+     +P   +VNPNRLD  SG G +CA  V FL +V   R LR      +D  +P  
Sbjct: 187 HKPDGAALPKGIVVNPNRLDCTSGLGSICATAVAFLTMVATIRHLRRCNWFDEDQVIP-- 244

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DLL  LDL ALAT+CDV+PL GLNRA V++GL V  R    GL  L     +    +A 
Sbjct: 245 -DLLKRLDLTALATICDVMPLTGLNRALVMQGLRVMSRGERLGLATLSSVAGVKEEASAM 303

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
             G+ +GP INAGGRI +++LG +LL+SDD  E   LA +LD +N+ R+ +ES +L+ A 
Sbjct: 304 ACGFALGPRINAGGRIAQADLGLKLLLSDDVVEARALAEQLDRVNRQRQTVESTILDSAM 363

Query: 356 AKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRS 415
            +   Q D     +VI + G+ WHPG+VG++A RLKE++ RP+   +   DG   GS RS
Sbjct: 364 EQAQQQLD--AGHAVIFLHGETWHPGVVGIVAGRLKERYNRPALVAAL-TDGVIKGSARS 420

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAG--LTVERVNFGRLCDFFQKFAHNIVPALIT 473
           + G D+G  +  A + G+L+ GGGHAMAAG  L+ +R       D F  +  + +   +T
Sbjct: 421 VPGLDLGTAIIAARQNGLLLSGGGHAMAAGFSLSADRA------DEFHSWLDSQLSGALT 474

Query: 474 TP---VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHK-LQSIRVVNLAH- 528
            P     K+DG++  +  ++A+ D L    P+G GN  PV A  N + ++S R+    + 
Sbjct: 475 LPKQDALKLDGIMTLAGASVAVADQLARLEPFGPGNEEPVLAISNVRCVKSERIGKDGNT 534

Query: 529 LQMTFESQDSET-LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVL 587
           L++  + +D  T L+ + FR    P    L       +HV G L    W+  K     + 
Sbjct: 535 LRVILQGEDGGTRLRGLVFRAADKPFAALLEDRSMPLVHVAGTLRAETWQERKNLSFFIS 594

Query: 588 DASP 591
           DA+P
Sbjct: 595 DAAP 598


>gi|258543197|ref|YP_003188630.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634275|dbj|BAI00251.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637335|dbj|BAI03304.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640387|dbj|BAI06349.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643444|dbj|BAI09399.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646499|dbj|BAI12447.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649552|dbj|BAI15493.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652538|dbj|BAI18472.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655596|dbj|BAI21523.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 610

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 239/604 (39%), Positives = 347/604 (57%), Gaps = 32/604 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEG---INRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
           A LGVE S+ G RW    G E    +    A+ Q+  IP+IV R+L  R ++ D A  FL
Sbjct: 19  AVLGVEASLIGRRWAWRAGAEDPALMRLGAALAQQLGIPEIVGRLLAMRQITPDQASHFL 78

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP  LTD DKAA R+ +A+ N E I IFGDYDVDGA + A++  F      
Sbjct: 79  EPKLRALMPDPSSLTDMDKAADRMAKAVQNREVIGIFGDYDVDGACASAILASFFEELGC 138

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             + +IPDR+ +GYGPN + ++  + +GA ++I VDCG+ S D L   T++  DVIV+DH
Sbjct: 139 TVHTHIPDRMTEGYGPNVAALDNLVAQGASILICVDCGTASADILSQVTDKA-DVIVLDH 197

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ------DNKVPLN 235
           H+ +    P  A VNPNR D  SG  H+CAA + FL  V   R LR+      D   P  
Sbjct: 198 HKSEDALPPILATVNPNRPDCSSGLHHICAAALAFLAAVATTRDLRRADWFTADQPPP-- 255

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DL+  LDLVALATVCDV+PL GLNRA+V +GL +  R+   GL AL+E   ++    A 
Sbjct: 256 -DLMRQLDLVALATVCDVMPLHGLNRAFVTQGLKIMARRQRTGLNALMEIAGVTKAPDAF 314

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
           + G+ +GP INAGGRI E+ LG RLL   DS E   +A +LD +N+ R+ +E+ +L++A 
Sbjct: 315 SCGFALGPRINAGGRIAEAALGLRLLRCPDSFEARQMAERLDAVNRRRQGVEADILDRA- 373

Query: 356 AKVLTQCDDIQQA--SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSG 413
              + Q +  ++A  +VI++ G  WHPG+VG++A R+KE+F RP+   + +EDG   GSG
Sbjct: 374 ---MQQAEAQKEAGHAVILLAGKDWHPGVVGIVAGRIKERFNRPALVGAEQEDGTIKGSG 430

Query: 414 RSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALIT 473
           RS+ G D+G ++  A + G+L  GGGHAMAAG +   +   +L D F  F    +    T
Sbjct: 431 RSVPGLDLGTVIIAARQAGMLKTGGGHAMAAGFS---LTADKLED-FHTFLDTRLAQAAT 486

Query: 474 TP---VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAH-- 528
            P      +D V++ S     L   + +  P+GAGNP P+ A P  ++  IR   +    
Sbjct: 487 LPEKVPLTVDAVVSISGATAELAQDMGALAPFGAGNPEPLLAIP--RVTVIRADRIGRDG 544

Query: 529 --LQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRV 586
             L++  + +++  L+A+ FR +  PL   L  +    +H+ G+L    W G       +
Sbjct: 545 NTLRLLLKGENNGRLKALLFRAHENPLAAKLEDTTRPALHLAGYLRAESWNGRTDATFFI 604

Query: 587 LDAS 590
            DA+
Sbjct: 605 QDAA 608


>gi|114797921|ref|YP_760668.1| single-stranded-DNA-specific exonuclease RecJ [Hyphomonas neptunium
           ATCC 15444]
 gi|114738095|gb|ABI76220.1| single-stranded-DNA-specific exonuclease RecJ [Hyphomonas neptunium
           ATCC 15444]
          Length = 597

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 225/592 (38%), Positives = 333/592 (56%), Gaps = 15/592 (2%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGVE S  G RW      E + R L      A  D+VAR+L  R V+ + A  +L P++
Sbjct: 12  FLGVERSAGGRRWRLADVDETMVRRL--MPAAAGSDLVARLLAGRGVTPETAPSYLAPTL 69

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R L PDP +  D DKAA  I+ AI   +++ +F DYDVDG  S A++ R+         +
Sbjct: 70  RDLFPDPSLFADMDKAAGIILDAIVAGKRVCVFADYDVDGGTSSAILARYFRAWGRELGL 129

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           Y+PDR+ +GYGP+P        +G  L+ITVDCG+ +  AL  A +  + V+V+DHH + 
Sbjct: 130 YVPDRLEEGYGPSPEAFRWLKAQGYDLVITVDCGAAAVRALDEAVSIDLPVVVLDHHLMS 189

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF--DLLSLLD 243
                  ALVNPNR D  SGQGHL AAGVVF+    + R+ RQ N  P     D+L  LD
Sbjct: 190 GHLPETAALVNPNRPDCTSGQGHLAAAGVVFVFAAAMNRLARQRNIAPPAGLPDILPYLD 249

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           L AL T+CD+ PL G+NRA+V +GL +  R  N GL+AL +   I    +  +  +++GP
Sbjct: 250 LCALGTLCDMSPLTGVNRAFVRQGLTIMSRGENVGLRALADVSGIGEIDSVYHATFLLGP 309

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            +NAGGR+G+  L ++LL +DD  E   LA +L  LN  RR +E+A+ ++A A+      
Sbjct: 310 RLNAGGRVGDPWLAAKLLATDDRGEAIALAERLHTLNDERRAVEAAIQDEATAQAERALA 369

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI-----GSGRSIEG 418
                 +I+  G+ WHPG++G++A RLK++F  P+  I +   G+G+     GSGRS+ G
Sbjct: 370 ANPDRGIIIAAGEGWHPGVIGIVAGRLKDRFHLPTIIIGW---GEGLGPVAKGSGRSVTG 426

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            ++G  +S A  EGI++ GGGHAMA GL++E        D+                   
Sbjct: 427 VNLGDAISAAAREGIILSGGGHAMAGGLSLEPHQIAAFDDWMVAHMAQFTAERDAALDLH 486

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           ID VL+  +    L D++ + GP+G G P PVFA  +     +R +   HL+ T E+ ++
Sbjct: 487 IDAVLSPGSATTDLYDLIAALGPFGMGAPEPVFAMTDVMPTGVRRIGANHLRFTAEN-NT 545

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             ++ IA+RV   P+G+ L    G+R+ + G L  + W G +R QL +LDA+
Sbjct: 546 GRIECIAWRVADEPMGDLLRT--GQRVGLAGRLKSDQWNGRRRVQLEILDAA 595


>gi|189184334|ref|YP_001938119.1| single-stranded-DNA-specific exonuclease [Orientia tsutsugamushi
           str. Ikeda]
 gi|189181105|dbj|BAG40885.1| single-stranded-DNA-specific exonuclease [Orientia tsutsugamushi
           str. Ikeda]
          Length = 587

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 243/600 (40%), Positives = 350/600 (58%), Gaps = 44/600 (7%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           E S+ G  W      E I     I QKH + D +A++L  +N+ ++    FL P+I+  +
Sbjct: 6   EQSVLGNYWNKTEFDEYIIET--IRQKHGVSDFLAKLLYAQNIDLEQISYFLTPTIKEAL 63

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D DKA  R++ AI   E I IFGDYDVDGA S AL+  +     +   +YIP+
Sbjct: 64  PDPFHLLDMDKAVNRVIHAINQQEHICIFGDYDVDGATSSALLKNYFCELGIEPIIYIPE 123

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R+ +GYGP+ S ++K  + G  LIITVDCG+++Y+AL  A  Q IDVIVIDHH +  E++
Sbjct: 124 RLTEGYGPSVSAIKKLKSAGISLIITVDCGTSAYEALAEAKAQHIDVIVIDHH-LSVEQL 182

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLD 243
           P A A++NPNRLD+ S   +L A GV FL LV +   LR+     D   P    L+  LD
Sbjct: 183 PDAVAIINPNRLDETSKYNYLAAVGVSFLFLVALRSALRKLNYFADKSEP---SLVKYLD 239

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKAL--IERVNISSPITAENLGYMI 301
           LVAL TVCDV+ LIGLNRA+V KGL +  +  N G+KAL  +     SS      LG+++
Sbjct: 240 LVALGTVCDVMALIGLNRAFVTKGLEIMAQHQNVGIKALGYLSEAEFSSDCYY--LGFVL 297

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG+S+LGS+LL +    E   +A +L+  N  R+L+E  MLE+A      Q
Sbjct: 298 GPRINAGGRIGKSDLGSKLLSTKCQIEAYNIASELENYNSERKLIEKVMLEEAVTIAREQ 357

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
            D+    +VIVV   +WHPG++G++A+RLK+ F +P   IS  +D  G  S RSI+G DI
Sbjct: 358 ADN----NVIVVANHKWHPGVIGIIASRLKDLFHKPIVVISL-DDTLGRASCRSIKGIDI 412

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFA--------HNIVPALI 472
           G  ++ A  +G+L+ GGGHAMAAG T++R   G L +F  Q+ A        HNI     
Sbjct: 413 GSKIAEAKLKGLLITGGGHAMAAGFTIKRDLIGDLKNFLNQELALDMKNLTGHNIRN--- 469

Query: 473 TTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMT 532
               + ID  L+ +++NI  +  ++   P+G GNP P+F   N KL+    ++  H+   
Sbjct: 470 ----YAID--LSIASLNINTVHEIQKLAPFGNGNPEPIFKLTNIKLKYASQLSNKHVHCV 523

Query: 533 FESQDS----ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
               ++    +T +AIAF    T L + L+ +  K + + G++ VN WRG +  Q  ++D
Sbjct: 524 LSEWENINAVKTTKAIAFNPR-TQLFDALLSTYTKPIDLIGNIKVNRWRGREEIQFVIMD 582


>gi|148284293|ref|YP_001248383.1| single-stranded-DNA-specific exonuclease [Orientia tsutsugamushi
           str. Boryong]
 gi|146739732|emb|CAM79563.1| single-stranded-DNA-specific exonuclease [Orientia tsutsugamushi
           str. Boryong]
          Length = 586

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 241/598 (40%), Positives = 346/598 (57%), Gaps = 40/598 (6%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           E S+ G  W      E I     I QKH + D +A++L  +N+ ++    FL P+I+  +
Sbjct: 6   EKSVLGNYWNKTEFDEYIIET--IRQKHGVSDFLAKLLYAQNIDLEQISYFLTPTIKDAL 63

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D DKA  R++ AI   E I IFGDYDVDGA S AL+  +     +   +YIP+
Sbjct: 64  PDPFHLLDMDKAVNRVIHAINQQEHICIFGDYDVDGATSSALLKNYFCELGIEPIIYIPE 123

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R+ +GYGP+ S ++K  + G  LIITVDCG+++Y+AL  A  Q IDVIVIDHH +  E++
Sbjct: 124 RLTEGYGPSVSAIKKLKSAGISLIITVDCGTSAYEALAEAKAQHIDVIVIDHH-LSVEQL 182

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLD 243
           P A A++NPNRLD+ S   +L A GV FL LV +   LR+     D   P    L+  LD
Sbjct: 183 PDAVAIINPNRLDETSKYNYLAAVGVSFLFLVALRSALRKLHYFTDKSEP---SLVKYLD 239

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TVCDV+ LIGLNRA+V KGL +  +  N G+KAL              LG+++GP
Sbjct: 240 LVALGTVCDVMALIGLNRAFVAKGLEIMAQHQNVGIKALGYMSEAEFSSDCYYLGFVLGP 299

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG+S+LGS+LL +    E   +A +L+  N  R+L+E  MLE+A      Q D
Sbjct: 300 RINAGGRIGKSDLGSKLLSTKCQIEAYNIASELENYNSERKLIEKVMLEEAVTIAREQAD 359

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           +    +VIVV   +WHPG++G++A+RLK+ F +P   IS  +D  G  S RSI+G DIG 
Sbjct: 360 N----NVIVVANHKWHPGVIGIIASRLKDLFHKPIVVISL-DDTLGRASCRSIKGIDIGS 414

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFA--------HNIVPALITT 474
            ++ A  +G+L+ GGGHAMAAG T++R   G L +F  Q+ A        HNI       
Sbjct: 415 KIAEAKLKGLLITGGGHAMAAGFTIKRDLIGDLKNFLNQELALDIKNLTGHNIRN----- 469

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
             + ID  L+ +++NI  +  ++   P+G GNP P+F   N KL+    ++  H+     
Sbjct: 470 --YAID--LSIASLNINTVHEIQKLAPFGNGNPEPIFKLTNIKLKYASQLSNKHVHCVLS 525

Query: 535 SQDS----ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              +    +T +AIAF    T L + L+ +  K + + G++ VN WRG +  Q  ++D
Sbjct: 526 EWGNINAVKTTKAIAFNPR-TQLFDALLSTYTKPIDIIGNIKVNRWRGREEIQFAIMD 582


>gi|148557626|ref|YP_001265208.1| single-stranded-DNA-specific exonuclease RecJ [Sphingomonas
           wittichii RW1]
 gi|148502816|gb|ABQ71070.1| single-stranded-DNA-specific exonuclease RecJ [Sphingomonas
           wittichii RW1]
          Length = 588

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 232/555 (41%), Positives = 333/555 (60%), Gaps = 9/555 (1%)

Query: 41  DIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           D++ ++L+ R    +  +    P+IR  MPDP I  D D+AA R+  A+ + E + IFGD
Sbjct: 35  DLITQLLLARGCPREAVELHRLPTIRGFMPDPSIFRDMDEAAARLADAVEHGEPVTIFGD 94

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDGA S AL++R L    + A  YIPDR+++GYGP+   + K    G +LI+TVDCG+
Sbjct: 95  YDVDGATSAALLIRLLRDLGLRAGFYIPDRLMEGYGPSGEALLKIGEGGTRLIVTVDCGA 154

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSG--QGHLCAAGVVFLV 218
            +++AL+ A++ GIDVIV+DHH+  +E   A+ALVNPNRLD+  G   GHL A GV FL+
Sbjct: 155 QAFEALKLASDAGIDVIVVDHHKCAAELPRAFALVNPNRLDEGEGAAHGHLAAVGVAFLL 214

Query: 219 LVLIYRILRQDNKVPLNFD--LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGN 276
              + R+LR  N      +  L+ LLD+VAL TV DV  L GLNRA+V +G+ V   + N
Sbjct: 215 GAALLRVLRARNFFATRAEPKLIDLLDIVALGTVADVASLRGLNRAFVAQGIKVMAGRRN 274

Query: 277 PGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
            GL ALIE   +    T  +LG+ +GP INAGGR+G+S+LG RLL ++D  E   +A +L
Sbjct: 275 IGLAALIEASRLERAPTCTDLGFALGPRINAGGRVGKSDLGVRLLTTEDRDEARTIAAEL 334

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           D LN+ RR +E A+ E+AE    +Q +     SV VV    WHPG++G++A RLKEK GR
Sbjct: 335 DRLNEERRAIEKAVQEEAETLSGSQGNR----SVAVVAAGGWHPGVIGIVAGRLKEKLGR 390

Query: 397 PSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRL 456
           P+  I+ ++DG G GSGRSI G D+G  +  A + G+LV GGGHAMAAG+TV       L
Sbjct: 391 PALVIALDKDGVGKGSGRSIGGVDLGAAILAAKDMGLLVAGGGHAMAAGVTVAPGGVDAL 450

Query: 457 CDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNH 516
            DF ++   + V          +D V+    V  +L++ LE+ GPYGAG P P  A    
Sbjct: 451 ADFLEERLASDVARARDDRALLLDAVVAPGGVTPSLVEALEAGGPYGAGWPAPRIAAGAV 510

Query: 517 KLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKR-MHVTGHLCVNY 575
           ++    VV   H++     +D  +++ IAFR   + LG+ L+ +   R + + G   V+ 
Sbjct: 511 RVIKADVVGQGHVRTIVSGRDGRSIKTIAFRAADSALGQALLGAGPDRTLWIAGRPKVDD 570

Query: 576 WRGSKRCQLRVLDAS 590
           W      +L V DA+
Sbjct: 571 WGSRPAAELHVEDAA 585


>gi|225677396|ref|ZP_03788363.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590540|gb|EEH11800.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 547

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 230/539 (42%), Positives = 336/539 (62%), Gaps = 22/539 (4%)

Query: 24  QEGINRA-LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAA 82
           QE   R  L +TQ+  +P+I+AR+LV R V+I+ A DFL P IR L+PDP  L D DKA 
Sbjct: 18  QEADQRQILTLTQRFELPEILARILVTRGVNIENASDFLYPLIRSLLPDPFHLLDMDKAV 77

Query: 83  RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLM 142
            RI+ AI N E + IFGDYDVDGA S AL+ R+L    +++ +YIPDR+ +GYG N   +
Sbjct: 78  SRIIWAIKNDENLAIFGDYDVDGATSSALINRYLRAIDIHSIIYIPDRVDEGYGLNTDAL 137

Query: 143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLD 201
            +    G  L I+VDCG+ +Y  ++ A   G+D+IV+DHH + +E++P A A+VNPNRLD
Sbjct: 138 LQLKKNGIDLCISVDCGTLAYQPIEDAKAFGLDIIVVDHH-LGTEKLPSAVAVVNPNRLD 196

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPL 256
           + S   +L A GV FL++V + + LR+     + K P   DL  LLDLVAL TVCDV+ +
Sbjct: 197 ESSPYNNLAAVGVSFLLIVALNKSLREQGFFTNKKEP---DLFDLLDLVALGTVCDVMQI 253

Query: 257 IGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNL 316
            GLNRA V +GL V   + N GL+ L + + I    +   LG+ IGP INAGGRIGE++L
Sbjct: 254 TGLNRALVSQGLKVMSTRKNVGLRVLFDALGILEKPSVSRLGFSIGPCINAGGRIGEASL 313

Query: 317 GSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGD 376
           G+RLL +DD +E   +A+KL  LN  R+++E+  L +A A+          A+ I++ G+
Sbjct: 314 GARLLSTDDDEEAHSIALKLIDLNNARKVLENEALLEATAQAEKSAQ--SGANFIMISGN 371

Query: 377 RWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVK 436
            WH GI+G++A+RLKE+F  P+  IS   +G G  S RSI G DI   V  A    ++++
Sbjct: 372 -WHQGIIGIIASRLKEQFHLPTVVISL-NNGIGKASCRSILGVDIDAAVLSAKFINLIIE 429

Query: 437 GGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           GGGH+MAAG +++      L DFF ++F+++     I     K D ++ A A+N++L + 
Sbjct: 430 GGGHSMAAGFSIKEDKINDLHDFFTERFSNS-----INEKTLKADSIVTAKAINLSLWNQ 484

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLG 554
           L+  GP+G GNP P F     K++   V+ + H++  F + D+  ++AIAFR   T LG
Sbjct: 485 LQRLGPFGVGNPEPRFIIQGAKIRKPEVIGVDHIK-CFIADDNVMVRAIAFRSANTHLG 542


>gi|57239581|ref|YP_180717.1| single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57161660|emb|CAH58590.1| putative single-stranded-DNA-specific exonuclease RecJ [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 585

 Score =  402 bits (1033), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 226/569 (39%), Positives = 342/569 (60%), Gaps = 30/569 (5%)

Query: 31  LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           L I QK  + +IVAR+L  R ++I+   +FL P+++  +P+P  + D DKA  RI  AI+
Sbjct: 30  LTIKQKFYLSEIVARILSARKINIEEISNFLYPTLKSSLPNPFHMLDMDKAVYRICHAIH 89

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
           N E I+IFGDYDVDGA S AL+ ++LS   V   +YIPDRI +GYGPN   + K    G 
Sbjct: 90  NRENIVIFGDYDVDGATSSALIKQYLSQIGVPTTIYIPDRICEGYGPNTQALLKLKEIGN 149

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
            L ITVDCG+ +++ +  A +  +DVIVIDHH   +    A A++NPNRLD+ S   +L 
Sbjct: 150 SLCITVDCGTIAHEPISAAKSVNLDVIVIDHHIGINTLPDAVAVINPNRLDETSPYTYLA 209

Query: 211 AAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVV 265
             GV FL+LV +++ L++     +N+ P   +L++ LDLVAL TVCDV+P+IGLNR +V 
Sbjct: 210 GVGVSFLMLVALHKTLKEQGFFKNNQEP---NLINYLDLVALGTVCDVMPIIGLNRTFVK 266

Query: 266 KGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDD 325
           +GL +   + N GLK L + + +        LG+ IGP INAGGR+G ++LG+RLL +++
Sbjct: 267 QGLKIMTTRQNLGLKTLSDVIGLEEKPNIYQLGFNIGPHINAGGRVGNASLGARLLSTNN 326

Query: 326 SQELEMLAMKLDVLNQNRRLME----SAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPG 381
            +E   ++ KL   N  R+ +E    +  +EQ EA +++       +++I+  G+ WHPG
Sbjct: 327 EEEALEISEKLQNFNLERKTLENQSFNEAVEQIEATIIS-------SNIIIATGN-WHPG 378

Query: 382 IVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHA 441
           I+G++A RLK+KF  PS  IS  E+G G  S RSI   D+G  +  A   GI+++GGGHA
Sbjct: 379 IIGIVAGRLKDKFFLPSIVISL-ENGIGKASARSIPDVDLGAAILEAKALGIIIEGGGHA 437

Query: 442 MAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGP 501
           MAAG +++      L +F  +  HNI     T  VFK+DG++ A A+N+ L   L+   P
Sbjct: 438 MAAGFSIQENKIKILHEFLSQKFHNIN----TRKVFKVDGIVTAEAINLKLWKELQFLEP 493

Query: 502 YGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET-LQAIAFRVYGTPLGEFLMQS 560
           +G GNP P F   N ++++  V+  +H++      D++T ++ I FR  GT L       
Sbjct: 494 FGIGNPEPRFILTNIRIKNSEVIGESHIRCLI--YDNKTFIKGICFRCIGTEL--GTTLL 549

Query: 561 RGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
                 + G + +NYWRG++  Q  + DA
Sbjct: 550 ECTTTTLLGKISINYWRGNENIQFIIEDA 578


>gi|329114086|ref|ZP_08242850.1| Single-stranded-DNA-specific exonuclease RecJ [Acetobacter pomorum
           DM001]
 gi|326696625|gb|EGE48302.1| Single-stranded-DNA-specific exonuclease RecJ [Acetobacter pomorum
           DM001]
          Length = 611

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 237/603 (39%), Positives = 345/603 (57%), Gaps = 30/603 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQEG---INRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
           A LGVE S  G RWV   G E    +    A+ Q+  IP+IV R+L  R ++ D A  FL
Sbjct: 20  AVLGVEASFVGRRWVWRAGAEDPALMRLGAALAQQLGIPEIVGRLLAMRQITPDQAPHFL 79

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP  LTD DK A R+ +A+ N E I IFGDYDVDGA + A++  F      
Sbjct: 80  EPKLRALMPDPSTLTDMDKVAARMAKAVQNREVIGIFGDYDVDGACASAILASFFEELGC 139

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             + +IPDR+ +GYGPN + ++  + +GA ++I VDCG+ S D L   T++  DVIV+DH
Sbjct: 140 TVHTHIPDRMTEGYGPNVAALDNLVAQGASILICVDCGTASADILCQMTDKA-DVIVLDH 198

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF---DL 238
           H+ +    P  A VNPNR D  SG  H+CAA + FL  V   R LR+ +    N    DL
Sbjct: 199 HKSEDALPPILATVNPNRPDCPSGLHHICAAALAFLAAVATTRDLRRADWFTANQPPPDL 258

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           +  LDLVALATVCDV+PL GLNRA+V +GL +  R+   GL AL+E   ++    A + G
Sbjct: 259 MRQLDLVALATVCDVMPLHGLNRAFVTQGLKIMARRQRTGLNALMEIAGVTKAPDAFSCG 318

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           + +GP INAGGRI E+ LG RLL   D+ E   +A +LD +N+ R+ +E+ +L+ A    
Sbjct: 319 FALGPRINAGGRIAEAALGLRLLRCPDNFEARQMAERLDAVNRRRQGVEADILDLA---- 374

Query: 359 LTQCDDIQQA--SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSI 416
           + Q +  ++A  +VI++ G  WHPG+VG++A R+KE+F RP+   + +EDG   GSGRS+
Sbjct: 375 MQQAEAQKKAGHAVIMLAGKDWHPGVVGIVAGRIKERFNRPALVGAEQEDGTIKGSGRSV 434

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAG--LTVERVNFGRLCDFFQKFAHNIVPALITT 474
            G D+G ++  A + G+L  GGGHAMAAG  LT +++      + F  F    +    T 
Sbjct: 435 PGLDLGTVIIAARQAGMLKTGGGHAMAAGFSLTADKL------EEFHTFLDTRLAQAATL 488

Query: 475 P---VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAH--- 528
           P      +D V+  S     L   + +  P+GAGNP P+ A P  ++  IR   +     
Sbjct: 489 PEKVPLTVDAVVAISGATAELAQDMGALAPFGAGNPEPLLAIP--RVTVIRADRIGRDGN 546

Query: 529 -LQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVL 587
            L++  + +++  L+A+ FR +  PL   L  +    +H+ G+L    W G       + 
Sbjct: 547 TLRLLLKGENNGRLKALLFRAHENPLAAKLEDTTRPALHLAGYLRAESWNGRTDATFFIQ 606

Query: 588 DAS 590
           DA+
Sbjct: 607 DAA 609


>gi|58579570|ref|YP_197782.1| single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58418196|emb|CAI27400.1| Single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 590

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 226/569 (39%), Positives = 342/569 (60%), Gaps = 30/569 (5%)

Query: 31  LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           L I QK  + +IVAR+L  R ++I+   +FL P+++  +P+P  + D DKA  RI  AI+
Sbjct: 35  LTIKQKFYLSEIVARILSARKINIEEISNFLYPTLKSSLPNPFHMLDMDKAVYRICHAIH 94

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
           N E I+IFGDYDVDGA S AL+ ++LS   V   +YIPDRI +GYGPN   + K    G 
Sbjct: 95  NRENIVIFGDYDVDGATSSALIKQYLSQIGVPTTIYIPDRICEGYGPNTQALLKLKEIGN 154

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
            L ITVDCG+ +++ +  A +  +DVIVIDHH   +    A A++NPNRLD+ S   +L 
Sbjct: 155 SLCITVDCGTIAHEPISAAKSVNLDVIVIDHHIGINTLPDAVAVINPNRLDETSPYTYLA 214

Query: 211 AAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVV 265
             GV FL+LV +++ L++     +N+ P   +L++ LDLVAL TVCDV+P+IGLNR +V 
Sbjct: 215 GVGVSFLMLVALHKTLKEQGFFKNNQEP---NLINYLDLVALGTVCDVMPIIGLNRTFVK 271

Query: 266 KGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDD 325
           +GL +   + N GLK L + + +        LG+ IGP INAGGR+G ++LG+RLL +++
Sbjct: 272 QGLKIMTTRQNLGLKTLSDVIGLEEKPNIYQLGFNIGPHINAGGRVGNASLGARLLSTNN 331

Query: 326 SQELEMLAMKLDVLNQNRRLME----SAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPG 381
            +E   ++ KL   N  R+ +E    +  +EQ EA +++       +++I+  G+ WHPG
Sbjct: 332 EEEALEISEKLQNFNLERKTLENQSFNEAVEQIEATIIS-------SNIIIATGN-WHPG 383

Query: 382 IVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHA 441
           I+G++A RLK+KF  PS  IS  E+G G  S RSI   D+G  +  A   GI+++GGGHA
Sbjct: 384 IIGIVAGRLKDKFFLPSIVISL-ENGIGKASARSIPDVDLGAAILEAKALGIIIEGGGHA 442

Query: 442 MAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGP 501
           MAAG +++      L +F  +  HNI     T  VFK+DG++ A A+N+ L   L+   P
Sbjct: 443 MAAGFSIQENKIKILHEFLSQKFHNIN----TRKVFKVDGIVTAEAINLKLWKELQFLEP 498

Query: 502 YGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET-LQAIAFRVYGTPLGEFLMQS 560
           +G GNP P F   N ++++  V+  +H++      D++T ++ I FR  GT L       
Sbjct: 499 FGIGNPEPRFILTNIRIKNSEVIGESHIRCLI--YDNKTFIKGICFRCIGTEL--GTTLL 554

Query: 561 RGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
                 + G + +NYWRG++  Q  + DA
Sbjct: 555 ECTTTTLLGKISINYWRGNENIQFIIEDA 583


>gi|85708498|ref|ZP_01039564.1| single-stranded DNA-specific exonuclease [Erythrobacter sp. NAP1]
 gi|85690032|gb|EAQ30035.1| single-stranded DNA-specific exonuclease [Erythrobacter sp. NAP1]
          Length = 572

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 235/560 (41%), Positives = 343/560 (61%), Gaps = 19/560 (3%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           +V ++L+ R V+ D       P++R  +PDP    D ++AA RI QA+ N E+I I+GDY
Sbjct: 18  VVTQLLMTRGVAADEVAKHAKPTMREFLPDPSEFRDMEQAAERIAQAVLNEEQITIYGDY 77

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDGA S AL++  L    V A  YIPDR+++GYGP+   + K   +G+ LI+TVDCG+ 
Sbjct: 78  DVDGATSSALLVDLLRSLGVEAGYYIPDRLLEGYGPSGEALVKLAEDGSSLIVTVDCGAM 137

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDD---LSGQGHLCAAGVVFLV 218
           +++AL  A + G+DVIV+DHH+  +E  P  ALVNPNRLD+    +  GHL A GV FL+
Sbjct: 138 AHEALTMARDAGVDVIVVDHHKCAAELPPTAALVNPNRLDESDLAASHGHLAAVGVAFLL 197

Query: 219 LVLIYRILR-----QDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR 273
            + + R LR     +  + P   DL+SLLDLVAL TV DV  L GLNRA+V +GL V  R
Sbjct: 198 AIALVRTLRAKGFFESRREP---DLMSLLDLVALGTVADVAALHGLNRAFVSQGLKVLAR 254

Query: 274 QGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLA 333
           +   G+ ALI+   +     A +LG+ +GP INAGGRIGES LG RLL + D++E   +A
Sbjct: 255 RDRIGMAALIDASRLKRAPIASDLGFALGPRINAGGRIGESTLGVRLLTTSDAEEAREIA 314

Query: 334 MKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEK 393
            +L  LN+ RR +E+ + E AEA++  Q       +V V+  D WHPG++G++AAR+KEK
Sbjct: 315 EQLSALNEERRAIEAEVQEAAEAQLEGQ----HNMAVQVLAADGWHPGVIGIVAARIKEK 370

Query: 394 FGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVN 452
            G+PS  I+ +  DG G GSGRSI G D+G  +  A EEG+LV GGGHAMAAGLT+ +  
Sbjct: 371 TGKPSIVIALDPADGTGKGSGRSISGVDLGAAIIAAREEGLLVAGGGHAMAAGLTIAQDK 430

Query: 453 FGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVF 511
                +F  ++ A ++  A I+  V ++D  L    +   L++ LE+AGPYG G P P  
Sbjct: 431 LSAFTEFLDERLARDVERARISQ-VMQLDLSLAPGGLTPDLVNTLEAAGPYGVGWPAPRV 489

Query: 512 AFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLM-QSRGKRMHVTGH 570
           A    ++ +  +V   HL++     D  + +AIAFR   T + + L+ +S+G++ H  G 
Sbjct: 490 AVGPVRIVNADIVGKDHLRVIASGGDGRSFKAIAFRAAETEMAQTLIHRSKGRQFHFAGR 549

Query: 571 LCVNYWRGSKRCQLRVLDAS 590
           + ++ W      +L + DA+
Sbjct: 550 VKIDDWGPRPAAELHLEDAA 569


>gi|58617623|ref|YP_196822.1| single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Gardel]
 gi|58417235|emb|CAI28348.1| Single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Gardel]
          Length = 590

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 225/569 (39%), Positives = 341/569 (59%), Gaps = 30/569 (5%)

Query: 31  LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           L I QK  + +IVAR+L  R ++I+   +FL P+++  +P+P  + D DKA  RI  AI+
Sbjct: 35  LTIKQKFYLSEIVARILSARKINIEEISNFLYPTLKSSLPNPFHMLDMDKAVYRICHAIH 94

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
           N E I+IFGDYDVDGA S AL+ ++LS   V   +YIPDRI +GYGPN   + K    G 
Sbjct: 95  NRENIVIFGDYDVDGATSSALIKQYLSQIGVPTTIYIPDRICEGYGPNTQALLKLKEIGN 154

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
            L ITVDCG+ +++ +  A +  +DVIVIDHH   +    A A++NPNRLD+ S   +L 
Sbjct: 155 SLCITVDCGTIAHEPISAAKSVNLDVIVIDHHIGINTLPDAVAVINPNRLDETSPYTYLA 214

Query: 211 AAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVV 265
             GV FL+LV +++ L++     +N+ P   +L++ LDLVAL TVCDV+P+IGLNR +V 
Sbjct: 215 GVGVSFLMLVALHKTLKEQGFFKNNQEP---NLINYLDLVALGTVCDVMPIIGLNRTFVK 271

Query: 266 KGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDD 325
           +GL +   + N GLK L + + +        LG+ IGP INAGGR+G ++LG+RLL +++
Sbjct: 272 QGLKIMTTRQNLGLKTLSDVIGLEEKPNIYQLGFNIGPHINAGGRVGNASLGARLLSTNN 331

Query: 326 SQELEMLAMKLDVLNQNRRLME----SAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPG 381
            +E   ++ KL   N  R+ +E    +  +EQ EA +++       +++I+  G+ WHPG
Sbjct: 332 EEEALEISEKLQNFNLERKTLENQSFNEAVEQIEATIIS-------SNIIIATGN-WHPG 383

Query: 382 IVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHA 441
           I+G++A RLK+KF  PS  IS  E+G G  S RSI   D+G  +  A   GI+++GGGHA
Sbjct: 384 IIGIVAGRLKDKFFLPSIVISL-ENGIGKASARSIPDVDLGAAILEAKALGIIIEGGGHA 442

Query: 442 MAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGP 501
           MAAG +++      L +F  +  HNI     T  VFK+DG++ A A+N+ L   L+   P
Sbjct: 443 MAAGFSIQENKIKILHEFLSQKFHNIN----TRKVFKVDGIVTAEAINLKLWKELQFLEP 498

Query: 502 YGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET-LQAIAFRVYGTPLGEFLMQS 560
           +G GNP P F   N ++++  V+  +H++      D++T ++ I FR  GT         
Sbjct: 499 FGIGNPEPRFILTNIRIKNPEVIGESHIRCLI--YDNKTFIKGICFRCIGTE--LGTTLL 554

Query: 561 RGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
                 + G + +NYWRG++  Q  + DA
Sbjct: 555 ECTTTTLLGKISINYWRGNENIQFIIEDA 583


>gi|91205110|ref|YP_537465.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia bellii
           RML369-C]
 gi|91068654|gb|ABE04376.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia bellii
           RML369-C]
          Length = 585

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 233/586 (39%), Positives = 343/586 (58%), Gaps = 15/586 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W      E I   + + +   I D++AR++  R   I  A+DFL P I+ L+
Sbjct: 4   QASINGKIWQRRSVNEEI--VIELCRSFKISDLLARMISLRIDDIAKAEDFLMPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D  KA  R ++AI + +KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMQKAVDRAIKAILSKQKICIFADYDVDGATSSALLKNVFKDLNIVCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP PS M+K  + G +L+ITVDCG+ +++AL+YA + G+DVIVIDHH + +E +
Sbjct: 122 RIAEGYGPTPSAMQKIKDNGTELLITVDCGAMAHEALKYAKDAGLDVIVIDHH-IATEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLSLLDLVA 246
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N  +  L  +L+  LDLVA
Sbjct: 181 PEAVAIVNPNRVDETSECKHLAAVGVAFLFATGILSDLKRQNYFEKTLPPNLMKYLDLVA 240

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD+V LIGLNRA+V  GL +  ++ N G+K L +   ++      +LG+++GP IN
Sbjct: 241 LGTVCDMVKLIGLNRAFVSSGLKIMHQRQNIGIKTLYDMAGLNEIPKCYHLGFILGPRIN 300

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL ++ S E   LA +L+  N  R+++E  M+E+A     TQ D+  
Sbjct: 301 AGGRVGKSSLGANLLSTNCSNEALKLAEELEKHNNERKVIEMLMIEEAMEMAKTQQDN-- 358

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
             S++ +  + WHPG++G++A RLKEKF +P   I+   DG G  S RSI G D G  + 
Sbjct: 359 --SLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEII 415

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +F        +  L      + D  L+ S
Sbjct: 416 NAKVKNLLITGGGHAMAAGFTVAAEKIQELQEFLNNAFRISLNRLENYKQAEYDLDLSLS 475

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF----ESQDSETLQ 542
           +V++ L++ L +  P+G GN  P+F F N  +    +V   H++  F    +S  S+ LQ
Sbjct: 476 SVHLPLMEELSTLEPFGQGNYEPIFKFDNLFVLKADIVGSKHIRCLFAPNKKSSSSKALQ 535

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AIAF   GT   E L+  +   + V G L  N W+ +   QL + D
Sbjct: 536 AIAFNSLGTSFEEVLLSPKAHNISVLGTLKTNNWQNNYTIQLIIKD 581


>gi|157827557|ref|YP_001496621.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia bellii
           OSU 85-389]
 gi|157802861|gb|ABV79584.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia bellii
           OSU 85-389]
          Length = 585

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 233/586 (39%), Positives = 343/586 (58%), Gaps = 15/586 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W      E I   + + +   I D++AR++  R   I  A+DFL P I+ L+
Sbjct: 4   QASINGKIWQRRSVNEEI--VIELCRSFKISDLLARMISLRIDDIAKAEDFLMPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D  KA  R ++AI + +KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMQKAVDRAIKAILSKQKICIFADYDVDGATSSALLKNVFKDLNIVCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP PS M+K  + G +L+ITVDCG+ +++AL+YA + G+DVIVIDHH + +E +
Sbjct: 122 RIAEGYGPTPSAMQKIKDNGTELLITVDCGAMAHEALKYAKDAGLDVIVIDHH-IATEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLSLLDLVA 246
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N  +  L  +L+  LDLVA
Sbjct: 181 PEAVAIVNPNRVDETSECKHLAAVGVAFLFATGILSDLKRQNYFEKTLPPNLMKYLDLVA 240

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD+V LIGLNRA+V  GL +  ++ N G+K L +   ++      +LG+++GP IN
Sbjct: 241 LGTVCDMVKLIGLNRAFVSSGLKIMHQRQNIGIKTLYDMAGLNEIPKCYHLGFILGPHIN 300

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL ++ S E   LA +L+  N  R+++E  M+E+A     TQ D+  
Sbjct: 301 AGGRVGKSSLGANLLSTNCSNEALKLAEELEKHNNERKVIEMLMIEEAMEMAKTQQDN-- 358

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
             S++ +  + WHPG++G++A RLKEKF +P   I+   DG G  S RSI G D G  + 
Sbjct: 359 --SLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEII 415

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +F        +  L      + D  L+ S
Sbjct: 416 NAKVKNLLITGGGHAMAAGFTVAAEKIQELQEFLNNAFRISLNRLENYKQAEYDLDLSLS 475

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF----ESQDSETLQ 542
           +V++ L++ L +  P+G GN  P+F F N  +    +V   H++  F    +S  S+ LQ
Sbjct: 476 SVHLPLMEELSTLEPFGQGNYEPIFKFDNLFVLKADIVGSKHIRCLFAPNKKSSSSKALQ 535

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AIAF   GT   E L+  +   + V G L  N W+ +   QL + D
Sbjct: 536 AIAFNSLGTSFEEVLLSPKAHNISVLGTLKTNNWQNNYTIQLIIKD 581


>gi|88607079|ref|YP_505704.1| single-stranded-DNA-specific exonuclease RecJ [Anaplasma
           phagocytophilum HZ]
 gi|88598142|gb|ABD43612.1| single-stranded-DNA-specific exonuclease RecJ [Anaplasma
           phagocytophilum HZ]
          Length = 585

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 223/563 (39%), Positives = 339/563 (60%), Gaps = 17/563 (3%)

Query: 31  LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           L I QK  + +IVA VL  + + +D  +DFL P+++LL+PDP  L D  KA  RI++AIY
Sbjct: 31  LTIKQKFGLSEIVAHVLAIKRIPLDDIRDFLFPTLKLLLPDPFHLLDMGKAVDRILKAIY 90

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
             E+I+IFGDYDVDGA S A++ R+       A +YIPDR+ +GYGPNP  + K   +G 
Sbjct: 91  EKERIVIFGDYDVDGATSSAMLKRYFKSIGATAEVYIPDRLKEGYGPNPEALIKLRKKGC 150

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHL 209
            L ITVDCG+ +++ +  A   G+DVIV+DHH + S  +P A A++NPNRLD+ S   +L
Sbjct: 151 SLCITVDCGTVAHEPISVARAAGLDVIVVDHH-IGSPTLPDATAIINPNRLDETSTYTYL 209

Query: 210 CAAGVVFLVLVLIYRILRQDNKVPLNFD--LLSLLDLVALATVCDVVPLIGLNRAYVVKG 267
              G  F++L+ + + LRQ        +  L++ LDLVAL TVCDV+P++ LNRA+V +G
Sbjct: 210 SGVGTSFMLLIALNKTLRQAGYFQQENEPNLMNYLDLVALGTVCDVMPMLKLNRAFVKQG 269

Query: 268 LMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQ 327
           L V   +GN GL+ L + + I    +  +LG+ IGP INAGGRIG S+LG+RLL S+D+ 
Sbjct: 270 LKVMSERGNMGLRTLADAIGIEEKPSVYHLGFCIGPHINAGGRIGNSSLGARLLSSNDAI 329

Query: 328 ELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLA 387
           E   +   L  LN  R+ +E+  L +A A+     D  +  ++I+V G+ WH G++G++A
Sbjct: 330 ECNKIVTMLLDLNNERKEIENRSLAEALAQAELLVD--EGKNIIMVTGN-WHVGVIGIIA 386

Query: 388 ARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLT 447
            R+KE+F  P+  IS + D  G  S RS+ G DIG  V  A  E ++ +GGGH MAAG +
Sbjct: 387 GRIKERFFLPTIVISLDGD-MGKASARSVAGIDIGAAVLSAKFEKLIPEGGGHEMAAGFS 445

Query: 448 VERVNFGRLCDFF-QKFAH-NIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAG 505
           V R     L  FF ++F   NI  AL  +      G+L+ + ++ AL   L+   P+G G
Sbjct: 446 VHRSQIEPLYKFFLERFKDVNIQKALHAS------GILSTAGISSALCRELQLLEPFGPG 499

Query: 506 NPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRM 565
           NP P F   N ++++  ++  +H++   +     +++ + F+  GT L   L+Q  G  +
Sbjct: 500 NPEPKFVLRNVRIKNPAIIGESHIKCLIDDGSGASVRGMCFKCVGTELALGLLQG-GIAV 558

Query: 566 HVTGHLCVNYWRGSKRCQLRVLD 588
           H+ G + +N WRG++  Q  + D
Sbjct: 559 HLLGKVSMNQWRGNEYVQFIIDD 581


>gi|296283974|ref|ZP_06861972.1| single-stranded-DNA-specific exonuclease RecJ [Citromicrobium
           bathyomarinum JL354]
          Length = 600

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 242/596 (40%), Positives = 344/596 (57%), Gaps = 21/596 (3%)

Query: 8   GVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRL 67
           GVE S+ G  W    G    +   A        DI+ ++L+ R V+ D  +    P +  
Sbjct: 15  GVERSLGGRSWRWRGGPNQYDGPAASLGD----DILTQLLLARGVARDDLERQREPKLAA 70

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
            +PDP I  D + AA R+ QAI   EK+ I+GDYDVDGA S AL++R        A+ YI
Sbjct: 71  FLPDPAIFQDMEAAAERLAQAILTREKVTIYGDYDVDGATSAALLIRLFGMLGHEADYYI 130

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           PDR+++GYGP+   + K   +G+ L++TVDCG+ +++AL  A + G++VIVIDHH+   E
Sbjct: 131 PDRLLEGYGPSGEALVKLGEQGSSLVVTVDCGAMAHEALAAARDAGVEVIVIDHHKCSHE 190

Query: 188 EIPAYALVNPNRL---DDLSGQGHLCAAGVVFLVLVLIYRILR-----QDNKVPLNFDLL 239
             PA ALVNPNRL   D+ +  GHL A GV FLV + + R LR     +D K P   DL 
Sbjct: 191 RPPALALVNPNRLDEADEAAAHGHLAAVGVAFLVAIALVRKLRTHGYFKDRKEP---DLR 247

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            LLDLVAL TV DV  L GLNRA+V +GL V  ++ N G+ ALI+   ++    + +LG+
Sbjct: 248 GLLDLVALGTVADVAALHGLNRAFVSQGLKVMAKRANIGMSALIDASRLTRAPISSDLGF 307

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
            +GP INAGGR+GES LG RLL ++D +E   +A +L  LN+ RR +E+ + E  EA++ 
Sbjct: 308 ALGPRINAGGRVGESTLGVRLLTTEDPEEAAQIAAQLSQLNEERRAIEAEVQEAGEAQLA 367

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEG 418
            Q +     +V +V GD WHPG++G++A R+KEK GRPS  I+ + + G G GSGRSI G
Sbjct: 368 GQGNR----AVRIVHGDGWHPGVIGIVAGRIKEKTGRPSLVIARDSQAGLGKGSGRSIPG 423

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+G  +  A EEG+L  GGGHAMAAGLTV         D+ +      V A        
Sbjct: 424 VDLGAAIMAAREEGLLEAGGGHAMAAGLTVHEDKIEAFTDWLESRLERQVAAASAEASLG 483

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
            D  L    + + L++ LE  GPYG G P P  A     L  +  V   H+++   S+D 
Sbjct: 484 FDLSLGPRGLTVELVETLERGGPYGMGWPGPRIAIGPVHLVKVDRVGSDHVRLLAGSRDG 543

Query: 539 ETLQAIAFRVYGTPLGEFLMQSR-GKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            +++AIAFR   +  G+ L+ +  G RM + G   V+ W  + R +L + DA+ +E
Sbjct: 544 GSIKAIAFRAADSDWGQALLAAHPGTRMWLAGRAKVDTWANTPRAELHLEDAAFIE 599


>gi|329850707|ref|ZP_08265552.1| single-stranded-DNA-specific exonuclease RecJ [Asticcacaulis
           biprosthecum C19]
 gi|328841022|gb|EGF90593.1| single-stranded-DNA-specific exonuclease RecJ [Asticcacaulis
           biprosthecum C19]
          Length = 618

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 229/609 (37%), Positives = 341/609 (55%), Gaps = 32/609 (5%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGI--NRALAITQK--------HAIPDIVARVLVNRNVS 53
           + +LGV  S++G  W   L  + +       ITQ+         A  D +AR +  R ++
Sbjct: 14  EPYLGVTASLTGRGWSERLAAQKVAPETLREITQRLGLMNVAEPAFLDPLARFIAGRGIT 73

Query: 54  IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMM 113
            D    F++P+++ L PDP    D D+A   +++A+    KI +F DYDVDGA S A ++
Sbjct: 74  PDSLDTFIHPTLKALFPDPSSFMDMDRAVEAMLEALQAKAKICVFADYDVDGATSAAQLV 133

Query: 114 RFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQG 173
           R+  H   +  +Y+PDR+ +GYGP+ +  +    +GA L+ITVDCG+ ++ AL +A   G
Sbjct: 134 RWFRHMGHDLTVYVPDRVTEGYGPSNAAFDTLKRQGADLVITVDCGAMAHRALDHAAEIG 193

Query: 174 IDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP 233
           +DV+VIDHH ++ +   A A+VNPNR    S QG+L AAGVVF+VL  +    R+  K  
Sbjct: 194 LDVVVIDHHLMREDPPRALAVVNPNRPGCTSAQGNLAAAGVVFVVLAALN---REAEKRG 250

Query: 234 L-----NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI 288
           L       DL+  LDL AL  +CDV  L G NRA   +GL +  ++ NPG+ AL++    
Sbjct: 251 LFAGRGRPDLMQWLDLSALGAICDVTALTGFNRALAAQGLKIMSQRKNPGINALMDIAGS 310

Query: 289 SSP----ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRR 344
           +S     ++  + G++IGP INAGGR+G S+LG RLL +DD  E   LA +LD LN+ RR
Sbjct: 311 ASEAGKLMSTFHSGFVIGPRINAGGRVGRSDLGVRLLSTDDPVEAASLAQELDELNRLRR 370

Query: 345 LMESAMLEQ----AEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
            +E+ +LEQ    AE + L   DD     VIVV    WHPG++G++A RL+E++ RP   
Sbjct: 371 DVETQVLEQAARVAEDQGLWPSDD----PVIVVAHQDWHPGVIGIVAGRLRERWHRPVII 426

Query: 401 ISFEE-DGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDF 459
           I  +   G G GSGRS  G ++G+ V  A E G+L+ GGGHAMAAGL+VER     L  F
Sbjct: 427 IGVDPVSGMGKGSGRSQAGVNLGEAVGAAFESGLLLSGGGHAMAAGLSVERDRIADLRRF 486

Query: 460 FQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQ 519
              + H  V         +ID  L+  A +  L D  +   P+G GNP P+ AF + ++ 
Sbjct: 487 LNDYIHTHVAEADQVETVEIDAALSLKAASRDLFDRFDLLAPFGQGNPEPLLAFTDVRVA 546

Query: 520 SIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGS 579
             + +   H++          ++AI +R  GT LG+ L++  GK +HV   L  + + G 
Sbjct: 547 FAQAMKGGHVRCELLDDSGAKVKAIIWRAEGTALGDALLRPSGK-VHVLARLKADDYMGR 605

Query: 580 KRCQLRVLD 588
           +  QL + D
Sbjct: 606 RGIQLEIED 614


>gi|144897176|emb|CAM74040.1| single-stranded-DNA-specific exonuclease RecJ [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 495

 Score =  395 bits (1015), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 208/445 (46%), Positives = 295/445 (66%), Gaps = 8/445 (1%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           D AFLGVE S++G RW S  G E +  A  ++Q+ A+P+I+ RVL  R + +D A+ FL+
Sbjct: 4   DAAFLGVERSLTGRRWQSSGGDERL--AATLSQRLALPEIIGRVLAARGIGLDEAETFLS 61

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R L+PDP  L D DKAA RI  A+   E I IFGDYDVDGA S AL+  FL+     
Sbjct: 62  PTLRALLPDPSHLKDMDKAAARIASAVMAGEPIGIFGDYDVDGATSSALLNTFLTAIGAT 121

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A ++IPDR+ +GYGPN   + K   +GA++++TVDCG+T++D L+ A   GIDVIV+DHH
Sbjct: 122 ALVHIPDRMSEGYGPNLPALLKLAAQGAKVVVTVDCGTTAFDPLEGAAEAGIDVIVVDHH 181

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNFDLL 239
           + +     A+A++NP RLDD S  GHL A GV FLV+V + R+L++           DLL
Sbjct: 182 EAEPHLPRAFAIINPKRLDDDSPHGHLAAVGVTFLVVVAVNRVLKEAGWYGPARPAPDLL 241

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LD+VAL TVCDVVPL G+NRA V +GL V  ++ N GL AL +   I     + +LGY
Sbjct: 242 QWLDVVALGTVCDVVPLWGVNRALVTQGLKVMAKRANVGLAALSDVAGIKERPDSYHLGY 301

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP +NAGGR+G+S LGSRLL + D      +A +LD  N+ R+ +E+A+L +A  +V 
Sbjct: 302 VLGPRVNAGGRVGQSALGSRLLSTHDPLLAADIARQLDGYNKERQEIEAAVLLEAIEQVE 361

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            + DD     ++V  G+ WHPG++G++A RLKE++GRP+  I+ + D +G GSGRS+ G 
Sbjct: 362 GRDDD--GLPLVVAAGENWHPGVIGIVAGRLKERYGRPACVIALDGD-EGKGSGRSVTGL 418

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAA 444
           D+G  +  A ++G+L   GGHAMAA
Sbjct: 419 DLGCAIIAARQQGLLKADGGHAMAA 443


>gi|56696609|ref|YP_166970.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria pomeroyi
           DSS-3]
 gi|56678346|gb|AAV95012.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria pomeroyi
           DSS-3]
          Length = 551

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 237/569 (41%), Positives = 338/569 (59%), Gaps = 31/569 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNS 92
           + Q+  +P  V +VL  R V    A+ FL+P ++ L+PDP  L D + AA R + A+   
Sbjct: 1   MRQQTDLPQAVCQVLARRGVPAIEARGFLDPKLKELLPDPRKLKDMEIAAARFLAAVAGR 60

Query: 93  EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQL 152
           ++I +F DYDVDG +S AL++ +L      A +Y+PDRI +GYGPN   M   +  G  L
Sbjct: 61  QRIAVFADYDVDGGSSAALLICWLREMGQTATLYVPDRIDEGYGPNEVAMAD-LARGHDL 119

Query: 153 IITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCA 211
           I+ VDCG+ S+  +  A  +G DVIV+DHH + +E +P   A+VNPNR D+    G+ CA
Sbjct: 120 IVCVDCGTLSHGPI--AAAKGADVIVLDHH-LGAETLPECVAVVNPNRQDESGDLGYFCA 176

Query: 212 AGVVFLVLVLIYRILR-QDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
           AGVVFL+LV   R LR +  + P   DL+++LDLVALATV DV PLI  NRA V +GL V
Sbjct: 177 AGVVFLMLVEAGRQLRARGQRGP---DLMAMLDLVALATVADVAPLIEANRALVRQGLKV 233

Query: 271 ARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             ++  PGL AL +   + +     +LG+++GP +NAGGRIG+++LG+RLL +D   E +
Sbjct: 234 MAQRQRPGLVALADIARMDAMPNTYHLGFLLGPRVNAGGRIGQADLGARLLSTDSMSEAQ 293

Query: 331 MLAMKLDVLNQNRRLMESAM----LEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLL 386
            LA +LD+LN  RR +E+A+    L+QAE + L       +A ++   G+ WHPG+VG++
Sbjct: 294 ALAERLDLLNTERREIEAAVRAAALDQAETRGL-------EAPLVWAAGEGWHPGVVGIV 346

Query: 387 AARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGL 446
           A+RLKE   RP+  I F+ D +G GSGRS+ G D+G  +     EG+LVKGGGH MAAGL
Sbjct: 347 ASRLKESANRPAIVIGFDGD-EGKGSGRSVAGVDLGASIQRLAAEGLLVKGGGHKMAAGL 405

Query: 447 TVERVNF----GRLCDFFQK-FAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGP 501
           TV R        RL +   K  A    PA       ++DGVL   A  + L++ +E AGP
Sbjct: 406 TVLRDRLEPAMERLSELLAKQGAGQGGPA-----DLRLDGVLMPGAATVELLEQIELAGP 460

Query: 502 YGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSR 561
           YGA  P P FA P+ +++  + V  +HL+++        L AI F  +   +G  L    
Sbjct: 461 YGASAPAPRFALPDLQIRFAKRVGASHLKLSLADGMGGGLDAILFGAFDGEIGPILENHG 520

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           G R H  G L +N W G +  QLRV D +
Sbjct: 521 GARFHFAGRLEINSWGGRQSVQLRVDDVA 549


>gi|85373913|ref|YP_457975.1| single-stranded DNA-specific exonuclease [Erythrobacter litoralis
           HTCC2594]
 gi|84786996|gb|ABC63178.1| single-stranded DNA-specific exonuclease [Erythrobacter litoralis
           HTCC2594]
          Length = 587

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 241/596 (40%), Positives = 340/596 (57%), Gaps = 27/596 (4%)

Query: 8   GVECSISG--FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           GV  S+SG  +RW       G N  L         DIV ++L++R V  D  +    P++
Sbjct: 3   GVSQSLSGKAWRW------RGGNMELGDGAIGLEDDIVTQLLLSRGVERDDLERHRAPTL 56

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           +  +PDP +  D D AA RI QAI   E I I+GDYDVDGA S AL++R +      A  
Sbjct: 57  KAFLPDPSVFQDMDNAAERIAQAILAHETITIYGDYDVDGATSSALLIRLIRMLGHEAGH 116

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDR+++GYGP+   + K    G+ LI+TVDCG+ +++AL  A + G+DVIV+DHH+  
Sbjct: 117 YIPDRLLEGYGPSGEALVKLGESGSSLIVTVDCGAMAHEALSMARDAGVDVIVVDHHKCP 176

Query: 186 SEEIPAYALVNPNRLDD---LSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFD 237
            +  P  ALVNPNRLD+    +  GHL A GV FL+ + + R LR+     D   P   D
Sbjct: 177 PDLPPTVALVNPNRLDESDLAASHGHLAAVGVAFLLAIALVRTLRERGYFDDRPEP---D 233

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           L  LLDLVAL TV DV  L GLNRA+V +GL V  ++   G+ ALI+   +       +L
Sbjct: 234 LRGLLDLVALGTVADVASLHGLNRAFVAQGLKVMAKRNTTGMSALIDASRLKRAPACSDL 293

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAK 357
           G+ +GP INAGGR+GES LG RLL ++D  E   +A +L  LN+ RR +ES + E AE +
Sbjct: 294 GFALGPRINAGGRVGESTLGVRLLTTEDPDEAREIAEQLSRLNEERRAIESEVQEAAEEQ 353

Query: 358 VLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSI 416
           +  Q       +V VV G  WHPG++G++A R+KEK G+PS  I+ + E  +G GSGRSI
Sbjct: 354 LAAQ----HNRAVHVVAGHGWHPGVIGIVAGRIKEKTGKPSLVIALDGESAQGKGSGRSI 409

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPV 476
            G D+G  +  A E  +LV GGGHAMAAGLTV+      L D+ +      V   +    
Sbjct: 410 AGVDLGAAIIAARENDLLVAGGGHAMAAGLTVDADKVEALADWLEARLEGPVGRAMAEKA 469

Query: 477 FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAF-PNHKLQSIRVVNLAHLQMTFES 535
             +D  +    +   L+  L+ AGPYG G P P  A  P H +++  +V   HL++   S
Sbjct: 470 MTLDLAVGPRGLTPELVHSLDRAGPYGVGWPGPRVAVGPVHVIKA-DIVGNDHLRLIAGS 528

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +  +L+AIAFR   T  G+ L+ S RG+R+ + G   ++ W      +L + DA+
Sbjct: 529 VEGGSLKAIAFRAASTDWGQALLHSARGRRLWLAGRARIDDWGARPAAELHLEDAA 584


>gi|157803729|ref|YP_001492278.1| transcription termination factor Rho [Rickettsia canadensis str.
           McKiel]
 gi|157784992|gb|ABV73493.1| transcription termination factor Rho [Rickettsia canadensis str.
           McKiel]
          Length = 585

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 225/586 (38%), Positives = 338/586 (57%), Gaps = 17/586 (2%)

Query: 11  CSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMP 70
            SI+G  W   +  E I   + + +   I D++AR++  R  ++   ++FL P I+ L+P
Sbjct: 5   ASINGKIWQQKVINEDI--VMELCRSFKISDLLARIVSLRVNNLAEVENFLIPKIKNLLP 62

Query: 71  DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
           DP  L D  KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y+PDR
Sbjct: 63  DPFHLLDMAKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNIFRDLNIICDIYVPDR 122

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           I +GYGP P  ++K  +   +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +P
Sbjct: 123 IAEGYGPTPFAIQKIKDNSTELLITVDCGTMAHEALKYAKDISLDVIVIDHH-IATEILP 181

Query: 191 -AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLVA 246
            A A++NPNR+D+ S   HL A GV FL    I   L+Q N   K P   +L++ LDLVA
Sbjct: 182 DAVAIINPNRIDEKSEYKHLAAVGVAFLFATAILSNLKQQNYFTKSP-QPNLINYLDLVA 240

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD+V L G+NRA+V  GL V +++ N G+K L + V ++      +LG+++GP IN
Sbjct: 241 LGTVCDMVKLTGINRAFVASGLKVMQQRQNIGIKTLYDIVGLNEIPKCYHLGFILGPRIN 300

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+L+E  M+E+A     TQ    Q
Sbjct: 301 AGGRVGKSSLGANLLSTSCSNEASKLAEELEKHNNERKLIELLMIEEAMEIAWTQ----Q 356

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A RLKEKF +P   ++   DG G  S RSI G D G  + 
Sbjct: 357 DSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVVAL-NDGIGKASCRSITGIDFGAEII 415

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A   G+L+ GGGH MAAG TV       L +F        +  L      + D  L+ +
Sbjct: 416 NAKNHGLLIAGGGHTMAAGFTVTAEKLQELQEFLNNAFRTSINKLENYKQVEYDLDLSLN 475

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF----ESQDSETLQ 542
           ++N+ L++ L S  P+G GN  P+F F N  +    +V   H++       +   S+ L 
Sbjct: 476 SINLHLMEELSSIEPFGQGNHEPIFKFDNLFVLKAYIVGSKHIKALLVHNTQGSGSKALS 535

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AIAF   GT   E L+  + K +   G L  + W+ +   QL + D
Sbjct: 536 AIAFNSVGTAFEEVLLSPKAKNIAAIGTLRTSNWQDNYTIQLIIKD 581


>gi|15604385|ref|NP_220901.1| single-stranded-DNA-specific exonuclease RECJ (recJ) [Rickettsia
           prowazekii str. Madrid E]
 gi|3861077|emb|CAA14977.1| SINGLE-STRANDED-DNA-SPECIFIC EXONUCLEASE RECJ (recJ) [Rickettsia
           prowazekii]
 gi|292572140|gb|ADE30055.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           prowazekii Rp22]
          Length = 586

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/587 (38%), Positives = 338/587 (57%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W     +E I   L  + K  I D +AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QISINGKIWKQKPIKEDIVTELCRSFK--ISDFLARIVSLRVNNLEEVENFLIPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D DKA  RI+QAI NS++I IF DYDVDGA S AL+  FL   ++  ++Y+PD
Sbjct: 62  PDPFHLLDMDKAVDRIIQAIVNSQQICIFADYDVDGATSAALLKHFLRDLNIICDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K    G +L+ITVDCG+ ++DAL+YA +  +DVIVIDHH + +E +
Sbjct: 122 RIYEGYGPTPLAMQKIKGNGTELLITVDCGAMAHDALKYAKDVKLDVIVIDHH-ISTEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF---DLLSLLDLV 245
           P A A+VNPNR+D+ S   +L A GV FL    I   L++ N    +    +L+  LDLV
Sbjct: 181 PDAVAIVNPNRIDETSEYKYLAAVGVTFLFATAILSNLKKRNYFSQSIPTPNLMKYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP I
Sbjct: 241 ALGTVCDMMKLTGLNRAFVTAGLKVMQQRQNIGIKTLYDIAGLDEIPQCYHLGFILGPRI 300

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+SNLG+ LL ++   E   LA +L+  N  R+++E  M+ +A    LTQ D  
Sbjct: 301 NAGGRVGKSNLGANLLATNCHNEANKLANELEKHNNERKVIELLMINEAIDIALTQKD-- 358

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
             +S++ V  + WHPG++G++A +LKEKF +P   ++   +G G  S RSI G D    +
Sbjct: 359 --SSLLFVVKEGWHPGVIGIVAGKLKEKFDKPVVVVAL-NNGIGKASCRSILGIDFSAEI 415

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +++ GGGHAMAAG T        L DF        +  L +    + D  L  
Sbjct: 416 INAKSKDLIISGGGHAMAAGFTATASKLQELQDFLNDAFSISINKLASYKHAEYDIDLTV 475

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           + VN  L++ L++  P+G GN  P+F F +  +    +V   H++           ++ L
Sbjct: 476 NGVNFRLMEELKTLEPFGPGNYEPIFKFDDLFILKADIVGSKHIKCMLAPDKQYFGNKAL 535

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AI F   GTP  + L+ SR + +   G L +N W+ +   QL + D
Sbjct: 536 SAIVFDAVGTPFEDILLSSRARHISAIGTLKMNNWKYNYTIQLIIKD 582


>gi|332187561|ref|ZP_08389298.1| single-stranded-DNA-specific exonuclease RecJ [Sphingomonas sp.
           S17]
 gi|332012490|gb|EGI54558.1| single-stranded-DNA-specific exonuclease RecJ [Sphingomonas sp.
           S17]
          Length = 584

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 239/581 (41%), Positives = 334/581 (57%), Gaps = 19/581 (3%)

Query: 20  SLLGQEGINRALAITQKHAI--PDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTD 77
           S+LGQ    RAL+   +  +   D+V ++L+ R    +  +D   PSIR  MPDP I  D
Sbjct: 10  SILGQPWRWRALSADARDGLVHDDLVTQLLLARGCPPEAVEDHKQPSIRSFMPDPSIFRD 69

Query: 78  CDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGP 137
            D+AA R+  A+   E + IFGDYDVDGA S ALM+R L    ++   YIPDR+ +GYGP
Sbjct: 70  MDRAADRLADAVIAGEPVAIFGDYDVDGATSSALMVRLLRSLGLSPRAYIPDRLAEGYGP 129

Query: 138 NPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNP 197
             + + +   EGA LI+TVDCG+ +++ L  A   GI+V+V+DHH+  +    A+A+VNP
Sbjct: 130 TEAALLRLQAEGANLIVTVDCGAQAFEPLAAAHAAGIEVMVVDHHKCATLLPLAHAVVNP 189

Query: 198 NRLDDLSG--QGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATV 250
           NRLD+  G   GHL A GV FL+   + R LRQ     D   P       LLDLVAL TV
Sbjct: 190 NRLDEDEGAAHGHLAAVGVCFLLGAALIRTLRQRGFFADRPEPRLL---DLLDLVALGTV 246

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
            DV PL GLNRA+V +GL V  ++ N GL +L E   ++   T  +LG+ +GP INAGGR
Sbjct: 247 ADVAPLRGLNRAFVAQGLKVMAQRRNIGLASLTEAARLTRAPTCSDLGFALGPRINAGGR 306

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G ++LG RLL ++D  E   +A +L+  N  RR +E+ +   AE    T  D  +Q  V
Sbjct: 307 VGRADLGVRLLTTEDPAEARAIAEELNHFNDERRAIEAGVQATAE----TIVDRGRQ--V 360

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
            +V G  WHPG++G++A RLKEK  RP+  I+ +E+G G GSGRSI G D+G  +  A E
Sbjct: 361 ALVSGTGWHPGVIGIVAGRLKEKLDRPAIVIAIDENGIGKGSGRSITGVDLGAAILAAKE 420

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
            G+L+ GGGHAMAAGLTV       L DF +      V          +D VL    VN 
Sbjct: 421 HGLLIAGGGHAMAAGLTVAANRISELADFLEDRLAQAVTRASAGRALLVDAVLAPGGVNP 480

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYG 550
           AL+  +E+ GPYG G P P  A    ++    +V   H++      D  +L+A+AFR   
Sbjct: 481 ALVGSMEAGGPYGMGWPAPRIAAGPFRVIRADLVGTNHVRAIIAGADGRSLKAMAFRHAE 540

Query: 551 TPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           TPLG+ L+ +   +R+ + G   V+ W G    +L + DA+
Sbjct: 541 TPLGQALLGAGSTRRLWLAGRAKVDDWSGRDVAELHIEDAA 581


>gi|315499810|ref|YP_004088613.1| single-stranded-DNA-specific exonuclease recj [Asticcacaulis
           excentricus CB 48]
 gi|315417822|gb|ADU14462.1| single-stranded-DNA-specific exonuclease RecJ [Asticcacaulis
           excentricus CB 48]
          Length = 622

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 228/604 (37%), Positives = 337/604 (55%), Gaps = 25/604 (4%)

Query: 6   FLGVECSISGFRWVSLLGQE--GINRALAITQK--------HAIPDIVARVLVNRNVSID 55
           FLGVE S++G  WV     +  G +    ITQ+         A  + VAR +  R V+  
Sbjct: 16  FLGVETSVTGRLWVDRRDSQRVGAHELRQITQQIALKGPMEEAFVEPVARSIAARGVTAA 75

Query: 56  YAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRF 115
              D+L P+++ L PDP    D  +A   I+ A+   +KI +F DYDVDGA S A ++R+
Sbjct: 76  TLDDYLRPTLKALFPDPDGFMDMPQAVAAILDALQARQKIYVFADYDVDGATSAAQLVRW 135

Query: 116 LSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGID 175
             H     ++Y+PDR+++GYGP+    ++   EGA L+ITVDCG++++ AL YA   G++
Sbjct: 136 FRHMGHELSVYVPDRMLEGYGPSEKAFDRLKAEGADLVITVDCGASAHRALDYAARIGLE 195

Query: 176 VIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLI-----YRILRQDN 230
           V+VIDHH ++ +     A+VNPNR    S QG+L AAGVVF+VL  +      R L  + 
Sbjct: 196 VVVIDHHIMREDPPKCRAVVNPNRPGCTSAQGNLAAAGVVFVVLAALNREAETRGLFAER 255

Query: 231 KVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALI-----ER 285
             P   DL   LDL AL  +CDV  L G NRA   +GL V  R  NPG++AL+     E 
Sbjct: 256 PRP---DLTQWLDLAALGAICDVTALSGFNRALASQGLKVMSRLNNPGIRALMQVAGGEP 312

Query: 286 VNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRL 345
            + ++ +   + G+++GP INAGGRIG ++LG RLL +DD+ E   LA +LD LN+ RR 
Sbjct: 313 KDAATALGVFHSGFVLGPRINAGGRIGRADLGVRLLSTDDADEAAALAQELDELNKTRRD 372

Query: 346 MESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE 405
           +E+A+ EQA A   T+     +  VI+V  + WHPG++G++A RL+E++ +P   I  + 
Sbjct: 373 VEAAVQEQALALAETKGLVTAEDHVIIVAHEDWHPGVIGIVAGRLRERWHKPVIVIGIDP 432

Query: 406 -DGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFA 464
             G G GSGRS  G ++G+ V+ A E G+L+ GGGHAMAAGL++E      L  F     
Sbjct: 433 VTGIGKGSGRSQAGINLGQAVTAAFESGLLLSGGGHAMAAGLSIEAARIPELRTFLNSHI 492

Query: 465 HNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV 524
            N           +ID  L+A A    L++  E   P+G GNP P+F  P  ++     +
Sbjct: 493 ANATVEADRKDRLEIDAALSAGACTRVLLECFEIMAPFGPGNPEPMFVLPGMRVGYASAL 552

Query: 525 NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
              H++     +  + L+AIA+R   T +G  L+   G  +HV G L  + + G K  Q 
Sbjct: 553 KGGHVRCDLIDEGGKRLKAIAWRAQDTAVGAALLNPVGA-IHVAGRLKPDDYMGRKGVQF 611

Query: 585 RVLD 588
            + D
Sbjct: 612 EIED 615


>gi|167646973|ref|YP_001684636.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter sp. K31]
 gi|167349403|gb|ABZ72138.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter sp. K31]
          Length = 605

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 229/590 (38%), Positives = 344/590 (58%), Gaps = 10/590 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V  S+SG  W    G   + R+    Q H + + +AR L +R V +D A+ +L P++
Sbjct: 14  FLDVSRSLSGRAWRERPGDAAVARSH--QQLHGLSEPLARALASRGVGVDDAEHYLRPTL 71

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           + L PDP   TD D+AA  ++ A+ +    M+F DYDVDGA S A ++R+  +  V   +
Sbjct: 72  KALFPDPSSFTDMDRAAEILIDALESGRSTMVFADYDVDGATSAAQLVRWFRYMGVELPI 131

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDR+ +GYGP+P+  +   + GA L++T+DCG+ +YDA+  A   G++V+VIDHH ++
Sbjct: 132 YIPDRLTEGYGPSPAAFKTIRDTGADLVVTLDCGAAAYDAIASAATIGLEVVVIDHHLMR 191

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLSL 241
            +   A A+VNPNR    SGQG L AAGV F++L  + R  R+     ++ P   DL   
Sbjct: 192 EDPPAAAAVVNPNRPGCQSGQGVLAAAGVTFVLLAALNREARRRGLFTDERP-QPDLRQW 250

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVA+  VCDV  L+G NRA    GL      GNPGLKAL E    S P +  + G+++
Sbjct: 251 LDLVAMGEVCDVTQLVGFNRALTTLGLRTMSSWGNPGLKALFEVGKGSGPASVFHAGFIL 310

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG S+LG+RLL +DD +E  MLA +LD LN  R+ +E+ ++E+A A +   
Sbjct: 311 GPRINAGGRIGRSDLGARLLSTDDPEEARMLAEELDGLNTERKAVEAGVVEEAAAVLERG 370

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFD 420
            +    A VIVV G+ WHPG++G++A RL+E++ +P   I  +     G GSGRS  G +
Sbjct: 371 SNFNPDAPVIVVAGEGWHPGVIGIVAGRLRERYRKPVVVIGIDRAANVGKGSGRSQPGVN 430

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  +  A E G+L+ GGGHAMAAGL++   +      F ++     + A+    V  ID
Sbjct: 431 LGAAIQAAFEAGLLMAGGGHAMAAGLSIRPDSIPEFRAFLEERLAGEMEAVGVEGV-DID 489

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
            ++   A N AL    +   P+G GNP P+FA    + + +  +   H+++       + 
Sbjct: 490 ALVQPRAANRALWTEFQQLAPFGPGNPEPMFALAGVRPERMMAMKGGHVRVDLVGPSGDR 549

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           ++AI++R   TPLG+ LM   G  +HV G L  + + G +  QL + DA+
Sbjct: 550 IKAISWRSVETPLGQRLMAG-GGALHVVGRLKPDDYMGREGVQLEIEDAA 598


>gi|262277190|ref|ZP_06054983.1| single-stranded-DNA-specific exonuclease RecJ [alpha
           proteobacterium HIMB114]
 gi|262224293|gb|EEY74752.1| single-stranded-DNA-specific exonuclease RecJ [alpha
           proteobacterium HIMB114]
          Length = 580

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 216/586 (36%), Positives = 347/586 (59%), Gaps = 24/586 (4%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           S+ G  WV  L     N A  I++++ +  + +R+L NRN++    ++FLNP I+  +P+
Sbjct: 5   SVQGKEWV--LKDFDKNLAEYISKEYNLDFLTSRLLANRNINQKNIENFLNPKIKNFLPN 62

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P    D  K    I + I N  KI IFGDYDVDGA S  +M ++L   +++  ++IPDR 
Sbjct: 63  PYNFKDMGKGLEIISRHIKNKNKICIFGDYDVDGATSSGIMSKYLEQLNIDHFVFIPDRQ 122

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            DGYGP+       IN+   LII +DCG+TS++A++YA ++ IDV+VIDHH+ +     A
Sbjct: 123 KDGYGPSVKTFTNIINKNVNLIIALDCGTTSFEAIEYARSKNIDVVVIDHHKSQETFPAA 182

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNF-DLLSLLDLVAL 247
            A++NPNR+D+     +LCAAGV+F+ LV + +ILR++   NK  +   +LL LLDLV +
Sbjct: 183 NAIINPNRIDETGDYYYLCAAGVLFIFLVGLNKILRENYYFNKAKVQEPNLLDLLDLVMM 242

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCDVVPL+ LNRA+V +GL VA ++ N GLK L++   I   ++   +GY++GP INA
Sbjct: 243 GTVCDVVPLMDLNRAFVHQGLKVASKRHNLGLKTLVDYSKIKKKLSTYEVGYVLGPKINA 302

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGRIG+S LG  LL +++++   +++ +L+ LN  R+ +E  ++E+A    ++  +    
Sbjct: 303 GGRIGKSELGYNLLTTNNAETAYLISSELESLNLKRKDIEKKIVEEA----ISISERNND 358

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVS 426
             ++ +  + WH G++G++A+RLK+ F +PSF IS + ED K  GS RSI GFD+G  ++
Sbjct: 359 EPIVFLSKNDWHEGLIGIVASRLKDHFNKPSFIISQKGEDCK--GSARSIFGFDVGMAIT 416

Query: 427 FAVEEGILVKGGGHAMAAGLTVE----RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
              +  I+ KGGGH MA G +++     +    L + F K   N         + +ID  
Sbjct: 417 KCKQLNIITKGGGHPMAGGFSLKSDKLEIFKNELINLFLKLKKN-----KDNNIIEIDSY 471

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L +SA+N  LI+ L    PYG+GN  P+F F   K+  +      H+++   ++ +  + 
Sbjct: 472 LESSAINDELIEKLNHLEPYGSGNREPIFGFEKFKVSKVIETKNNHVKVVL-NKGNFYID 530

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AI+F      LG +LM  + K  ++   + +N W G  + +L + D
Sbjct: 531 AISFNSKNKDLGNYLMNFK-KEFNLVAKIKLNEWNGKSKIELIIDD 575


>gi|114328064|ref|YP_745221.1| single-stranded-DNA-specific exonuclease recJ [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316238|gb|ABI62298.1| single-stranded-DNA-specific exonuclease recJ [Granulibacter
           bethesdensis CGDNIH1]
          Length = 616

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 230/605 (38%), Positives = 334/605 (55%), Gaps = 29/605 (4%)

Query: 5   AFLGVECSISGFRWVSLLGQ----EGINR-ALAITQKHAIPDIVARVLVNRNVSIDYAKD 59
           A LGVE S++G  W   +        I R  LAI+Q+H + D++ R++  R + ID A  
Sbjct: 20  AVLGVERSLTGRAWYWRMPAGADIAAIERLGLAISQRHGVSDLLGRLIATRGIGIDQADT 79

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FL P++R LMPDP +L   D+AA RI  AI   E I IFGDYDVDGA    LM+  L  C
Sbjct: 80  FLQPTLRALMPDPSVLAGMDQAAARIAAAITARETIAIFGDYDVDGACGTTLMLTVLRAC 139

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
                 +IPDR+ +GYGPN   +      GA LII VDCG+ +  AL   + +  D++V+
Sbjct: 140 GCPVLYHIPDRLREGYGPNAPALLSLAERGASLIICVDCGTAAQTALSAVSGRA-DILVL 198

Query: 180 DHHQVKSEEIP--AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR----QDNKVP 233
           DHH  KS+ +P  A A VNPN  DD SG   LCA GV  L  V  +R LR    Q ++ P
Sbjct: 199 DHH--KSDTLPPAALATVNPNGPDDRSGLTMLCATGVALLTCVATFRQLRLNGWQGHEGP 256

Query: 234 LNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPIT 293
              DLL +LDLVALATVCDV+PL G+NRA+V +GL V  R+   G+ AL+E   ++  +T
Sbjct: 257 -PPDLLEMLDLVALATVCDVMPLTGINRAFVTQGLKVMDRRNRIGIAALLEVAQMTGRVT 315

Query: 294 AENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQ 353
           A   G+++GP INA GRI  +++G RLL + D      +A  LD +N  R+ +ES++L+ 
Sbjct: 316 ASTCGFVLGPRINAAGRIDSADMGVRLLTATDPIAARDIAQALDSVNGRRQTVESSILDA 375

Query: 354 A--EAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIG 411
           A  EA+   +  D    + IV+ G+ WHPG+VG++A RL+E+F RP+  ++   DG   G
Sbjct: 376 AVREAEARIEAGD----AAIVIGGEDWHPGVVGIIAGRLRERFNRPA-CVAGSADGLLKG 430

Query: 412 SGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL 471
           SGRS+ G D+G  +  A + G+L  GGGHAMAAG  +   +      F  +        L
Sbjct: 431 SGRSVPGIDLGAAIIAAHQHGLLRSGGGHAMAAGFALPPESMPAFRTFMNERLAAAA-LL 489

Query: 472 ITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHL 529
                  +D  L A AV +A+ + L    P+G GN  P+   P  + +    +  +   +
Sbjct: 490 PKAADLALDASLGAGAVTVAMAEELAQLAPFGNGNDEPLLVLPRLRCRRAERIGRDGGTI 549

Query: 530 QMTFESQDSETLQAIAFRV----YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLR 585
           +   ES+   T++A+ FR        P+ + L+    + +H+ G+L    W G+      
Sbjct: 550 RAFLESESGYTIKALLFRAKPEDMAAPIADILLNRELRPLHLAGYLRAETWNGTTSANFC 609

Query: 586 VLDAS 590
           + DA+
Sbjct: 610 ISDAA 614


>gi|103488491|ref|YP_618052.1| single-stranded-DNA-specific exonuclease RecJ [Sphingopyxis
           alaskensis RB2256]
 gi|98978568|gb|ABF54719.1| single-stranded-DNA-specific exonuclease RecJ [Sphingopyxis
           alaskensis RB2256]
          Length = 588

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 241/596 (40%), Positives = 340/596 (57%), Gaps = 22/596 (3%)

Query: 4   QAFLGVECSISG--FRWVSLLGQEGINRALA--ITQKHAIPDIVARVLVNRNVSIDYAKD 59
           +A LG+ CSI+G  +RW          RA A    +  A  D+V ++L+ R V+ D    
Sbjct: 3   EAALGITCSIAGQSWRW---------RRASADMAAENLAPDDLVTQLLLARGVARDDLDR 53

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
              P++R  MPDP +  D D AA R+  A+   E + IFGDYDVDGA S AL++R L   
Sbjct: 54  QRTPTLRGFMPDPSLFRDMDAAAARLADAVERREAVTIFGDYDVDGATSAALLVRLLRAL 113

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
                 YIPDR+++GYGP+ + + K    G++LI+TVDCG+ +++A+  A   G++VIV+
Sbjct: 114 GTTVGAYIPDRLMEGYGPSGAALVKIGEAGSKLIVTVDCGAQAFEAIAEANAAGVEVIVV 173

Query: 180 DHHQVKSEEIPAYALVNPNRLD---DLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF 236
           DHHQ  +    A ALVNPNRLD   D +  G+L A GV FL+   + R LR         
Sbjct: 174 DHHQCATSLPAALALVNPNRLDESPDAAVHGNLAAVGVAFLLGAALLRTLRARGFFAGRE 233

Query: 237 D--LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITA 294
           +  L+ LLDLVAL TV DV  L G NRA V +GL V  R+GN GL AL++   ++ P  A
Sbjct: 234 EPALIELLDLVALGTVADVARLTGFNRALVTQGLKVMARRGNIGLAALMDAARLTRPPGA 293

Query: 295 ENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQA 354
            ++G+ +GP INAGGR+G+S+LG RLL +DD QE   +A +L  LN+ RR +E+A+L++A
Sbjct: 294 SDMGFALGPRINAGGRVGKSDLGVRLLTTDDPQEAADIAQQLCRLNEERRTIEAAVLDEA 353

Query: 355 EAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGR 414
               L        A V +V G+ WHPG++G++A RLKE+  RP+  I+ + DG G GSGR
Sbjct: 354 ----LAASAACGNAPVAIVAGEGWHPGVIGIVAGRLKERLHRPAIVIAVDADGIGKGSGR 409

Query: 415 SIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITT 474
           SI G D+G  +  A E G+LV GGGHAMAAGLTV       L  F        V      
Sbjct: 410 SISGVDLGAAILAAKETGLLVAGGGHAMAAGLTVAADRVDALGAFLSDRLAADVERASGE 469

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
               ID VL    ++    D +ESAGPYGAG P P  A    ++    +V   H+++   
Sbjct: 470 RALLIDAVLAPRGISPLWCDAIESAGPYGAGWPAPRVATGPVRIVESGIVGTDHVRLIVA 529

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             D    +A+AFR   T LG+ L+ +RG+++ + G    + W      +L + DA+
Sbjct: 530 GDDGARFKAVAFRSAETVLGQTLLGARGRKLWLAGRAKRDDWGSRPAAELHLEDAA 585


>gi|94497632|ref|ZP_01304200.1| single-stranded DNA-specific exonuclease [Sphingomonas sp. SKA58]
 gi|94422849|gb|EAT07882.1| single-stranded DNA-specific exonuclease [Sphingomonas sp. SKA58]
          Length = 588

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 229/556 (41%), Positives = 328/556 (58%), Gaps = 10/556 (1%)

Query: 41  DIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           D+V ++L+ R  + D      NP+IR  MPDP +  D D AA R+  A+   E + IFGD
Sbjct: 34  DLVTQLLLARGCTRDGLDAHRNPTIRGFMPDPSLFRDMDVAAERLADAVQRQEDVRIFGD 93

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDGA S AL++R L    ++A  YIPDR+++GYGP+   + +   EGA LI+TVDCG+
Sbjct: 94  YDVDGATSAALLIRLLRDLGLHARPYIPDRLMEGYGPSGEALVRLAGEGASLIVTVDCGA 153

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLD---DLSGQGHLCAAGVVFL 217
            +++AL  A   G+DV+V+DHH+  S+   A+ALVNPNRLD   + +  GHL A GV FL
Sbjct: 154 QAFEALSMAKASGVDVVVVDHHKCASQLPEAFALVNPNRLDEHPEAALHGHLAAVGVAFL 213

Query: 218 VLVLIYRIL--RQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQG 275
           +   + + L  R         ++L LLD+VAL TV DV  L GLNRA+V +GL V  ++ 
Sbjct: 214 LGARLLKTLDARGWFASRQKPNILDLLDIVALGTVADVAQLKGLNRAFVAQGLKVMSKRR 273

Query: 276 NPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMK 335
           N GL ALI+   ++      +LG+ +GP INAGGR+G+++LG RLL ++D  E   +A +
Sbjct: 274 NIGLSALIDASRLTRAPLCHDLGFALGPRINAGGRVGQADLGVRLLTTEDPAEAARIAAQ 333

Query: 336 LDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFG 395
           LD  N+ RR +ES + EQAEA +  Q +     +V V+ G  WHPG++G++A R+KEK G
Sbjct: 334 LDQYNEERRAIESTVQEQAEALLAAQGNR----AVAVIAGAGWHPGVIGIVAGRIKEKAG 389

Query: 396 RPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           RP+  I+ ++ G G GSGRSI G D+G  V  A + G+LV GGGHAMAAGLTV       
Sbjct: 390 RPAIVIALDDAGVGKGSGRSISGVDLGAAVLAAKDSGLLVAGGGHAMAAGLTVAADRIDA 449

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
           L D+  +     V          ID VL  + VN   +  L+  GPYGAG P P+ A   
Sbjct: 450 LADYLDERLSAAVAKARDDRALLIDAVLAPTGVNPDFVAALDQGGPYGAGWPAPLIAAGP 509

Query: 516 HKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVN 574
            ++    VV   HL+      D  +++ IAFR   T LG+ ++ + R +R+ V G   ++
Sbjct: 510 MRVIKADVVGNGHLRAIMAGDDGRSIKTIAFRRAETDLGQAILAAPRDRRLWVAGKAKID 569

Query: 575 YWRGSKRCQLRVLDAS 590
            W      +L + DA+
Sbjct: 570 DWGSRPAAELHLEDAA 585


>gi|209544632|ref|YP_002276861.1| single-stranded-DNA-specific exonuclease RecJ [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532309|gb|ACI52246.1| single-stranded-DNA-specific exonuclease RecJ [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 619

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 224/594 (37%), Positives = 320/594 (53%), Gaps = 16/594 (2%)

Query: 7   LGVECSISGFRWV---SLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           LGV  S+ G RW+    +L   G    L I Q+  + DIV ++L  R +    A  FL+P
Sbjct: 29  LGVAASLGGRRWLWRDPVLADAGGRVGLMIAQQAGVSDIVGQMLAARGLDGRSAATFLDP 88

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP  L D D AA R+  A+   E + +FGDYDVDGA + AL+ + L       
Sbjct: 89  TLRALMPDPSALRDMDPAAERLADAVRRGETVAVFGDYDVDGACAAALVTQLLRDLGCPV 148

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
             ++PDR+ +GYGPN   +E     GA L++ VDCG+ + D L     +  D+IV+DHH+
Sbjct: 149 LTHVPDRMTEGYGPNAPALEALAARGATLVVCVDCGTAAGDILAGLAGRA-DIIVLDHHK 207

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLSL 241
            +    P  A VNPNRLD  SGQ  LCAAGV FL  V   R LR+          DL++ 
Sbjct: 208 AEGPPPPVLATVNPNRLDCTSGQRGLCAAGVAFLAAVATVRTLRRAGWFAARPEPDLMAF 267

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LD+VALATVCDV+PL  LNRA V +GL +  R+   GL AL+E      P++A   G+ +
Sbjct: 268 LDIVALATVCDVMPLTDLNRALVTQGLKILARRQRTGLDALLEVAGARDPLSAFTCGFAL 327

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRI ES LG  LL+ DD+ E   LA +LD +N+ R+ +E+ +L++A  +  +Q
Sbjct: 328 GPRINAGGRIAESGLGLDLLLCDDAAEARRLAERLDAVNRRRQTVETTILDRAMDEAASQ 387

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                   V+++ G  WHPG+VG++A R+KE+F RP    +  EDG   GS RS+   D+
Sbjct: 388 --RAAGRGVLLLSGRDWHPGVVGIVAGRIKERFNRPVLVGAELEDGTVKGSSRSVADLDL 445

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G  +  A + G+L  GGGHAMAAG ++ R     L DF +            T V  I+G
Sbjct: 446 GAAIIAARQAGLLTTGGGHAMAAGFSLPREGVPALHDFLEARLAGATALPDATDVL-IEG 504

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAH----LQMTFESQ- 536
           V++ +     L   +    P+GAGN  P+ A P  +++ +R   +      L++  E + 
Sbjct: 505 VVHVAGATTELATDIGRLAPFGAGNDEPILAIP--RVRVVRADRIGREGNTLRVLVEGEG 562

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
               L+A+ FR    P    L       +H+ G L    W G       + DA+
Sbjct: 563 GGPRLKALLFRADDHPATPILEDRNAPPLHLAGWLRAESWNGRVSAGFFIRDAA 616


>gi|240142185|ref|YP_002966695.1| Single-stranded-DNA-specific exonuclease protein [Methylobacterium
           extorquens AM1]
 gi|240012129|gb|ACS43354.1| Single-stranded-DNA-specific exonuclease protein [Methylobacterium
           extorquens AM1]
          Length = 614

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 227/586 (38%), Positives = 320/586 (54%), Gaps = 28/586 (4%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           E S+ G RW        +    A    H    +  ++ + R V+    + F  P +R  M
Sbjct: 45  ETSLRGNRW-------SVPNEFAGVDPHDPLFLPKQIALMRGVAPSALETFFKPMLRTSM 97

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN-ANMYIP 128
           PDP  L D D A  RI +A+   E + + GDYDVDGA S A+M+R+L     + A  YIP
Sbjct: 98  PDPSSLADMDAATARIAEAVRRGETVGLLGDYDVDGATSTAIMLRWLGSAGHDKAVYYIP 157

Query: 129 DRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ-VKSE 187
           DRI +GYGPNP  ++     GA L++ +D G+ ++  + +A  +G+DV+V+DHH+  ++ 
Sbjct: 158 DRIREGYGPNPGAVDAIAEAGATLLLVLDSGTLAHGPIAHARARGMDVVVVDHHEPSRTL 217

Query: 188 EIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLSLLD 243
            +P   LVNP R DD SGQ +LC AG+ FL+ V + R+LR     D       D + LL 
Sbjct: 218 PLPDAILVNPKRPDDASGQTNLCTAGLAFLLAVSLNRLLRAEGYFDQAGIAPPDPMDLLG 277

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           L AL TV DVVPL GLNRA VV+GL    R  NPG++AL+E        T    G++ GP
Sbjct: 278 LAALGTVADVVPLTGLNRAIVVQGLPKLDR--NPGIRALVEETG-EGEFTPRTAGFVFGP 334

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INA GRI ++ LG+ LL SDD  E   LA  L  +N  R+ M+  M+E A A+ L+   
Sbjct: 335 CINAAGRIDDTRLGTLLLASDDPGETRDLARHLREINAQRQAMQKEMVEAAVARALSA-- 392

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           +     VIV+E   WHPGIVGL+AAR++E   +P+  +   E GK  GS RS++GFD+G 
Sbjct: 393 EFADDPVIVIEDRAWHPGIVGLVAARVREATDKPAVVVG--EFGK--GSCRSVDGFDMGT 448

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +  A E+GIL+ GGGH MAAGLT+E      L  F    A +        P  ++D V 
Sbjct: 449 AIIRAREQGILIAGGGHRMAAGLTIEAGRLEELRRFVCGAAFD-----FERPPTEVDVVA 503

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            A   ++  I  LE+  PYGAGN  P  A      + +R++   HL++  E     T +A
Sbjct: 504 EAGTASVEAIAPLEALAPYGAGNQQPAVAVVGGIARRVRILKERHLKLMLEGPSGST-EA 562

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           I F   GT LG+ L  S G  + V G + V+ +    R Q+++ DA
Sbjct: 563 ILFNAVGTRLGDALAASEGLPVDVLGRMAVDEFNAQARVQIKIDDA 608


>gi|16125635|ref|NP_420199.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter
           crescentus CB15]
 gi|221234387|ref|YP_002516823.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter
           crescentus NA1000]
 gi|13422741|gb|AAK23367.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter
           crescentus CB15]
 gi|220963559|gb|ACL94915.1| single-stranded-DNA-specific exonuclease recJ [Caulobacter
           crescentus NA1000]
          Length = 606

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 230/596 (38%), Positives = 346/596 (58%), Gaps = 14/596 (2%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           ++  AFLGVE S+SG  W        + R   I Q+H + + +A+ LV+R V++++A+ +
Sbjct: 9   ISSSAFLGVERSLSGRAWRERPADLAVVRE--IQQRHGLIEPLAKALVSRGVTLEHAEHY 66

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L P+++ L PDP + TD D+AA  ++ A+      M+F DYDVDGA S A ++R+  H  
Sbjct: 67  LRPTLKALFPDPSLFTDMDRAAEILIDALERGRPTMVFADYDVDGATSAAQLVRWFRHMG 126

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           V   +YIPDR+ +GYGP+P+   K  + GA+L++T+DCG+ +YDA+  A   G++V+VID
Sbjct: 127 VELPIYIPDRLTEGYGPSPAAFRKIRDGGAELVVTLDCGAAAYDAIASAGEIGLEVVVID 186

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR------QDNKVPL 234
           HH ++ +   A A+VNPNR    SGQG L AAGV F++L  + R  R      +D   P 
Sbjct: 187 HHLMREDPPAAAAVVNPNRPGCPSGQGVLAAAGVTFVLLTALNREARKRGLFTEDRPQP- 245

Query: 235 NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITA 294
             D    LDLVAL  VCDV  L+G NRA    GL       NPGLKAL E    S   + 
Sbjct: 246 --DPRQWLDLVALGEVCDVTQLVGFNRALTALGLRAMGAWANPGLKALFEVGKGSGEPSV 303

Query: 295 ENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQA 354
              G+++GP INAGGR+G S+LG+RLL +DD  E   LA +LD LN  R+ +E+A++E+A
Sbjct: 304 FTAGFILGPRINAGGRVGRSDLGARLLSTDDPLEARALAEELDSLNTERKAVEAAVVEEA 363

Query: 355 EAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSG 413
            A +    +    A VIVV GD WHPG++G++A RL+E++ +P   I  +     G GSG
Sbjct: 364 AAMLERGSNFNPDAPVIVVAGDDWHPGVIGIVAGRLRERYRKPVVVIGIDRAANVGKGSG 423

Query: 414 RSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALIT 473
           RS  G ++G+ +  A E G+L+ GGGHAMAAGL++          F ++     + A + 
Sbjct: 424 RSQSGVNLGRAIQAAFEAGLLMAGGGHAMAAGLSIRPEMIPEFRAFLEERLAGEMEA-VG 482

Query: 474 TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
               ++D ++   A N AL+D  +   P+G GNP P+FA    + + +  +   H++M  
Sbjct: 483 VEAVEVDALVQPRAANRALLDDFQRLAPFGPGNPEPLFALSQVRPERVSALKGGHVRMDL 542

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
                + ++AI++R   TPLG+ L+   G  + V G L  + + G    QL + DA
Sbjct: 543 VGPTGDRIKAISWRSAETPLGQRLLAGGGP-LDVVGKLKPDDYMGRNGVQLEIEDA 597


>gi|197105103|ref|YP_002130480.1| single-stranded-DNA-specific exonuclease RecJ [Phenylobacterium
           zucineum HLK1]
 gi|196478523|gb|ACG78051.1| single-stranded-DNA-specific exonuclease RecJ [Phenylobacterium
           zucineum HLK1]
          Length = 598

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 225/587 (38%), Positives = 341/587 (58%), Gaps = 7/587 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           +LGV  S+SG RW        + R   ++   + P  +AR L +R V     + FLNP++
Sbjct: 10  YLGVTRSLSGRRWRERAACPDLTRRHQLSLGLSEP--LARALASRGVGEGEGETFLNPTL 67

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           + L PDP   +D D+AA  +V A+ N  +I++F DYDVDGA+S AL++R+     +   +
Sbjct: 68  KALFPDPSCFSDMDRAAEILVDALENRRRIVVFADYDVDGASSAALLVRWFRAMGLEIAI 127

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           Y+PDR+ +GYGP+P+   +  +EGA+L++TVDCG+ ++DAL  A   G+ V+VIDHH ++
Sbjct: 128 YVPDRLTEGYGPSPAAFRRLKDEGAELVVTVDCGAAAHDALACAGEIGLPVVVIDHHLMR 187

Query: 186 SEEIPAY-ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
             EIP   ALVNPNR D +SGQGHL AAGV F++L  + R  R+    P   DL + LDL
Sbjct: 188 PGEIPPIAALVNPNRPDCVSGQGHLAAAGVTFVLLAALNREARRRGLAP-EPDLRAWLDL 246

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
            A+  +CDV  L G NRA   +GL V     NPGL AL++        +  ++G+++GP 
Sbjct: 247 AAMGAICDVTRLTGFNRALAAQGLKVMSGWKNPGLAALMQVAKGQGAASTFHVGFLLGPR 306

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG S+LG+RLL +DD  E   LA +LD LN +R+ +E+ ++E A  + + Q  +
Sbjct: 307 INAGGRIGRSDLGARLLSTDDPDEAAALAAELDGLNASRKEVEAQVMEAA-IRHIEQESN 365

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGK 423
              A  ++V  D WHPG++G++A RL+E++ +P   +  +     G GSGRS  G ++G+
Sbjct: 366 AADAPCLLVAQDDWHPGVIGIVAGRLRERYRKPCIVVGIDRAANVGKGSGRSQPGVNLGR 425

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V  A EEG+L+ GGGHAMAAGL+V       L DF      +           +ID ++
Sbjct: 426 AVQAAFEEGLLLAGGGHAMAAGLSVRPDAIPELRDFLNARLADEQAQAAAEDGLEIDALV 485

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            A   + AL    +   P+G GNP P FA  + +++    +   H++ T        L+A
Sbjct: 486 TARGCDRALWRDFQRLAPFGPGNPEPTFAAADMRIERPMALKGGHVRCTLTDSSGGKLKA 545

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +A+R+  T  G  L+Q  G  +HV G L  + W+G +  +L + D +
Sbjct: 546 VAWRMADTEAGRRLLQE-GGAVHVAGRLKPDDWQGREGVELEIEDVA 591


>gi|157964581|ref|YP_001499405.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia massiliae
           MTU5]
 gi|157844357|gb|ABV84858.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia massiliae
           MTU5]
          Length = 608

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 228/587 (38%), Positives = 341/587 (58%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 25  QASINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLIPKIKNLL 82

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 83  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 142

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +
Sbjct: 143 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHH-IATEIL 201

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLV 245
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N   +  L  +L+  LDLV
Sbjct: 202 PDAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMKYLDLV 261

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL + +++ N G+K L +   ++      +LG+++GP I
Sbjct: 262 ALGTVCDMMKLTGLNRAFVASGLKIMQQRQNIGIKTLYDMAGLNEIPKCYHLGFILGPRI 321

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    
Sbjct: 322 NAGGRVGKSSLGANLLSTSCSNEANKLAEELEKHNNERKVIELLMIEEAMEIALTQ---- 377

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           Q +S++ +  + WHPG++G++A +LKEKF +P   I+   DG G  S RSI G D G  +
Sbjct: 378 QDSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEI 436

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  
Sbjct: 437 INAKSKDLLIAGGGHAMAAGFTVTADKLQELQNFFNNAFRISINKLENYKHAEYDIELTV 496

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           ++VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L
Sbjct: 497 NSVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKAL 556

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GT   + L+ S+ K +   G L  N W+G+   QL + D
Sbjct: 557 SAIAFNSVGTAFEDVLLSSKAKNIAAIGTLKTNNWQGNYTIQLIIKD 603


>gi|239947713|ref|ZP_04699466.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921989|gb|EER22013.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 599

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 229/587 (39%), Positives = 341/587 (58%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 16  QASINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLIPKIKNLL 73

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 74  PDPFHLLDMEKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNIFRDLNIICDIYVPD 133

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +
Sbjct: 134 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHH-IATEIL 192

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSLLDLV 245
           P A A+VNPNR+D+ S   HL A GV FL +  I   L++ N      L  +L+  LDLV
Sbjct: 193 PDAVAIVNPNRIDEKSEYKHLAAVGVAFLFVTAILSNLKKQNYFTQPMLQPNLMKYLDLV 252

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+KAL +   ++      +LG+++GP I
Sbjct: 253 ALGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKALYDMAGLNEIPKCYHLGFILGPRI 312

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    
Sbjct: 313 NAGGRVGKSSLGANLLSTSCSNEANKLAEELEKHNNERKVIELLMIEEAMEIALTQ---- 368

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           Q +S++ +  + WHPG++G++A RLKEKF +P   I+   DG G  S RSI G D G  +
Sbjct: 369 QDSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEI 427

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  
Sbjct: 428 INAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISINKLENYKHAEYDIDLTV 487

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           ++VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L
Sbjct: 488 NSVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCILVPNKRGFGNKAL 547

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GT   + L+  + K +   G L  N W+ +   QL + D
Sbjct: 548 SAIAFNSVGTSFEDVLLSPKAKNITAIGTLKTNNWQDNYTIQLIIKD 594


>gi|15892684|ref|NP_360398.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia conorii
           str. Malish 7]
 gi|15619857|gb|AAL03299.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia conorii
           str. Malish 7]
          Length = 587

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 228/587 (38%), Positives = 339/587 (57%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHH-IATEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLV 245
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N   +  L  +L+  LDLV
Sbjct: 181 PDAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP I
Sbjct: 241 ALGTVCDMMKLTGLNRAFVASGLKVMQQRHNIGIKTLYDMAGLHEIPKCYHLGFILGPRI 300

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    
Sbjct: 301 NAGGRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKVIELLMIEEAMEIALTQ---- 356

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           Q +S++ +  + WHPG++G++A +LKEKF +P   I+   DG G  S RSI G D G  +
Sbjct: 357 QDSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEI 415

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  
Sbjct: 416 INAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTV 475

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           ++VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L
Sbjct: 476 NSVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKAL 535

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GT   + L+  + K + V G L  N W+ +   QL + D
Sbjct: 536 SAIAFNSVGTAFEDVLLSPKAKNIAVIGTLKTNNWQDNYTIQLIIKD 582


>gi|307295021|ref|ZP_07574863.1| single-stranded-DNA-specific exonuclease RecJ [Sphingobium
           chlorophenolicum L-1]
 gi|306879495|gb|EFN10713.1| single-stranded-DNA-specific exonuclease RecJ [Sphingobium
           chlorophenolicum L-1]
          Length = 588

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 227/556 (40%), Positives = 331/556 (59%), Gaps = 10/556 (1%)

Query: 41  DIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           D+V ++L+ R    D  +   NP+IR  MPDP +  D D AA R+ +A+   E + IFGD
Sbjct: 34  DLVTQLLLARGCPRDAVEAHRNPTIRHFMPDPSLFRDMDAAAERLAEAVMRGEDVRIFGD 93

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDGA S AL++R L    + A  YIPDR+++GYGP+   + +   EGA LI+TVDCG+
Sbjct: 94  YDVDGATSAALLIRLLRDLGLAARPYIPDRLMEGYGPSGEALVRLAGEGATLIVTVDCGA 153

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLD---DLSGQGHLCAAGVVFL 217
            ++DAL  A   G+DV+V+DHH+  +    A ALVNPNRLD   + +  GHL A GV FL
Sbjct: 154 QAFDALAMAKAAGVDVVVVDHHKCTTLLPEALALVNPNRLDEAEEAAAHGHLAAVGVAFL 213

Query: 218 VLVLIYRILRQDNKVPLNFD--LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQG 275
           +   + R+LR+ N      +  L+ LLD+VAL TV DV  L GLNRA+V +GL +  ++ 
Sbjct: 214 LGAALIRVLRKRNWFAARSEPPLMELLDIVALGTVADVAQLKGLNRAFVAQGLKIMAKRR 273

Query: 276 NPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMK 335
           N GL ALI+   ++      +LG+ +GP INAGGR+G+++LG RLL ++D  E   +A +
Sbjct: 274 NIGLSALIDASRLTRAPLCHDLGFALGPRINAGGRVGKADLGVRLLTTEDPAEAAKIAAE 333

Query: 336 LDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFG 395
           LD+LN+ RR +E+A+  +AE  +  Q +     +V +V G  WHPG++G++A R+KEK G
Sbjct: 334 LDLLNEERRAIEAAVQAEAEELLAAQGNR----AVALVSGAGWHPGVIGIVAGRIKEKAG 389

Query: 396 RPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           RP+  ++ +EDG G GSGRSI G D+G  V  A + G+LV GGGHAMAAGLTV       
Sbjct: 390 RPAIVVAIDEDGTGKGSGRSISGVDLGAAVLAAKDSGLLVAGGGHAMAAGLTVAAGKVDA 449

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
           L DF        V          ID VL  + VN   +  +++ GPYGAG P P+ A   
Sbjct: 450 LADFLDARLSGAVAKARDDRALLIDAVLAPAGVNPDFVAAIDAGGPYGAGWPAPLIASGP 509

Query: 516 HKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVN 574
            ++    VV   HL+      D  +++ IAFR   + LG+ ++ + R +R+ + G   ++
Sbjct: 510 MRVIKADVVGNGHLRAIMAGDDGRSIKTIAFRQAESDLGQAILGAPRDRRLWIAGRAKID 569

Query: 575 YWRGSKRCQLRVLDAS 590
            W      +L + DA+
Sbjct: 570 DWGPRPAAELHLEDAA 585


>gi|241116890|ref|XP_002401658.1| single-stranded DNA specific exonuclease RecJ, putative [Ixodes
           scapularis]
 gi|215493202|gb|EEC02843.1| single-stranded DNA specific exonuclease RecJ, putative [Ixodes
           scapularis]
          Length = 581

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 229/585 (39%), Positives = 340/585 (58%), Gaps = 16/585 (2%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+PD
Sbjct: 1   SINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLIPKIKNLLPD 58

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L D +KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y+PDRI
Sbjct: 59  PFHLLDMEKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNIFRDLNIICDIYVPDRI 118

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP- 190
            +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +P 
Sbjct: 119 AEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHH-IATEILPD 177

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSLLDLVAL 247
           A A+VNPNR+D+ S   HL A GV FL +  I   L++ N      L  +L+  LDLVAL
Sbjct: 178 AVAIVNPNRIDEKSEYKHLAAVGVAFLFVTAILSNLKKQNYFTQPMLQPNLMKYLDLVAL 237

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCD++ L GLNRA+V  GL V +++ N G+KAL +   ++      +LG+++GP INA
Sbjct: 238 GTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKALYDMAGLNEIPKCYHLGFILGPRINA 297

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q 
Sbjct: 298 GGRVGKSSLGANLLSTSCSNEANKLAEELEKHNNERKVIELLMIEEAMEIALTQ----QD 353

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
           +S++ +  + WHPG++G++A RLKEKF +P   I+   DG G  S RSI G D G  +  
Sbjct: 354 SSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEIIN 412

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  ++
Sbjct: 413 AKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISINKLENYKHAEYDIDLTVNS 472

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETLQA 543
           VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L A
Sbjct: 473 VNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCILVPNKRGFGNKALSA 532

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           IAF   GT   + L+  + K +   G L  N W+ +   QL + D
Sbjct: 533 IAFNSVGTSFEDVLLSPKAKNITAIGTLKTNNWQDNYTIQLIIKD 577


>gi|157828569|ref|YP_001494811.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933283|ref|YP_001650072.1| RecJ [Rickettsia rickettsii str. Iowa]
 gi|157801050|gb|ABV76303.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908370|gb|ABY72666.1| RecJ [Rickettsia rickettsii str. Iowa]
          Length = 587

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 228/587 (38%), Positives = 338/587 (57%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QVSINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +
Sbjct: 122 RIAEGYGPTPFAMQKIKDHGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHH-ITTEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLV 245
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N   +  L  +L+  LDLV
Sbjct: 181 PDAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP I
Sbjct: 241 ALGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKTLYDMAGLHEIPKCYHLGFILGPRI 300

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    
Sbjct: 301 NAGGRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKVIELLMIEEAMEIALTQ---- 356

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           Q +SV+ +  + WHPG++G++A +LKEKF +P   I+   DG G  S RSI G D G  +
Sbjct: 357 QDSSVLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEI 415

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  
Sbjct: 416 INAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTV 475

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           ++VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L
Sbjct: 476 NSVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKAL 535

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GT   + L+  + K +   G L  N W+ +   QL + D
Sbjct: 536 SAIAFNSVGTAFEDVLLSPKTKNIAAIGTLKTNNWQDNYTIQLIIKD 582


>gi|67459155|ref|YP_246779.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia felis
           URRWXCal2]
 gi|67004688|gb|AAY61614.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia felis
           URRWXCal2]
          Length = 587

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 228/587 (38%), Positives = 337/587 (57%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLIPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D  KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMKKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNVFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDLNLDVIVIDHH-IATEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLV 245
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N   +  L  +L+  LDLV
Sbjct: 181 PDAVAIVNPNRIDEKSECKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMKYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+K L +   ++      +LG+++GP I
Sbjct: 241 ALGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKTLYDMAELNEIPKCYHLGFILGPRI 300

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    
Sbjct: 301 NAGGRVGKSSLGANLLSTSCSNEASKLAEELEKHNNERKVIELLMIEEATEIALTQ---- 356

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           Q +S++ +  + WHPG++G++A RLKEKF +P   ++   DG G  S RSI G D G  +
Sbjct: 357 QDSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVVAL-NDGIGKASCRSILGIDFGAEI 415

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  
Sbjct: 416 INAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISINKLENYKHAEYDIDLTV 475

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           + VN  L+  L +  P+G GN  P+F F +  +    +V   H++           ++ L
Sbjct: 476 NGVNFPLMKELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLAPNKRGFGNKAL 535

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GT   E L+  + K +   G L  N W+ +   QL + D
Sbjct: 536 SAIAFNSVGTSFEEVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIRD 582


>gi|34581633|ref|ZP_00143113.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia sibirica
           246]
 gi|28263018|gb|EAA26522.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia sibirica
           246]
          Length = 587

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 227/587 (38%), Positives = 338/587 (57%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHH-IATEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLV 245
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N   +  L  +L+  LDLV
Sbjct: 181 PDAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP I
Sbjct: 241 ALGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKTLYDMAGLHEIPKCYHLGFILGPRI 300

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    
Sbjct: 301 NAGGRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKVIELLMIEEAMEIALTQ---- 356

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           Q +S++ +  + WHPG++G++A +LKEKF +P   I+   DG G  S RSI G D G  +
Sbjct: 357 QDSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEI 415

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  
Sbjct: 416 INAKSKDLLIAGGGHAMAAGFTVAAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTV 475

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           ++VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L
Sbjct: 476 NSVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKAL 535

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GT   + L+  + K +   G L  N W+ +   QL + D
Sbjct: 536 SAIAFNSVGTAFEDVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIKD 582


>gi|157825818|ref|YP_001493538.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia akari
           str. Hartford]
 gi|157799776|gb|ABV75030.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia akari
           str. Hartford]
          Length = 587

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 227/590 (38%), Positives = 339/590 (57%), Gaps = 16/590 (2%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           +  + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+
Sbjct: 1   MKTQTSINGKIWQQKLIHEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLIPKIK 58

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            L+PDP  L D  KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y
Sbjct: 59  NLLPDPFHLLDMKKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNVFRDLNIICDIY 118

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           +PDRI +GYGP P  M+K  ++  +L+ITVDCG+ +Y+A++YA +  +DVIVIDHH + +
Sbjct: 119 VPDRIAEGYGPTPFAMQKIKDKDTELLITVDCGAMAYEAIKYAKDLNLDVIVIDHH-IAT 177

Query: 187 EEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLL 242
           E +P A A+VNPNR+D+ S   HL A GV FL    I   L++ N   +  L  +L+  L
Sbjct: 178 EILPDAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSHLKKQNYFTQTMLQPNLMKYL 237

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVAL TVCD++ L GLNRA+V  GL V +++ N G+K L +   ++      +LG+++G
Sbjct: 238 DLVALGTVCDMMTLTGLNRAFVSSGLKVMQQRQNIGIKTLYDMAGLNEIPKCYHLGFILG 297

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ 
Sbjct: 298 PRINAGGRVGKSSLGANLLSTSCSNEASKLAEELEKHNNERKVIELLMIEEATEIALTQ- 356

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
              Q +S++ +  + WHPG++G++A RLKEKF +P   ++   DG G  S RSI G D G
Sbjct: 357 ---QDSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVVAL-NDGIGKASCRSILGIDFG 412

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
             +  A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  
Sbjct: 413 AEIINAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISINTLENYKHAEYDID 472

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF----ESQDS 538
           L    VN  L++ L +  P+G GN  P+F F +  +    +V   H++        S  +
Sbjct: 473 LTVDGVNFHLMEELNTLEPFGQGNHEPIFKFDDLFVLKAYIVGSKHIKCMLVPNKRSFGN 532

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           + L AIAF   GT   + L+  + K +   G L  N W+ +   QL + D
Sbjct: 533 KALSAIAFNSVGTSFEDVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIKD 582


>gi|229586785|ref|YP_002845286.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia africae
           ESF-5]
 gi|228021835|gb|ACP53543.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia africae
           ESF-5]
          Length = 587

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 226/587 (38%), Positives = 338/587 (57%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           P+P  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PNPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHH-IATEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLV 245
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N   +  L  +L+  LDLV
Sbjct: 181 PDAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP I
Sbjct: 241 ALGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKTLYDMAGLHEIPKCYHLGFILGPRI 300

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    
Sbjct: 301 NAGGRVGKSSLGAHLLSTSCSNEATKLAKELEKHNNERKVIELLMIEEAMEIALTQ---- 356

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           Q +S++ +  + WHPG++G++A +LKEKF +P   I+   DG G  S RSI G D G  +
Sbjct: 357 QDSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEI 415

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  
Sbjct: 416 INAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTV 475

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           ++VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L
Sbjct: 476 NSVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKAL 535

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GT   + L+  + K +   G L  N W+ +   QL + D
Sbjct: 536 SAIAFNSVGTAFEDVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIKD 582


>gi|238650226|ref|YP_002916077.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia peacockii
           str. Rustic]
 gi|238624324|gb|ACR47030.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia peacockii
           str. Rustic]
          Length = 587

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 226/587 (38%), Positives = 337/587 (57%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I   L  + K  I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDIVTELCRSFK--ISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH + +E +
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHH-IATEIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLV 245
           P A A+VNPNR+D+ S   HL A GV FL    I   L++ N   +  L  +L+  LDLV
Sbjct: 181 PDAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP I
Sbjct: 241 ALGTVCDMMKLTGLNRAFVASGLKVIQQRQNIGIKTLYDMAGLHEIPKCYHLGFILGPRI 300

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    
Sbjct: 301 NAGGRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKVIELLMIEEAMEIALTQ---- 356

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           Q +S++ +  + WHPG++G++A +LKEKF +P   I+   DG G  S RSI G D G  +
Sbjct: 357 QDSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIAL-NDGIGKASCRSILGIDFGAEI 415

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  
Sbjct: 416 INAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTV 475

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           ++VN  L++ L +  P+G  N  P+F F +  +    +V   H++           ++ L
Sbjct: 476 NSVNFPLMEELNTLEPFGQENHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKAL 535

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GT   + L+  + K +   G L  N W+ +   QL + D
Sbjct: 536 SAIAFNSVGTAFEDVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIKD 582


>gi|330991943|ref|ZP_08315892.1| Single-stranded-DNA-specific exonuclease recJ [Gluconacetobacter
           sp. SXCC-1]
 gi|329760964|gb|EGG77459.1| Single-stranded-DNA-specific exonuclease recJ [Gluconacetobacter
           sp. SXCC-1]
          Length = 589

 Score =  367 bits (942), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 224/593 (37%), Positives = 329/593 (55%), Gaps = 18/593 (3%)

Query: 9   VECSISGFRWVSLLGQEGINR---ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           + CS++G +W    G +  +     +AI Q+  +P+IV R+L  R ++ +    +L P++
Sbjct: 1   MTCSVTGRQWHWRAGGQASHTDRMGMAIAQQANLPEIVGRMLALRGIAPEQVGTYLTPTL 60

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
             LMP+P  L D D AA R+ +A+ + E + +FGDYDVDGA S AL+  FL         
Sbjct: 61  NDLMPNPSTLVDMDAAADRLARAVSSGETVGLFGDYDVDGACSTALLATFLQEQGCTVLT 120

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           +IPDR+ +GYGPN   +    ++GA LII +DCG+ + D L++A  Q  D+I++DHHQV+
Sbjct: 121 HIPDRMTEGYGPNTPAIAAMQDKGASLIICLDCGTAAVDVLEHA-GQRSDIIILDHHQVQ 179

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNFDLLSLL 242
                  A VNPNR D  S    LCAA V F+ +V   R LR     +  P+  DL + +
Sbjct: 180 GPLPEVVATVNPNRPDCPSRLHGLCAAAVTFMTIVATRRALRAAGWFDTRPMP-DLWACM 238

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATVCDV+PL GLNRA+V +GL +  R+   GL AL+E      P++A   G+ +G
Sbjct: 239 DLVALATVCDVMPLRGLNRAFVTQGLRIMGRRKRVGLAALLEVAGARDPLSAFTCGFAVG 298

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRI +S LG RLL+  D  E  +LA +L+ +N NR+ +ES +L++A    L   
Sbjct: 299 PRINAGGRIADSGLGLRLLLCTDPAEARVLAERLNSVNHNRQSVESGILDRAME--LAAA 356

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
              Q  +V+V+ G  WHPG+VG++A R+KEKF RP    +  EDG   GS RS+ G D+G
Sbjct: 357 QRAQGNAVLVLSGRDWHPGVVGIVAGRIKEKFNRPVLVGAEMEDGSVKGSARSVPGQDLG 416

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPA--LITTPVFKID 480
             +  A + G+L  GGGHAMAAG  +       L +F     H++  A  L       ID
Sbjct: 417 GAIIAARQAGLLSTGGGHAMAAGFGLPAAGVPALQEFLN---HHLATAADLPDAVDLTID 473

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQD- 537
            V+N +A  + L   ++   P+G GN  P+ A P  ++     +      L++T E +  
Sbjct: 474 AVVNVAAATVELAADMDRLAPFGTGNDEPLIALPRVRVAYAERIGSEGNTLRLTLEGEGR 533

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              L+A+ FR   +PL   L    G  +H+ G L    W+G       + D +
Sbjct: 534 GPRLKALVFRANESPLATVLEDRDGPPLHLAGWLRAESWKGRTSATFFIRDVA 586


>gi|302383023|ref|YP_003818846.1| single-stranded-DNA-specific exonuclease RecJ [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193651|gb|ADL01223.1| single-stranded-DNA-specific exonuclease RecJ [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 605

 Score =  366 bits (939), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 224/588 (38%), Positives = 324/588 (55%), Gaps = 9/588 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V  S+SG  W     +  + RA    Q   + + +AR L  R V  +   DFL P++
Sbjct: 14  FLDVARSLSGRAWRQRPAEASVIRAH--MQGLGLDEPLARALAARGVKPEQGADFLEPTL 71

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           + L PDP    D D AA  IV AI + E I +F DYDVDGA+S AL++R+      +  +
Sbjct: 72  KALFPDPSSFMDMDLAAEAIVSAIQSGESIHVFADYDVDGASSAALLVRWFRALGRDLPI 131

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           Y+PDR+ +GYGP+P   ++    GA+L+ITVDCG+ + +A+ +A   G+ V+VIDHH ++
Sbjct: 132 YVPDRLTEGYGPSPMAFDRLKASGAELVITVDCGAAANEAIAHACGIGLKVVVIDHHMMR 191

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLL 242
            E     A+VNPNR  D SGQG+L AAGVVF++L  + R  R+     + P   D+   L
Sbjct: 192 EEPPRCLAVVNPNRPGDTSGQGNLAAAGVVFVLLAALNREARKRGLFVETP-EPDIRQWL 250

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMI 301
           DL AL  +CDV  L G NRA    GL V     NPGLKAL+        P  + + G+++
Sbjct: 251 DLAALGAICDVTGLTGFNRALTGLGLRVMSGWRNPGLKALLAVAGAEPGPAKSNHAGFIL 310

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG ++LG+RLL +DD  E   LA +LD LN  RR +E  + E A  +V   
Sbjct: 311 GPRINAGGRIGRADLGARLLSTDDPLEARALAEELDALNVARREVEREVTETATRRVEAT 370

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFD 420
                 ++V+VV G+ WHPG+VG++A RL+E++ +P   I  +     G GSGRS  G +
Sbjct: 371 GQHADGSAVVVVSGEDWHPGVVGIVAGRLRERWRKPVIVIGVDAVAHVGKGSGRSQPGMN 430

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G+ +  A  EG+L+ GGGHAMAAGLT+       L DF                  ++D
Sbjct: 431 LGRAIQSAWREGLLLAGGGHAMAAGLTIRPDGIDALRDFLNATMAGEQADADALDWVEVD 490

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
            +++  A + AL +  E   P+G  NP P+FA    + +    +N  H++      D  +
Sbjct: 491 ALIDPGAASRALFEGFERLAPFGPANPEPLFALSGVQSREPVQMNGGHVRCRLVGADGAS 550

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           ++AIA+R    P G  L+  +G  + V G L  + W G K  Q  + D
Sbjct: 551 VKAIAWRCADLPSGRALLAGQGG-LSVVGRLKADDWNGRKGVQFEIED 597


>gi|162146848|ref|YP_001601309.1| single-stranded-DNA-specific exonuclease recJ [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785425|emb|CAP54974.1| putative single-stranded-DNA-specific exonuclease recJ
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 574

 Score =  365 bits (938), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 217/577 (37%), Positives = 311/577 (53%), Gaps = 13/577 (2%)

Query: 21  LLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDK 80
           +L   G    L I Q+  + DIV ++L  R +    A  FL+P++R LMPDP  L D D 
Sbjct: 1   MLADAGGRVGLMIAQQAGVSDIVGQMLAARGLDGRSAATFLDPTLRALMPDPSALRDMDP 60

Query: 81  AARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPS 140
           AA R+  A+   E + +FGDYDVDGA + AL+ + L         ++PDR+ +GYGPN  
Sbjct: 61  AAERLADAVRRGETVAVFGDYDVDGACAAALVTQLLRDLGCPVLTHVPDRMTEGYGPNAP 120

Query: 141 LMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRL 200
            +E     GA L++ VDCG+ + D L     +  D+IV+DHH+ +    P  A VNPNRL
Sbjct: 121 ALEALAARGATLVVCVDCGTAAGDILAGLAGRA-DIIVLDHHKAEGPPPPVLATVNPNRL 179

Query: 201 DDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLSLLDLVALATVCDVVPLIG 258
           D  SGQ  LCAAGV FL  V   R LR+          DL++ LD+VALATVCDV+PL  
Sbjct: 180 DCTSGQRGLCAAGVAFLAAVATVRTLRRAGWFAARPEPDLMAFLDIVALATVCDVMPLTD 239

Query: 259 LNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGS 318
           LNRA V +GL +  R+   GL AL+E      P++A   G+ +GP INAGGRI ES LG 
Sbjct: 240 LNRALVTQGLKILARRQRTGLDALLEVAGARDPLSAFTCGFALGPRINAGGRIAESGLGL 299

Query: 319 RLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRW 378
            LL+ DD+ E   LA +LD +N+ R+ +E+ +L++A  +  +Q        V+++ G  W
Sbjct: 300 DLLLCDDAAEARRLAERLDAVNRRRQTVETTILDRAMDEAASQ--RAAGRGVLLLSGRDW 357

Query: 379 HPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGG 438
           HPG+VG++A R+KE+F RP    +  EDG   GS RS+   D+G  +  A + G+L  GG
Sbjct: 358 HPGVVGIVAGRIKERFNRPVLVGAELEDGTVKGSSRSVADLDLGAAIIAARQAGLLTTGG 417

Query: 439 GHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLES 498
           GHAMAAG ++ R     L DF +            T V  I+GV++ +     L   +  
Sbjct: 418 GHAMAAGFSLPREGVPALHDFLEARLAGATALPDATDVL-IEGVVHVAGATTELATDIGR 476

Query: 499 AGPYGAGNPNPVFAFPNHKLQSIRVVNLAH----LQMTFESQ-DSETLQAIAFRVYGTPL 553
             P+GAGN  P+ A P  +++ +R   +      L++  E +     L+A+ FR    P 
Sbjct: 477 LAPFGAGNDEPILAIP--RVRVVRADRIGREGNTLRVLVEGEGGGPRLKALLFRADDHPA 534

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              L       +H+ G L    W G       + DA+
Sbjct: 535 TPILEDRNAPPLHLAGWLRAESWNGRVSAGFFIRDAA 571


>gi|51473709|ref|YP_067466.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia typhi
           str. Wilmington]
 gi|51460021|gb|AAU03984.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia typhi
           str. Wilmington]
          Length = 586

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 226/587 (38%), Positives = 339/587 (57%), Gaps = 16/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W     +E I   L  + K  I D++AR++  R  ++   ++FL P I+ L+
Sbjct: 4   QISINGKIWKQKQIKEDIVTELCRSFK--ISDLLARIVSLRVNNLAEVENFLIPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D DKA  RIVQAI ++++I IF DYDVDGA S AL+   L   ++  ++Y+PD
Sbjct: 62  PDPFHLLDMDKAVDRIVQAIVHNQQICIFADYDVDGATSAALLKHLLRDLNIICDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  ++K  + G +L+ITVDCG+ ++DAL+YA +  +DVIVIDHH + +  +
Sbjct: 122 RIYEGYGPTPLAIQKIKDNGTELLITVDCGAMAHDALKYAKDVKLDVIVIDHH-ISTAIL 180

Query: 190 P-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF---DLLSLLDLV 245
           P A A+VNPNR+D+ S   +L A GV FL    I   L++ N    +    +L+  LDLV
Sbjct: 181 PDAVAIVNPNRIDETSEYKYLAAVGVTFLFATAILSNLKKRNYFSQSIPTPNLMQYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCD++ L GLNRA+V  GL V +++ N G+K L +   I+      +LG+++GP I
Sbjct: 241 ALGTVCDMMKLTGLNRAFVATGLKVMQQRQNIGIKTLYDIAGINEIPQCYHLGFILGPRI 300

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGR+G+SNLG+ LL +    E   LA +L+  N  R+++E  M+++A    LTQ D  
Sbjct: 301 NAGGRVGKSNLGANLLATSCHNEASKLANELEKYNNERKVIELLMIDEAIDIALTQKD-- 358

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
             +S++ V  + WHPG++G++A RLKEKF +P   ++   +G G  S RSI G D    +
Sbjct: 359 --SSLLFVVKEGWHPGVIGIVAGRLKEKFDKPVAVVAL-NNGIGKASCRSILGIDFSAEI 415

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A  + +++ GGGHAMAAG TV       L DF        +  L      + D  L  
Sbjct: 416 INAKSKDLIIAGGGHAMAAGFTVTAGKLEELQDFLNNAFSISINKLANYKHAEYDIDLTV 475

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD----SETL 541
           ++VN  L++ L+   P+G+GN  P+F F +  +    +V   H++           ++ L
Sbjct: 476 NSVNFYLMEELKILEPFGSGNHEPIFKFDDLFILKADIVGSKHIKCMLAPDKRGFGNKVL 535

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            AIAF   GTP  + L+ SR K +   G L  N W+ +   QL + D
Sbjct: 536 SAIAFDAVGTPFEDILLSSRAKHISAIGTLKTNNWKDNYTIQLIIKD 582


>gi|58697289|ref|ZP_00372658.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|58536352|gb|EAL59823.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila simulans]
          Length = 481

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 208/477 (43%), Positives = 303/477 (63%), Gaps = 21/477 (4%)

Query: 24  QEGINRA-LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAA 82
           QE   R  L +TQ+  +P+I+AR+LV R V+I+ A DFL P IR L+PDP  L D DKA 
Sbjct: 18  QEADQRQILTLTQRFELPEILARILVTRGVNIENASDFLYPLIRSLLPDPFHLLDMDKAV 77

Query: 83  RRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLM 142
            RI++AI N E + IFGDYDVDGA S AL+ R+L    +++ +YIPDR+ +GYG +   +
Sbjct: 78  SRIIRAIKNDENLAIFGDYDVDGATSSALINRYLRAIDIHSIIYIPDRVDEGYGLSTDAL 137

Query: 143 EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLD 201
            +    G  L I+VDCG+ +Y  ++ A   G+D+IV+DHH + +E++P A A+VNPNRLD
Sbjct: 138 LQLKKNGIDLCISVDCGTLAYQPIEDAKAFGLDIIVVDHH-LGTEKLPSAVAIVNPNRLD 196

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFDLLSLLDLVALATVCDVVPL 256
           + S   +L A GV FL++V + + LR+     + K P   DL  LLDLVAL TVCDV+ +
Sbjct: 197 ESSPYNNLAAVGVSFLLIVALNKSLREQGFFTNKKEP---DLFDLLDLVALGTVCDVMQI 253

Query: 257 IGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNL 316
            GLNRA V +GL V   + N GL+ L + + I    +   LG+ IGP INAGGRIGE++L
Sbjct: 254 TGLNRALVSQGLKVMSTRKNVGLRVLFDALGILEKPSVSRLGFSIGPCINAGGRIGEASL 313

Query: 317 GSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGD 376
           G+RLL +DD +E   +A+KL  LN  R+++E+  L +A A+          A+ I++ G+
Sbjct: 314 GARLLSTDDDEEAHSIALKLIDLNNARKVLENEALLEATAQAEKSAQ--SGANFIMISGN 371

Query: 377 RWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVK 436
            WH GI+G++A+RLKE+F  P+  IS   +G G  S RSI G DIG  V  A    ++++
Sbjct: 372 -WHQGIIGIIASRLKEQFHLPTVVISL-NNGIGKASCRSILGVDIGAAVLSAKFINLIIE 429

Query: 437 GGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           GGGH+MAAG +++      L DFF ++F+++     I     K D ++ A A+N++L
Sbjct: 430 GGGHSMAAGFSIKEDKINDLHDFFTERFSNS-----INEKTLKADSIVTAKAINLSL 481


>gi|294013199|ref|YP_003546659.1| single-stranded DNA-specific exonuclease [Sphingobium japonicum
           UT26S]
 gi|292676529|dbj|BAI98047.1| single-stranded DNA-specific exonuclease [Sphingobium japonicum
           UT26S]
          Length = 588

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 227/556 (40%), Positives = 329/556 (59%), Gaps = 10/556 (1%)

Query: 41  DIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           D+V ++L+ R    D  +   NP+IR  MPDP +  D D AA R+  A+   E + IFGD
Sbjct: 34  DLVTQLLLARGCPRDAVEAHRNPTIRHFMPDPSLFRDMDAAAERLADAVARGEDVRIFGD 93

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDGA S AL++R L    + A  YIPDR+++GYGP+   + +   EGA LI+TVDCG+
Sbjct: 94  YDVDGATSAALLIRLLRDLGLAARPYIPDRLMEGYGPSGEALVRLAGEGATLIVTVDCGA 153

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLD---DLSGQGHLCAAGVVFL 217
            ++DAL  A   G+DV+V+DHH+  +    A ALVNPNRLD   + +  GHL A GV FL
Sbjct: 154 QAFDALAQAKAAGVDVVVVDHHKCAAALPEALALVNPNRLDEAEEAAAHGHLAAVGVAFL 213

Query: 218 VLVLIYRILRQDNKVPLNFD--LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQG 275
           +   + R LR+ N      +  L+ LLD+VAL TV DV  L GLNRA+V +GL V  ++ 
Sbjct: 214 LGAALIRALRKRNWFAQRTEPPLMDLLDIVALGTVADVAQLKGLNRAFVAQGLKVMAKRR 273

Query: 276 NPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMK 335
           N GL ALI+   ++      +LG+ +GP INAGGR+G+++LG RLL ++D  E   +A +
Sbjct: 274 NIGLSALIDASRLTRAPLCHDLGFALGPRINAGGRVGKADLGVRLLTTEDPAEAAQIAQE 333

Query: 336 LDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFG 395
           LD+LN+ RR +E+A+  +AE  +  Q +     +V +V G  WHPG++G++A R+KEK G
Sbjct: 334 LDLLNEERRAIEAAVQAEAEELLAAQGNR----AVALVSGAGWHPGVIGIVAGRIKEKAG 389

Query: 396 RPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           RP+  ++ + DG G GSGRSI G D+G  V  A + G+LV GGGHAMAAGLTV       
Sbjct: 390 RPAIVVAIDGDGTGKGSGRSISGVDLGAAVLAAKDSGLLVAGGGHAMAAGLTVAADKVDA 449

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
           L DF  +     V          ID VL  + VN   +  +++ GPYGAG P P+ A   
Sbjct: 450 LADFLDERLSGAVAKARDDRALLIDAVLAPAGVNPDFVAAIDAGGPYGAGWPAPLIASGP 509

Query: 516 HKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVN 574
            ++    VV   HL+      D  +++ IAFR   + LG+ ++ + R +R+ + G   ++
Sbjct: 510 MRVIKADVVGNGHLRAIMAGDDGRSIKTIAFRQAESDLGQAILGAPRDRRLWIVGRAKID 569

Query: 575 YWRGSKRCQLRVLDAS 590
            W      +L + DA+
Sbjct: 570 DWGPRPAAELHLEDAA 585


>gi|295689095|ref|YP_003592788.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter segnis
           ATCC 21756]
 gi|295430998|gb|ADG10170.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter segnis
           ATCC 21756]
          Length = 611

 Score =  363 bits (931), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 227/592 (38%), Positives = 334/592 (56%), Gaps = 15/592 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+SG  W        + R   I Q+H + + +AR L  R VS++ ++ +L P+
Sbjct: 20  AFLGVEHSLSGRAWRERAADPLVVRD--IQQRHGLIEPLARALAARGVSLEQSEHYLRPT 77

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L PDP   TD D+AA  ++ A+      M+F DYDVDGA S A ++R+  +  V   
Sbjct: 78  LRALFPDPSSFTDMDRAAEILIDALAQGRPTMVFADYDVDGATSAAQLVRWFRYMGVELP 137

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDR+ +GYGP+P+   K    GA+L++T+DCG+ +YDA+  A   G++V+VIDHH +
Sbjct: 138 IYIPDRLTEGYGPSPAAFRKIRESGAELVVTLDCGAAAYDAIASAAEIGLEVVVIDHHLM 197

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR------QDNKVPLNFDL 238
           + +   A A+VNPNR    SGQG L AAGV F++L  + R  R      +D   P   D 
Sbjct: 198 REDPPAAAAVVNPNRPGCQSGQGVLAAAGVTFVLLAALNREARKRGLFTEDRPQP---DP 254

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
              LDLVAL  VCDV  L+G NRA    GL       NPGLKAL E    S P +  + G
Sbjct: 255 RQWLDLVALGEVCDVTQLVGFNRALTALGLRTMGAWANPGLKALFEVGKGSGPPSVFHAG 314

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +++GP INAGGRIG S+LG+RLL +DD  E   LA +LD LN  R+ +  A + +  A +
Sbjct: 315 FILGPRINAGGRIGRSDLGARLLSTDDPLEARALAEELDGLNTERKAV-EAAVVEEAAAM 373

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIE 417
           L + +    A VIVV G+ WHPG++G++A RL+E++ +P   I  +     G GSGRS  
Sbjct: 374 LERGNLNPDAPVIVVAGEDWHPGVIGIVAGRLRERYRKPVVVIGIDRAANVGKGSGRSQP 433

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVF 477
           G ++G+ +  A E G+L+ GGGHAMAAGL++          F ++     + A +     
Sbjct: 434 GVNLGRAIQGAFEAGLLMAGGGHAMAAGLSIRPEAIPEFRAFLEQHLAGEMEA-VGAEAV 492

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
           +ID +L   A + AL D  +   P+G GNP P+FA    +   +  +   H+++      
Sbjct: 493 EIDVLLQPRAASRALHDDFQRLAPFGPGNPEPMFAMTQVRPDRVTALKGGHVRLDLVGPT 552

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
            + ++A+++R   TPLG  L+   G  + V G L  + + G    Q  + DA
Sbjct: 553 GDRIKAVSWRSAETPLGRRLLAG-GGALDVAGRLKPDDYMGRNGVQFEIEDA 603


>gi|304319922|ref|YP_003853565.1| single-stranded-DNA-specific exonuclease RecJ [Parvularcula
           bermudensis HTCC2503]
 gi|303298825|gb|ADM08424.1| single-stranded-DNA-specific exonuclease RecJ [Parvularcula
           bermudensis HTCC2503]
          Length = 610

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 236/600 (39%), Positives = 331/600 (55%), Gaps = 14/600 (2%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           + AFLGV  S++G RW            +A  Q+  I  +++ V+  R V+ D A  +L+
Sbjct: 14  ETAFLGVTRSVTGRRWRRRAFDARAAETIA--QRLDIDPLLSEVVAARQVTPDLAAAWLS 71

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R  +PDP  L   D AA R+  AI   E I +FGD+DVDG  S A+M R+L      
Sbjct: 72  PRLRDDLPDPSCLKGMDTAAARLADAIIAGETIGLFGDFDVDGTTSSAIMARYLRAVGAA 131

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +++P+R  +GYGPN         +GA LI+T+DCG+T++  L  A  +G++VIV+DHH
Sbjct: 132 PLIHLPNRQSEGYGPNLPAFLAMKEKGASLIVTLDCGATAHGVLAAAAEEGLEVIVVDHH 191

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN--KVPLNFDLLS 240
            +      A A+VNPNR D LSG   L A GV FL LV + R LR+          DLL 
Sbjct: 192 LMSLPAPTAVAVVNPNRPDCLSGLTMLSAGGVTFLTLVALNRTLRERGFFADRPPPDLLR 251

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMV-----ARRQGNPGLKALIERVNISSPITAE 295
           LLDLVAL+ VCDV+PL GL R    +GL +         GN G++AL        P  A 
Sbjct: 252 LLDLVALSLVCDVMPLKGLGRTLTRQGLALLGHIEGAGSGNQGIRALAAEAGAKGPAAAA 311

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
           + GY IGP INA GRIG +     LL +DD  +   LA +L  LN  R+ +E+A+LE+A 
Sbjct: 312 HFGYAIGPRINAAGRIGHAMTAFDLLTTDDPVKAAALAAELSDLNGIRQGVEAAVLEEA- 370

Query: 356 AKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGR 414
            K      D      +VV G+ WHPG++G++A RLKE+FGRP+  IS   E+GK  GSGR
Sbjct: 371 CKAAEDQGDRDAPLPLVVAGEGWHPGVIGIVAGRLKERFGRPALVISLAGEEGK--GSGR 428

Query: 415 SIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITT 474
           S+ G D+G  +  AVE G+L+ GGGH MAAGLTV R   G L  F        + A    
Sbjct: 429 SLPGVDLGAAIGAAVEAGLLLGGGGHPMAAGLTVRRDGLGELRAFLDARLGEAIAAAQAD 488

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
            V  +DG++  + +  +L D L  A P+G GNP P FA  +  ++ +RV+   H+ +T  
Sbjct: 489 RVLSLDGIVAPTGITRSLHDGLLQAAPFGNGNPEPRFALADISVRELRVLKDKHMAVTLA 548

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSR-GKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                  + IAF   G PLG+ L   R G+R+H+ G +  + +RG    Q+ + D + V+
Sbjct: 549 DDTGGRARGIAFGCVGQPLGDLLEAGRAGQRLHLAGRIKPDEYRGGNAAQIHLEDGAVVK 608


>gi|254419621|ref|ZP_05033345.1| single-stranded-DNA-specific exonuclease RecJ [Brevundimonas sp.
           BAL3]
 gi|196185798|gb|EDX80774.1| single-stranded-DNA-specific exonuclease RecJ [Brevundimonas sp.
           BAL3]
          Length = 603

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 228/596 (38%), Positives = 336/596 (56%), Gaps = 15/596 (2%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           D AFLGV  S+SG  W     +    RA    Q   + + +AR L +R V  D   DFL 
Sbjct: 10  DNAFLGVTQSLSGRAWRQRPAEAATIRAH--MQGLGLEEPLARALASRGVRADQGADFLT 67

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R L PDP    D D AA  ++ A     ++ IF DYDVDGA+S AL++R+      +
Sbjct: 68  PTLRALFPDPSSFMDMDAAAEALLDAFQAKSQVHIFADYDVDGASSAALLVRWFRAMGAD 127

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +Y+PDR+ +GYGP+    +     GA L++TVDCG+ + +AL +A    ++V+VIDHH
Sbjct: 128 LPIYVPDRLTEGYGPSAKAFDTLKAAGADLVVTVDCGAAANEALAHAAAIDLNVVVIDHH 187

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVPLNFD 237
            ++SE   A A+VNPNR    SGQG+L AAGVVF++L  + R  R+     D   P   D
Sbjct: 188 LMRSEPPRALAVVNPNRPGCNSGQGNLAAAGVVFVLLAALNREARRRGLFADRPEP---D 244

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAEN 296
           +   LDL AL  +CDV  L G NRA    GL V     NPGL+AL+        P  + +
Sbjct: 245 IRQWLDLAALGAICDVTALTGFNRALTGLGLKVMSDWKNPGLRALLAAAGAEQGPAKSNH 304

Query: 297 LGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEA 356
            G+++GP INAGGRIG S+LG+RLL +DD  E + LA++LD LN +RR +E A+ E A  
Sbjct: 305 AGFILGPRINAGGRIGRSDLGARLLSTDDPAEAQALALELDALNLSRREVERAVTEAAVR 364

Query: 357 KVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE-DGKGIGSGRS 415
           +V        + +++VV G+ WHPG+VG++A RL+E++ +P   I  +   G G GSGRS
Sbjct: 365 RVEATGAHADETALVVVAGEDWHPGVVGIVAGRLRERWRKPVIVIGLDPVTGLGKGSGRS 424

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQ-KFAHNIVPALITT 474
             G ++G+ +  A E G+L+ GGGHAMAAGLT++      L DF   + A   + A +  
Sbjct: 425 QPGMNLGRAIQAAWEAGVLLAGGGHAMAAGLTMDGARLAELTDFLNDRLAGERIEA-VAM 483

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
              +ID +++  A   AL +  E   P+G  NP PVFA    + +    +N  H++    
Sbjct: 484 DALEIDALIDPGAATRALFESFEQLAPFGPSNPEPVFALNGVQAREPVQMNGGHVRCRLV 543

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             D  +++A+A+R    P G+ L+  +G  ++V G L  + W G +  Q  + D +
Sbjct: 544 GPDGASVRAVAWRCADLPTGQALLSGQGG-LNVVGRLKADDWNGRRGVQFEIEDVA 598


>gi|126733218|ref|ZP_01748965.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           CCS2]
 gi|126716084|gb|EBA12948.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           CCS2]
          Length = 458

 Score =  357 bits (915), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 207/480 (43%), Positives = 287/480 (59%), Gaps = 35/480 (7%)

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           +PDRI +GYGPN + M     +   LII VDCG+ S+  +  AT  G DVIV+DHH +  
Sbjct: 1   MPDRIDEGYGPNDAAMSALAKD-HDLIICVDCGTLSHGPIAAAT--GADVIVLDHH-LGG 56

Query: 187 EEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-DNKVPLNFDLLSLLDL 244
           E +P A A+VNPNR D+     HLCAAGVVFL+LV + R LR+   K P   DL+++LDL
Sbjct: 57  ETLPKAIAVVNPNRQDESGELAHLCAAGVVFLMLVDVNRQLREAGQKGP---DLMAMLDL 113

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           V LATV DV PL G+NRA+V +GL V  R+   GL AL +   +    T+ +LG+++GP 
Sbjct: 114 VGLATVADVAPLTGVNRAFVRQGLTVMARRNRVGLTALADVAGLDQAPTSYHLGFLLGPR 173

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAM----LEQAEAKVLT 360
           +NAGGRIG+++LG+RLL ++D  E E +A KLD LN +RR +E+ +    LEQA  + L 
Sbjct: 174 VNAGGRIGKADLGARLLSTNDPVEAEAMAAKLDELNTDRREVEAQVRDLALEQATVRGL- 232

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                    ++   G+ WHPG+VG++AARLKE   RP+  I  + D +G GSGRS+ G D
Sbjct: 233 ------DGPLVWAAGEGWHPGVVGIVAARLKEATNRPAIVIGLDGD-EGKGSGRSVSGID 285

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVER-------VNFGRLCDFFQKFAHNIVPALIT 473
           +G  +    ++G+L+KGGGH MAAGLTV R       V  G L    ++ A +I PA   
Sbjct: 286 LGAAIQRTAQDGLLIKGGGHKMAAGLTVARDKLDDAMVRLGEL--LAKQGAADIGPA--- 340

Query: 474 TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
                I G+L   A  I LI  +E AGP+GAG P P FAFP+ ++   + V   HL+++F
Sbjct: 341 --DLNISGILMPGAATIDLITQIEDAGPFGAGAPAPRFAFPDCQIHFAKQVGANHLKISF 398

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                  +  I+F     P+G  LM   G R H+ G L +N W+G +  QLR+ D +P  
Sbjct: 399 GDGMGGRIDGISFGAMDGPMGPMLMNHNGARFHLVGRLEINTWQGRQSVQLRLEDTAPAH 458


>gi|296117410|ref|ZP_06835998.1| single-stranded-DNA-specific exonuclease RecJ [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976012|gb|EFG82802.1| single-stranded-DNA-specific exonuclease RecJ [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 616

 Score =  350 bits (899), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 225/603 (37%), Positives = 338/603 (56%), Gaps = 20/603 (3%)

Query: 2   NDQAFLGVECSISGFRWV----SLLGQEG--INRALAITQKHAIPDIVARVLVNRNVSID 55
           +D   LGV  S++G RW+    S     G      +AI Q+  +P+IV R+L  R ++ +
Sbjct: 17  DDALVLGVSSSLTGRRWLWRDPSATRDAGRTARMGMAIMQQAGVPEIVGRMLAMRGIAPE 76

Query: 56  YAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRF 115
             +DFL P++R LMPDP  + D DKAA+R+ QAI  SE + +FGDYDVDGA S AL+  F
Sbjct: 77  VVQDFLTPTLRALMPDPAGMIDMDKAAQRLAQAITASETVGVFGDYDVDGACSAALLTHF 136

Query: 116 LSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGID 175
           L         ++PDR+ +GYGPN   +E  I++GA +I+ VDCG+ + D L   + +  D
Sbjct: 137 LRQMGCRVITHVPDRMNEGYGPNTPAIEAMIDDGAGVIVCVDCGTAASDILSPLSARA-D 195

Query: 176 VIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKV 232
           +IV+DHH+V+ +     A VNPNRLD  S     CAA V F+ +V    +LR++      
Sbjct: 196 IIVLDHHKVQGDLPRITATVNPNRLDCPSRLHGACAAAVAFMAVVATAGVLRREGWFETR 255

Query: 233 PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP- 291
           P+   L+  LDLVALA+VCDV+PL GLNRA+V +G+ +  R+   GL AL++   ++   
Sbjct: 256 PMP-QLMDYLDLVALASVCDVMPLTGLNRAFVTQGMKIMARRQRTGLNALLDVSGVTDDR 314

Query: 292 ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAML 351
           +++   G+ +GP INAGGRI ES LG  LL+ +D+ E   LA +LD +N+ R+ +E  +L
Sbjct: 315 LSSSTCGFALGPRINAGGRIAESGLGLELLLCEDALEARRLAERLDAVNRRRQTVEGDIL 374

Query: 352 EQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIG 411
           + A      Q ++     V+++ G  WHPG+VG++A R+KEKF RP    +  EDG   G
Sbjct: 375 DIAMDMAARQREEGH--PVLLLCGRDWHPGVVGIVAGRVKEKFNRPVLVGAMLEDGTVKG 432

Query: 412 SGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF-QKFAHNIVPA 470
           S RS+ G D+G  +  A + G L  GGGHAMAAG  +   +   L  F  ++ +H    A
Sbjct: 433 SARSVPGIDLGTAIIAARQAGHLTSGGGHAMAAGFGLNAGDIPALHMFLDERLSH--AAA 490

Query: 471 LITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHK-LQSIRVVNLAH- 528
           L       I+GV+  +A  + L   +    P+GAGN  P+ A P  + L++ R+    + 
Sbjct: 491 LPDAVDLCIEGVVGVAAATVELATDIGRLAPFGAGNDEPLLALPRVRILRADRIGREGNT 550

Query: 529 LQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVL 587
           L++  E +     L+A+ FR    P+   L       +H+ G L    W G       + 
Sbjct: 551 LRLLIEGEGGGPRLKALLFRAGDNPMTPVLEDRNAPPVHLAGWLQAQTWNGRTTASFFIR 610

Query: 588 DAS 590
           DA+
Sbjct: 611 DAA 613


>gi|254797063|ref|YP_003081901.1| single-stranded-DNA-specific exonuclease RecJ [Neorickettsia
           risticii str. Illinois]
 gi|254590309|gb|ACT69671.1| single-stranded-DNA-specific exonuclease RecJ [Neorickettsia
           risticii str. Illinois]
          Length = 577

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 211/545 (38%), Positives = 309/545 (56%), Gaps = 24/545 (4%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           SI G  W+           L + QK  +   VA VL NR  + D    FLNP ++  +PD
Sbjct: 7   SIKGSVWIH--NHVPSKELLFLRQKFGLSLTVASVLYNRVGADDDIATFLNPKLKHTLPD 64

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L    +   RI++AI   EKI+I+GDYDVDGA S AL+  +        ++YIPDRI
Sbjct: 65  PFSLLGMKEGIERILRAISEDEKIVIYGDYDVDGATSSALLKNYFREIGKKVDIYIPDRI 124

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN +   +   EG  L ITVDCG  ++  ++ A   G+D+IV+DHH       PA
Sbjct: 125 TEGYGPNKAAFMQLKKEGYTLCITVDCGILAHAEIEVANTIGLDIIVVDHHISADVIPPA 184

Query: 192 YALVNPNRLD--DLSGQGHLCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLSLLDLV 245
            A++NPNR+D  +++   HL A GV FL+L+ +  +LR     DNK   N  L++ LDLV
Sbjct: 185 TAVINPNRIDQPNVAYTEHLAAVGVSFLLLIGLNVVLRAKGFFDNKKEPN--LINYLDLV 242

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           AL TVCDVV L G+NRA+V +GL V  ++ N GL  L + + + S + A +LGY+IGP I
Sbjct: 243 ALGTVCDVVRLTGINRAFVKQGLKVIDQRKNLGLSILTKELKLFSTLEAYHLGYVIGPHI 302

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRI +S+LGSRLL + +  E E +A  L VLN  R+ +E A L++    V+TQ +  
Sbjct: 303 NAGGRISQSSLGSRLLSTQNPAEAEEIATTLCVLNLKRKEIERAALQE----VITQVEKT 358

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKM 424
            +  +I+     WH GI+G++A+R+K+ +  P+  +S   DG     S RSI+G +IG  
Sbjct: 359 SK-KIILAASANWHQGIIGIVASRIKDLYHLPTIILSI--DGNIAKASARSIKGANIGMA 415

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           V  A E G++++GGGH MAAG + E      + +FF+++   +     T     ID  L 
Sbjct: 416 VIAAKESGLIIEGGGHKMAAGFSCETEKIPAIREFFEEYFKEVD----TQESIHIDSELY 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL-AHLQMTFESQDSET-LQ 542
              +   L D L+   P+G+GNP P F   + ++ + RV+    H+  T     + T ++
Sbjct: 472 IDTITSDLCDDLKILAPHGSGNPEPKFVLKDVRVVTSRVIGEDGHIACTLRDVRTHTVIR 531

Query: 543 AIAFR 547
            IAFR
Sbjct: 532 GIAFR 536


>gi|88608252|ref|YP_506588.1| single-stranded-DNA-specific exonuclease RecJ [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600421|gb|ABD45889.1| single-stranded-DNA-specific exonuclease RecJ [Neorickettsia
           sennetsu str. Miyayama]
          Length = 577

 Score =  345 bits (884), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 206/526 (39%), Positives = 302/526 (57%), Gaps = 22/526 (4%)

Query: 31  LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           L + QK  +   VA VL NR  + D    FL+P ++  +PDP  L    +   RI++AI 
Sbjct: 24  LFLRQKFGLSLTVASVLYNRVGADDDIATFLDPKLKHTLPDPFSLLGMKEGIERILRAIS 83

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
             EKI+I+GDYDVDGA S AL+  +        ++YIPDRI +GYGPN     +   EG 
Sbjct: 84  EDEKIVIYGDYDVDGATSSALLKNYFREIGKKVDIYIPDRITEGYGPNKVAFTQLKKEGY 143

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLD--DLSGQGH 208
            L ITVDCG  ++  ++ A   G+D+IV+DHH       PA A++NPNR+D  ++    H
Sbjct: 144 TLCITVDCGILAHAEIEAANTIGLDIIVVDHHISTDVIPPATAVINPNRIDQPNVINTEH 203

Query: 209 LCAAGVVFLVLVLIYRILRQ----DNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYV 264
           L A GV FL+L+ +  +LR     DNK   N  L++ LDLVAL TVCDVV L G+NRA+V
Sbjct: 204 LAAVGVSFLLLIGLNVVLRAKGFFDNKKEPN--LINYLDLVALGTVCDVVRLTGINRAFV 261

Query: 265 VKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISD 324
            +GL V  ++ N GL  L + + + S + A +LGY+IGP INAGGRI +S+LGSRLL + 
Sbjct: 262 KQGLKVIDQRKNLGLSILTKELKLFSTLEAYHLGYVIGPHINAGGRISQSSLGSRLLSTQ 321

Query: 325 DSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVG 384
           +  E E +A  L VLN  R+ +E A L++    V+TQ +   +  VI+     WH GI+G
Sbjct: 322 NPAEAEEIATTLCVLNLKRKEIERAALQE----VITQVEKTSK-KVILAASANWHQGIIG 376

Query: 385 LLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMA 443
           ++A+R+K+++  P+  +S   DG     S RSI   +IG  V  A E G++++GGGH MA
Sbjct: 377 IVASRIKDRYHLPTIILSI--DGNIAKASARSIRDANIGMAVIAAKESGLIIEGGGHKMA 434

Query: 444 AGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYG 503
           AG + E      + DFF+++  ++     T     ID  L    +   L D L+   P+G
Sbjct: 435 AGFSCETRKIPAIRDFFEEYFKDVN----TQETIHIDSELYIDTITSDLCDDLKILAPHG 490

Query: 504 AGNPNPVFAFPNHKLQSIRVVNL-AHLQMTFESQDSET-LQAIAFR 547
           AGNP P F   + ++ + +++    H+  T     + T ++ IAFR
Sbjct: 491 AGNPEPKFVLKDVRVVTSKIIGEDGHIACTLRDVRTHTVIRGIAFR 536


>gi|117925055|ref|YP_865672.1| exonuclease RecJ [Magnetococcus sp. MC-1]
 gi|117608811|gb|ABK44266.1| exonuclease RecJ [Magnetococcus sp. MC-1]
          Length = 592

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 209/591 (35%), Positives = 322/591 (54%), Gaps = 21/591 (3%)

Query: 10  ECSISGFRW-VSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRL 67
           + S++G  W +     EG NR   + Q   +   +A +L +R +      + FL P ++ 
Sbjct: 6   KSSLTGKLWTLRCQPDEGHNR---VVQALGLSHYLAPLLASRKLCGAGETRQFLAPRLKD 62

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
           L  DP  L D   A  R+ +A+   EKI +FGDYDVDGA S AL+MR+     V   +YI
Sbjct: 63  LA-DPYDLLDMRVAVERLAEALERGEKIAVFGDYDVDGATSSALLMRYFHELGVALRVYI 121

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           P+R+ +GYGP+   M     EG  L+ITVDCG T+++ LQ A   G+ VI+ DHHQ + +
Sbjct: 122 PNRLTEGYGPSVGAMRTLAEEGVSLVITVDCGITAFEPLQEAKALGLAVIITDHHQAREQ 181

Query: 188 EIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD---NKVPLNFDLLSLLDL 244
              A A++NPNR D+      L   GV F +++ + R+LR+    NK      L  LLDL
Sbjct: 182 LPEALAVINPNRQDEPFPYKELAGVGVAFYLVMALNRLLRERGWFNKGRQEPVLKPLLDL 241

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPI---TAENLGYMI 301
           VA+ TV DV  + GLNRA V  GL V   + NPGL AL++ V I   +   T+ ++G+ +
Sbjct: 242 VAVGTVADVAGMRGLNRALVTTGLHVLSERSNPGLAALMQVVGIGEEVKELTSTHIGFQL 301

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP +NAGGR+G+  LG +LL   D  +   +A  LD  N+ R+ +E  +L+QA  +V  +
Sbjct: 302 GPRLNAGGRLGQGALGYQLLSCHDQAQALPIAQTLDASNKERQEIERTLLKQAMDQVEAE 361

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFD 420
              I +   +VV G+ WH G++G++A+RL +K+ +P+  I+ + E G G GSGRSI G +
Sbjct: 362 NQPILRRG-LVVAGEGWHAGVIGIVASRLCDKYSKPALVIAIDAETGVGKGSGRSIPGIN 420

Query: 421 IGKMVSFAVEEGI--LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
           +      A+E G   L   GGH +AAGLT++R       + F+        A    P   
Sbjct: 421 L----LAAIEAGAAHLEHFGGHKVAAGLTIQREKIPAFMEAFEDHLTRHYQASAFFPRLT 476

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE-SQD 537
           +D  L    ++ A+   ++S  P+G GNP P+F  P   L+ I+V+   HL M+    + 
Sbjct: 477 VDAELPLDELDFAVARQIQSFSPFGPGNPEPIFILPRVSLRGIKVLKERHLAMSIVCPRT 536

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            + ++AI FR+   P+ + +         V G L +  WRG ++ +L++ D
Sbjct: 537 HQQIEAIGFRMAPGPIVDAIQAGDVAVWDVAGKLTIETWRGREKMKLQLSD 587


>gi|303238658|ref|ZP_07325191.1| single-stranded-DNA-specific exonuclease RecJ [Acetivibrio
           cellulolyticus CD2]
 gi|302593777|gb|EFL63492.1| single-stranded-DNA-specific exonuclease RecJ [Acetivibrio
           cellulolyticus CD2]
          Length = 829

 Score =  342 bits (876), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 216/570 (37%), Positives = 318/570 (55%), Gaps = 23/570 (4%)

Query: 29  RALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQ 87
           + L I+++  I  ++A+V ++R +   DY K+FLNPS+  L  DP +L D +KA  RI+ 
Sbjct: 16  KILKISKQCGISALLAKVFLSRGIEDEDYIKEFLNPSMNDLF-DPFLLRDMEKAVERIIN 74

Query: 88  AIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN 147
           A+   EKI+IFGDYDVDG  S +++  FL     N   YIPDR  +GYG +   ++K I+
Sbjct: 75  AVEKKEKIIIFGDYDVDGITSTSILFDFLKKVGANVGYYIPDRKEEGYGLSIIAVDKVID 134

Query: 148 EGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQG 207
           +GA LIITVDCG T+++ +++     +D+I+ DHH+ K E   AYAL+NP R D      
Sbjct: 135 DGASLIITVDCGITAFEEVRHIIESHVDIIITDHHECKEELPEAYALINPCRHDCSYPFK 194

Query: 208 HLCAAGVVF-LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVK 266
            L   GVVF LV  L  ++   D  V       + LDLVAL TV DVVPLI  NR  V  
Sbjct: 195 ELAGVGVVFKLVKALCIKMGLTDESV-------NYLDLVALGTVADVVPLIEENRVIVKY 247

Query: 267 GLMVARRQGNPGLKALIERV-NISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDD 325
           GL       N GLKALI+   +    IT+  +G+++ P INA GRIG+++   RLL +D+
Sbjct: 248 GLQKIENTLNTGLKALIDVSGSKDKQITSYVIGFVLAPRINAAGRIGDASRAVRLLTTDN 307

Query: 326 SQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGL 385
             E   +A +L   N  R+  E  +L +  A +  Q  D+ +  VIVV G  WH GI+G+
Sbjct: 308 EDEAAQIAKELSEQNTYRQETEHNILCEVMAGI-EQYVDLDKEKVIVVWGKGWHHGIIGI 366

Query: 386 LAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAG 445
           +A+++ E + RP   I+  EDG G GSGRSIE F++ K  +      +L K GGH +AAG
Sbjct: 367 VASKITESYNRPCILITV-EDGMGKGSGRSIEEFNLFK--ALMDSSSLLEKFGGHELAAG 423

Query: 446 LTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAG 505
           LT++  N          +A++I+      P  KID  ++   ++   +  L+   P+GAG
Sbjct: 424 LTIKEDNIQEFKTKINAYANSILNDSDLVPKVKIDIEVSKEDISEESVRQLDLMSPFGAG 483

Query: 506 NPNPVFAFPNHKLQSIRVV-NLAHLQMTFESQDSETLQAIAF-RVYGTPLGEFLMQSRGK 563
           NP+PVFA+ N  ++ IR V N  H+++TF  ++++   AI F R Y   L E  + S   
Sbjct: 484 NPSPVFAYRNLVIKDIRAVGNNKHIKITFRDKETD-FDAIGFSRGY---LAE--VYSESD 537

Query: 564 RMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            +     L +N W   +  QL + D    E
Sbjct: 538 ILDAACSLEINSWNNRESVQLNIKDLKVCE 567


>gi|329890045|ref|ZP_08268388.1| single-stranded-DNA-specific exonuclease RecJ [Brevundimonas
           diminuta ATCC 11568]
 gi|328845346|gb|EGF94910.1| single-stranded-DNA-specific exonuclease RecJ [Brevundimonas
           diminuta ATCC 11568]
          Length = 570

 Score =  331 bits (849), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 213/561 (37%), Positives = 316/561 (56%), Gaps = 7/561 (1%)

Query: 35  QKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEK 94
           Q   + + +AR L +R V+ +   DFL P+++ L P+P    D D AA  IV A+     
Sbjct: 7   QALGLDEPLARALASRGVAAEQGADFLKPTLKALFPNPSSFMDMDAAAAAIVDALQAQAS 66

Query: 95  IMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLII 154
           I +F DYDVDGA+S AL++R+      +  +Y+PDR+ +GYGP+    +     GA L+I
Sbjct: 67  IHVFADYDVDGASSAALLVRWFRTLGADLPIYVPDRLTEGYGPSARAFDTLKARGADLVI 126

Query: 155 TVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGV 214
           TVDCG+ + +A+ +A   G+ V+VIDHH ++ E     A+VNPNR    SGQG+L AAGV
Sbjct: 127 TVDCGAAANEAVAHAAAIGLKVVVIDHHMMREEPPACLAVVNPNRPGCGSGQGNLAAAGV 186

Query: 215 VFLVLVLIYRILRQDN--KVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
           VF++L  + R  R     +     D+   LDL A+  +CDV  L G NRA    GL V  
Sbjct: 187 VFVLLAALNREARGRGLFEGKAEPDIRQWLDLAAMGAICDVTGLTGFNRALTSLGLGVMS 246

Query: 273 RQGNPGLKALIERVNISSPITAEN-LGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
              NPGL+AL+            N  G+++GP INAGGRIG+S+LG+RLL +DD  E  M
Sbjct: 247 HWRNPGLRALLAAAGAEPGPAKTNHAGFILGPRINAGGRIGKSDLGARLLSTDDPDEARM 306

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLK 391
           LA +LD LN  RR +E+ + EQA  +V         ++V+VV G+ WHPG+VG++A RL+
Sbjct: 307 LAQELDALNLARREVEAEVTEQAVRRVEATGAHADDSAVVVVSGEDWHPGVVGIVAGRLR 366

Query: 392 EKFGRPSFAISFEE-DGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
           E++ +P   I  +  +G G GSGRS  G ++G+ V  A  E +L+ GGGHAMAAGLTV  
Sbjct: 367 ERWRKPVIVIGVDAVNGVGKGSGRSQPGMNLGRAVQAAWNESLLIAGGGHAMAAGLTVAA 426

Query: 451 VNFGRLCDFF-QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
                L  F  ++ +   V A+    V ++D +++  A    L +  E   PYG  NP P
Sbjct: 427 DRVDELRAFLNERLSTERVEAVAQDWV-EVDALIDPRAATRDLFEAFEQLAPYGPANPEP 485

Query: 510 VFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           +FA    + +    +N  H++      D  +++AIA+R    P G+ L+  +G  ++V G
Sbjct: 486 LFALEGVQAREPVAMNGGHVRCRLVGPDGASVRAIAWRCADLPTGKALLAGQGG-VNVVG 544

Query: 570 HLCVNYWRGSKRCQLRVLDAS 590
            L  + W G +  Q  + D +
Sbjct: 545 RLRADDWNGRRGVQFEIEDVA 565


>gi|220932058|ref|YP_002508966.1| single-stranded-DNA-specific exonuclease RecJ [Halothermothrix
           orenii H 168]
 gi|219993368|gb|ACL69971.1| single-stranded-DNA-specific exonuclease RecJ [Halothermothrix
           orenii H 168]
          Length = 814

 Score =  316 bits (810), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 184/561 (32%), Positives = 314/561 (55%), Gaps = 22/561 (3%)

Query: 42  IVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           ++  +L +R ++  D    FL+  I+ L   P ++ D  KA  RI+ AI + EKI+++GD
Sbjct: 22  VLQSILYSRGITDRDEINRFLSCRIQDLHS-PFLMKDMGKAVDRILTAIESGEKIIVYGD 80

Query: 101 YDVDGAASVALM-MRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG 159
           YDVDG  S AL+ + F        + Y+P+R+ +GYG N   ++K IN+   L++TVDCG
Sbjct: 81  YDVDGITSTALLFLYFKKRLGYEVDYYLPNRLKEGYGLNKEALDKIINKNYDLMLTVDCG 140

Query: 160 STSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVL 219
            +  + ++YAT +G++VIV DHHQ   +  PA A+++P+R DD     +L   GV F + 
Sbjct: 141 ISGLEEVEYATRKGLEVIVTDHHQPAKKLPPAIAVLDPHRKDDKYPFKYLAGVGVAFKLC 200

Query: 220 VLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGL 279
             + + ++          LL L+D+V+L ++ D+VPL+G NR  V +GL       N GL
Sbjct: 201 QALEKEIKGHEISDF---LLRLIDIVSLGSIADIVPLLGENRIIVKRGLSELNDTSNKGL 257

Query: 280 KALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDV 338
           + L++++++    + A ++GY++ P +NA GR+ + +LG  LL +D   + + +A +L  
Sbjct: 258 RVLMDKLSLDGKDLNAGHIGYIMAPPLNAAGRMEDPSLGIELLTTDSIDKAKEIANRLIN 317

Query: 339 LNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPS 398
           LN++R+  E  + E A  K++ +  D+ +   IV+    WH G++G++A+RL EK+ RP 
Sbjct: 318 LNKSRQAEEEEIFEDA-VKMIEKTVDLNKDKGIVLASPDWHHGVIGIVASRLVEKYYRPV 376

Query: 399 FAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCD 458
             IS  EDG G GS RSIEG +I K + F      L+  GGH  AAGL + + +  +  D
Sbjct: 377 IMISL-EDGIGKGSCRSIEGLNIYKALDFC--SSYLLSYGGHEQAAGLAINKEDIEQFRD 433

Query: 459 FFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKL 518
            F  +  +++      PV K+D +L    +N+     L+   PYG GNP P F   N + 
Sbjct: 434 TFLDYVDSVLSPEDLIPVLKLDSILKPGQINLNFYKTLKQLEPYGVGNPKPRFFLSNMQF 493

Query: 519 QSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYW 576
             +R V  +  HL+ T +    + L+ I F       G+ L++ + K++ +  +L +N W
Sbjct: 494 NKLRTVGRDGKHLKFTLD----KGLKGIGF-----DFGDKLIEFKNKKVDLAFYLTLNTW 544

Query: 577 RGSKRCQLRVLDASPVEGHHF 597
            G++  +L++LD +  E  ++
Sbjct: 545 NGAEEVELQLLDVNVKESINY 565


>gi|302038557|ref|YP_003798879.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Nitrospira defluvii]
 gi|300606621|emb|CBK42954.1| Single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Nitrospira defluvii]
          Length = 568

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 196/566 (34%), Positives = 301/566 (53%), Gaps = 26/566 (4%)

Query: 28  NRAL--AITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILTDCDKAARR 84
           +RAL   ++++ +I  + A VL+ R V+  D A  +++ S++  + DP +L D + A  R
Sbjct: 12  DRALQHTLSKQLSISPVTASVLLARGVTTPDEATRWMS-SVQGGLHDPFLLPDMESAVER 70

Query: 85  IVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEK 144
           + QA+   E++  +GDYDVDG ++ +L + F      NA  YIP R+ +GYG N   + +
Sbjct: 71  LHQALARQERVCFYGDYDVDGVSATSLYLSFYQGLGGNACGYIPHRVREGYGLNEGAVRR 130

Query: 145 FINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLS 204
              EG  L++T DCG+TS+  +  A   G+DVIV DHHQ  +    A A++NP+R D + 
Sbjct: 131 LAEEGISLLVTSDCGTTSHHEIAVARELGVDVIVTDHHQTDATMPAALAVLNPHRRDAIY 190

Query: 205 GQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYV 264
               LC+AG+ + V V  Y+       V  +    S LDLVALATV D+VPL   NR  V
Sbjct: 191 PFKGLCSAGLAYKV-VSAYQQRYGSGDVEPD----SCLDLVALATVADIVPLQDENRILV 245

Query: 265 VKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISD 324
            +GL    R    G++AL +   I+   T+E +G+ +GP +NA GR+  + L  RLL ++
Sbjct: 246 REGLTHITRGARAGIRALKQVAGIAKACTSETIGFRLGPRLNAAGRLDHAMLCVRLLTTE 305

Query: 325 DSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVG 384
             QE   +A +L+ LN+ R+ +E  +  +A     T  +  + A+ IV+    WH G+VG
Sbjct: 306 SDQEAMQIAEQLEQLNRQRQQIEEGITREAA----TYLNQDEPAAAIVLGSRDWHLGVVG 361

Query: 385 LLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAA 444
           ++AARL ++F RPS  I+ +  G+G GS R++EGF++ + +S   +  +L   GGH  AA
Sbjct: 362 IVAARLVDRFHRPSIVIAIDGQGRGKGSARTVEGFNLYQGLSECKD--LLEAYGGHPSAA 419

Query: 445 GLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGA 504
           GLT++          F + A        T P   +D  +  + VN  LI  LES  P+GA
Sbjct: 420 GLTLKEARLEEFRRRFCEVAAQWAGGARTVPTLHVDAEVKLTDVNFDLIQELESLHPFGA 479

Query: 505 GNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKR 564
           GNP P  A     +   RVV   HL++      S    +I FR     +G F  +  G R
Sbjct: 480 GNPEPTLAVRGLDVVDARVVGEKHLKLRVRQGRSFIFDSIGFR-----MGSF--EELGLR 532

Query: 565 MHVTGHLCV----NYWRGSKRCQLRV 586
            +    L      N+W G  R QLR+
Sbjct: 533 ANRPVDLAFSPERNHWNGYDRVQLRI 558


>gi|300214762|gb|ADJ79178.1| Single-stranded-DNA-specific exonuclease [Lactobacillus salivarius
           CECT 5713]
          Length = 777

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 195/561 (34%), Positives = 298/561 (53%), Gaps = 26/561 (4%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + ++   P IV ++L+ R   S++   +FL+P  R L  DP  + D +    RI QAI N
Sbjct: 22  LIEETGFPKIVLQILMERGYDSLEAINNFLDPDARGLY-DPNFMHDMELGVDRIQQAIMN 80

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            EKI+I+GDYDVDG  S ALM   L         YIPDR  DGYGPN  + ++ I+EG  
Sbjct: 81  GEKIVIYGDYDVDGITSTALMYETLEELGAEVEYYIPDRFKDGYGPNVEVYKRLIDEGVS 140

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LI+TVD G   ++A+ YA   G+DV+V DHH++      AYA+++P   +     G L  
Sbjct: 141 LIVTVDNGVAGHEAIDYANQHGVDVVVTDHHELPETLPDAYAIIHPRHPEGDYPFGELSG 200

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F V   +   L QD           +LDLVAL TV D+V L G NR  V  GL + 
Sbjct: 201 VGVAFKVAAALLEELPQD-----------VLDLVALGTVADLVSLTGENRILVKYGLQLL 249

Query: 272 RRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           ++   PGL++L +   I +P IT E +G+ + P +NA GR+   +LG  LL + D +  E
Sbjct: 250 QQTMRPGLQSLYKVAGIEAPTITEETIGFTLAPRLNALGRMENGSLGVELLTTLDEERAE 309

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            LA   + LN  R+   + ++E+A A++  + ++     V VV G+ WH G+VG++A+RL
Sbjct: 310 ELAKTTNQLNVKRQEEVNEIVEEAVAQLANKSEN---HLVNVVAGNNWHEGVVGIVASRL 366

Query: 391 KEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
            +  G+PS  +S +E  G   GSGRSIE F +    +      IL+K GGH MA GL+++
Sbjct: 367 VDMTGKPSLVLSIDEKAGIAKGSGRSIEAFQM--FDALDSHRDILMKFGGHHMACGLSLD 424

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
           R     L     +          T PV K+  V N   VN+ L   LE+  P+G  NP P
Sbjct: 425 REKLSDLQQVVDEEGKKQGIEHATKPVVKVIPV-NLDDVNLDLEAQLEALAPFGTDNPRP 483

Query: 510 VFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           VF F ++++ +++ +     HL++  +S +S+ + A+ F +    + E  ++     + +
Sbjct: 484 VFEFKDYEVNTVQAIGQQKNHLKLQLQSNNSQ-VDALDFGIGSKKISE--IERNKNSVRL 540

Query: 568 TGHLCVNYWRGSKRCQLRVLD 588
            G L  N W+     Q+ + D
Sbjct: 541 IGTLGKNVWQSRVNLQIMIED 561


>gi|227891087|ref|ZP_04008892.1| single-stranded-DNA-specific exonuclease [Lactobacillus salivarius
           ATCC 11741]
 gi|227866961|gb|EEJ74382.1| single-stranded-DNA-specific exonuclease [Lactobacillus salivarius
           ATCC 11741]
          Length = 788

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 196/561 (34%), Positives = 296/561 (52%), Gaps = 26/561 (4%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + ++   P IV ++L+ R   S++   +FL+P  R L  DP  + D +    RI QAI N
Sbjct: 33  LIEETGFPKIVLQILMERGYDSLEAINNFLDPDARGLY-DPNFMHDMELGVDRIQQAIMN 91

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            EKI+I+GDYDVDG  S ALM   L         YIPDR  DGYGPN  + ++ I+EG  
Sbjct: 92  GEKIVIYGDYDVDGITSTALMYETLEELGAEVEYYIPDRFKDGYGPNVEVYKRLIDEGVS 151

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LI+TVD G   ++A+ YA   G+DV+V DHH++      AYA+++P   +     G L  
Sbjct: 152 LIVTVDNGVAGHEAIDYANQHGVDVVVTDHHELPETLPDAYAIIHPRHPEGDYPFGELSG 211

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F V   +   L QD           +LDLVAL TV D+V L G NR  V  GL + 
Sbjct: 212 VGVAFKVAAALLEELPQD-----------VLDLVALGTVADLVSLTGENRILVKYGLQLL 260

Query: 272 RRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           ++   PGL++L +   I +P IT E +G+ + P +NA GR+   +LG  LL + D +  E
Sbjct: 261 QQTMRPGLQSLYKVAGIEAPTITEETIGFTLAPRLNALGRMENGSLGVELLTTLDEERAE 320

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            LA   + LN  R+   + ++E+A A++  + ++     V VV G+ WH G+VG++A+RL
Sbjct: 321 ELAKTTNQLNVKRQEEVNKIVEEAVAQLANKSEN---HLVNVVAGNNWHEGVVGIVASRL 377

Query: 391 KEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
            +  G+PS  +S +E  G   GSGRSIE F +    +      IL+K GGH MA GL+++
Sbjct: 378 VDMTGKPSLVLSIDEKTGIAKGSGRSIEAFQM--FDALDSHRDILMKFGGHHMACGLSLD 435

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
           R     L     +          T PV K+  V N   VN+ L   LE+  P+G  NP P
Sbjct: 436 REKLSDLQQVVDEEGKKQGIEHATKPVVKVIPV-NLDDVNLDLEAQLEALAPFGTDNPRP 494

Query: 510 VFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           VF F ++++ +++ +     HL++  +S +S+ + A+ F +    + E        R+  
Sbjct: 495 VFEFKDYEVNTVQAIGQQKNHLKLQLQSNNSQ-VDALDFGIGSKKISEIERNENSVRL-- 551

Query: 568 TGHLCVNYWRGSKRCQLRVLD 588
            G L  N W+     Q+ + D
Sbjct: 552 IGTLGKNVWQSRVNLQIMIED 572


>gi|90962066|ref|YP_535982.1| single-stranded-DNA-specific exonuclease [Lactobacillus salivarius
           UCC118]
 gi|90821260|gb|ABD99899.1| Single-stranded-DNA-specific exonuclease [Lactobacillus salivarius
           UCC118]
          Length = 777

 Score =  309 bits (791), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 195/561 (34%), Positives = 297/561 (52%), Gaps = 26/561 (4%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + ++   P IV ++L+ R   S++   +FL+P  R L  DP  + D +    RI QAI N
Sbjct: 22  LIEETGFPKIVLQILMERGYDSLEAINNFLDPDARGLY-DPNFMHDMELGVDRIQQAIMN 80

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            EKI+I+GDYDVDG  S ALM   L         YIPDR  DGYGPN  + ++ I+EG  
Sbjct: 81  GEKIVIYGDYDVDGITSTALMYETLEELGAEVEYYIPDRFKDGYGPNVEVYKRLIDEGVS 140

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LI+TVD G   ++A+ YA   G+DV+V DHH++      AYA+++P   +     G L  
Sbjct: 141 LIVTVDNGVAGHEAIDYANQHGVDVVVTDHHELPETLPDAYAIIHPRHPEGDYPFGELSG 200

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F V   +   L QD           +LDLVAL TV D+V L G NR  V  GL + 
Sbjct: 201 VGVAFKVAAALLEELPQD-----------VLDLVALGTVADLVSLTGENRILVKYGLQLL 249

Query: 272 RRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           ++   PGL++L +   I  P IT E +G+ + P +NA GR+   +LG  LL + D +  E
Sbjct: 250 QQTMRPGLQSLYKVAGIEVPTITEETIGFSLAPRLNALGRMENGSLGVELLTTLDEERAE 309

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            LA   + LN  R+   + ++E+A A++  + ++     V VV G+ WH G+VG++A+RL
Sbjct: 310 ELAKTTNQLNIKRQEEVNKIVEEAVAQLANKSEN---HLVNVVAGNNWHEGVVGIVASRL 366

Query: 391 KEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
            +  G+PS  +S +E  G   GSGRSIE F +    +      IL+K GGH MA GL+++
Sbjct: 367 VDMTGKPSLVLSIDEKTGIAKGSGRSIEAFQM--FDALDSHRDILMKFGGHHMACGLSLD 424

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
           R     L     +          T PV K+  V N   VN+ L   LE+  P+G  NP P
Sbjct: 425 REKLSDLQQVVDEEGKKQGIEHATKPVVKVIPV-NLDDVNLGLEAQLEALAPFGTDNPRP 483

Query: 510 VFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           VF F ++++ +++ +     HL++  +S +S+ + A+ F +    + E  ++     + +
Sbjct: 484 VFEFKDYEVNTVQAIGQQKNHLKLQLQSNNSQ-VDALDFGIGSKKISE--IERNKNSVRL 540

Query: 568 TGHLCVNYWRGSKRCQLRVLD 588
            G L  N W+     Q+ + D
Sbjct: 541 IGTLGKNVWQSRVNLQIMIED 561


>gi|301300880|ref|ZP_07207052.1| single-stranded-DNA-specific exonuclease RecJ [Lactobacillus
           salivarius ACS-116-V-Col5a]
 gi|300851479|gb|EFK79191.1| single-stranded-DNA-specific exonuclease RecJ [Lactobacillus
           salivarius ACS-116-V-Col5a]
          Length = 777

 Score =  306 bits (785), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 194/561 (34%), Positives = 297/561 (52%), Gaps = 26/561 (4%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + ++   P IV ++L+ R   S++   +FL+P  R L  DP  + D +    RI QAI N
Sbjct: 22  LIEETGFPKIVLQILMERGYDSLEAINNFLDPDARGLY-DPNFMHDMELGVDRIQQAIMN 80

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            EKI+I+GDYDVDG  S ALM   L         YIPDR  DGYGPN  + ++ I+EG  
Sbjct: 81  GEKIVIYGDYDVDGITSTALMYETLEELGAEVEHYIPDRFKDGYGPNVEVYKRLIDEGVS 140

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LI+TVD G   ++A+ YA   G+DV+V DHH++      AYA+++P   +     G L  
Sbjct: 141 LIVTVDNGVAGHEAIDYANQHGVDVVVTDHHELPETLPDAYAIIHPRHPEGDYPFGELSG 200

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F V   +   L QD           +LDLVAL TV D+V L G NR  V  GL + 
Sbjct: 201 VGVAFKVAAALLEELPQD-----------VLDLVALGTVADLVSLTGENRILVKYGLQLL 249

Query: 272 RRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           ++   PGL++L +   I  P IT E +G+ + P +NA GR+   +LG  LL + D +  E
Sbjct: 250 QQTMRPGLQSLYKVAGIEVPTITEETIGFSLAPRLNALGRMENGSLGVELLTTLDEERAE 309

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            LA   + LN  R+   + ++E+A A++  + ++     V VV G+ WH G+VG++A+RL
Sbjct: 310 ELAKTTNQLNIKRQEEVNKIVEEAVAQLANKSEN---HLVNVVAGNNWHEGVVGIVASRL 366

Query: 391 KEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
            +  G+PS  +S +E  G   GSGRSIE F +    +      IL+K GGH MA GL+++
Sbjct: 367 VDMTGKPSLVLSIDEKTGIAKGSGRSIEAFQM--FDALDSHRDILMKFGGHHMACGLSLD 424

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
           +     L     +          T PV K+  V N   VN+ L   LE+  P+G  NP P
Sbjct: 425 KEKLSDLQQVVDEEGKKQGIEHATKPVVKVIPV-NLDDVNLDLEAQLEALAPFGTDNPRP 483

Query: 510 VFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           VF F ++++ +++ +     HL++  +S +S+ + A+ F +    + E  ++     + +
Sbjct: 484 VFEFKDYEVNAVQAIGQQKNHLKLQLQSNNSQ-VDALDFGIGSKKISE--IERNKNSVRL 540

Query: 568 TGHLCVNYWRGSKRCQLRVLD 588
            G L  N W+     Q+ + D
Sbjct: 541 IGTLGKNVWQSRVNLQIMIED 561


>gi|302391501|ref|YP_003827321.1| single-stranded-DNA-specific exonuclease RecJ [Acetohalobium
           arabaticum DSM 5501]
 gi|302203578|gb|ADL12256.1| single-stranded-DNA-specific exonuclease RecJ [Acetohalobium
           arabaticum DSM 5501]
          Length = 1210

 Score =  306 bits (785), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 183/554 (33%), Positives = 306/554 (55%), Gaps = 15/554 (2%)

Query: 39  IPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           I  ++A +L +R + S    ++FL   +  L   P +L   ++A  RI  A+ + E I I
Sbjct: 26  ISSVLAEILSSRGLNSKQKVENFLEVELDGLHS-PFLLEGIEQAVDRISTAMESQEIIGI 84

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYDVDG  S  L++ +  H  V    +IP+R+ +GYG N   +E     G +L+ITVD
Sbjct: 85  YGDYDVDGITSTGLLINYFQHLGVEPKYHIPNRLEEGYGLNKDAIESLAQSGVELLITVD 144

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
           CG + Y  ++YA   GIDVI+ DHH+V +   PA A++N  + +       LC AGV + 
Sbjct: 145 CGISDYQEVKYANQLGIDVIITDHHEVPARIPPAEAVINAKQSNCNYPFSQLCGAGVAY- 203

Query: 218 VLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
              LI  +  +D +V         LDL+A+  V D+VPL+  NR  V  GL + +   N 
Sbjct: 204 --KLILALADKDQQVNQKEIKEYYLDLLAMGIVADIVPLVDENRIMVKYGLELLQNPNNL 261

Query: 278 GLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           GL ALIE V+++ + I   ++GY++ P +NA GRIG  +L   LLI+DD  +   +A +L
Sbjct: 262 GLSALIEAVDLTETEINTGHIGYILAPRLNAAGRIGNPDLALELLITDDPSQAADIAAEL 321

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           + +N  RR +E+ +  + EA+++ +  D++Q   +V+  + WH G+VG++A+ ++EK+ R
Sbjct: 322 EEINHRRRDIEADI--RQEAELMVEGMDLEQTKALVLASENWHSGVVGIVASDIQEKYYR 379

Query: 397 PSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRL 456
           P+  I+ E+DG G GS RSI+GF+I + V  +  E +L K GGH  AAGL++ + +  + 
Sbjct: 380 PTIMIAIEDDGIGRGSARSIKGFNIYQAVKNS--EDLLPKFGGHEQAAGLSIAKEDIAQF 437

Query: 457 CDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNH 516
            D   ++A + +     TP  K+D  +  S ++  L+  ++   P+G GNP P  A    
Sbjct: 438 RDEINQYADDRLSDKDLTPRLKLDCEVELSELSKELVQEIDYLAPFGFGNPRPKLAVREV 497

Query: 517 KLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVN 574
            +     V  N  HL++    +   T++ I F + G    + L+ S+ + + +   + +N
Sbjct: 498 TVADFATVGSNGEHLKLAVTDEAGTTVECIGFNMAG--FRQKLI-SQQEEIDLACTVEIN 554

Query: 575 YWRGSKRCQLRVLD 588
            W+G    QL++ D
Sbjct: 555 NWQGKSELQLKLKD 568


>gi|95929295|ref|ZP_01312039.1| single-stranded-DNA-specific exonuclease RecJ [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134793|gb|EAT16448.1| single-stranded-DNA-specific exonuclease RecJ [Desulfuromonas
           acetoxidans DSM 684]
          Length = 576

 Score =  305 bits (781), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 193/558 (34%), Positives = 310/558 (55%), Gaps = 19/558 (3%)

Query: 42  IVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           +V ++L  R +S ++ A+ FL  S+  L PDP+ L   + A  R+VQA+   E I + GD
Sbjct: 32  LVCQLLSQRGISTLEEAQAFLTASLSQL-PDPMALRGMESAVDRLVQAVKAGEPIAVHGD 90

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDG +  AL+ + L    VN   +IP R+ DGYG +   + + + +G +L+++VDCG 
Sbjct: 91  YDVDGISGTALLTQCLRWFGVNVTYHIPLRMRDGYGLSEVALRRTLEQGIRLVVSVDCGI 150

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVL 219
           +++   Q A + GI++I+ DHHQ   E +P + + +NP   D       L   GV F+V+
Sbjct: 151 SAHAEAQLAADLGIELIITDHHQ-PPETLPVSLSCINPWLPDCSYPDKRLSGVGVAFMVM 209

Query: 220 VLIYRILRQDNKVP-LNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPG 278
           + +   LR+   +P    DL  +LDLVAL TV D+VPL G+NRA V  GL +  +Q   G
Sbjct: 210 IALRARLRETGNLPDPEPDLRYVLDLVALGTVADLVPLQGVNRALVSSGLRLMAQQPRVG 269

Query: 279 LKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDV 338
           L AL++   + + +TA  +GY + P +NA GR+ ++ LG  LL+ + SQ    +A +L+ 
Sbjct: 270 LAALVKVAEVRA-VTAGVVGYQLAPRLNAAGRLEDATLGVDLLLDEVSQSAMPVAEQLNQ 328

Query: 339 LNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPS 398
            N  RR +E  +L+QA  ++     D   A  IV+  +RWH G++G++A+RL E++ RP+
Sbjct: 329 FNHQRRQIEQQVLDQAIERIERDLTD--DALTIVLADERWHAGVIGIVASRLVERYHRPT 386

Query: 399 FAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCD 458
             I+ EE G+G GS RSI+GF + +  +F   +  L   GGH  AAGL+++     R  +
Sbjct: 387 VLIALEE-GQGKGSARSIKGFHLYQ--AFEACQEPLSGFGGHEFAAGLSIDAACVSRFTE 443

Query: 459 FFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKL 518
            F+++A + +  ++   V + D  L    ++  L D L++  P+G GNP PVF      +
Sbjct: 444 QFERYAQSHLNPVMLGAVREYDAELVLEEIDETLYDELQALAPFGMGNPEPVFVVRQVHV 503

Query: 519 QSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG 578
                V   HL+ + + QD  ++  IAF      + +   +  G+ + V   + +N WRG
Sbjct: 504 HRPSCVAEKHLRFSLQ-QDGYSVPCIAFG-----MAQRQDEVVGQAVDVLFQVGMNTWRG 557

Query: 579 SKRCQLRVLDASP--VEG 594
            K  QL V D  P  VEG
Sbjct: 558 QKSLQLIVKDIMPSHVEG 575


>gi|284105198|ref|ZP_06386191.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Poribacteria sp. WGA-A3]
 gi|283830149|gb|EFC34410.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 582

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 194/565 (34%), Positives = 293/565 (51%), Gaps = 22/565 (3%)

Query: 28  NRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIV 86
            R  A+     +  + A VL  R V   + AK +L  S      DP  L D ++A  R+ 
Sbjct: 32  ERVAALAGVLGLSPLTATVLCGRGVVEPEQAKAWLASSGGSTH-DPFALPDMERAVDRLH 90

Query: 87  QAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFI 146
            AI   E+I  +GDYDVDG A+ +L + F       A +YIPDR  +GYG + S + K  
Sbjct: 91  LAIQRCERICFYGDYDVDGMAATSLHLLFWRSVGAQAEVYIPDRQEEGYGLHESAIRKLG 150

Query: 147 NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQ 206
           + G  L++T DCG+TSY  ++ A + G+DVIV DHHQ++S      A +NP R D +   
Sbjct: 151 HGGVSLLLTADCGTTSYREIEVARSLGMDVIVTDHHQLQSRMPEPVAFINPYRPDSVYPF 210

Query: 207 GHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVK 266
             LC+ G+ + V+    R     + VP+     S  DLVAL+++ D+VPL   NR  V  
Sbjct: 211 QGLCSGGLAYKVVEAYARKYGAAD-VPVE----SFRDLVALSSIADMVPLRDENRVLVRD 265

Query: 267 GLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDS 326
           GL    +    G++AL + + ++   +A  +G+ + P +NA GR+  + LG RLL +D  
Sbjct: 266 GLAQVAQGNRCGIRALTQDLGLNGTCSAGTIGFRVAPRLNAAGRLAHAGLGVRLLTADSE 325

Query: 327 QELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLL 386
                LA +L+ LN+ RR +E AM  +A    + Q +   Q   IVV  + WH G+VG++
Sbjct: 326 PVALQLAQQLEELNRRRREIEEAMTREA----IAQVEAGDQPHAIVVGAEGWHSGVVGIV 381

Query: 387 AARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGL 446
           AARL E++ RP+  ++F+ DG G GS RS+ GFD+ + +     +  LV  GGH MAAGL
Sbjct: 382 AARLVERYHRPAAVVAFDRDGLGKGSVRSVAGFDVCQALRQCQRD--LVAFGGHPMAAGL 439

Query: 447 TVERVNFGRLCDFFQKFAHNIVPAL---ITTPVFKIDGVLNASAVNIALIDMLESAGPYG 503
           TV R  +    DF ++F   +  A+   +  P   +D  +  + V    +  LE   P+G
Sbjct: 440 TVRREAY---ADFSRRFGEGVEGAMDDSLKVPTLDVDAAVALADVQFPFVRELERLQPFG 496

Query: 504 AGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGK 563
            GNP P        +   +VV   HL++      S  L++I FR+ G  L   +    G 
Sbjct: 497 MGNPEPTLMSRGVSVLEKKVVGDNHLKLVVRQPGSVPLESIGFRMGG--LAHAIDAGHG- 553

Query: 564 RMHVTGHLCVNYWRGSKRCQLRVLD 588
           R+       +N W+GS R QLR+ D
Sbjct: 554 RIDAVFTPELNEWKGSTRIQLRLRD 578


>gi|289423185|ref|ZP_06425000.1| single-stranded-DNA-specific exonuclease RecJ [Peptostreptococcus
           anaerobius 653-L]
 gi|289156516|gb|EFD05166.1| single-stranded-DNA-specific exonuclease RecJ [Peptostreptococcus
           anaerobius 653-L]
          Length = 815

 Score =  303 bits (775), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 189/567 (33%), Positives = 311/567 (54%), Gaps = 21/567 (3%)

Query: 26  GINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLILTDCDKAARR 84
           G ++   +T+K  I D + ++L+NR +  +   D +++P +  L  DP +L D D+A  R
Sbjct: 10  GRSKGNEVTKKFNINDNIGQILINRGIETEEQLDLYMHPDLTSL-RDPFLLKDMDRAVDR 68

Query: 85  IVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEK 144
           I +AI N+EKI IFGDYDVDG +S +++  +          YIP+R+ +GYG N   + +
Sbjct: 69  IKRAISNNEKICIFGDYDVDGVSSTSILCLYFESIGYQVEFYIPNRLEEGYGLNDEAIRQ 128

Query: 145 FINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLS 204
               G  LII+VDCG TS + ++ A   GIDVI+ DHH+ + +   AYA+++P R D   
Sbjct: 129 IGQMGTDLIISVDCGITSVNEVETARKLGIDVIITDHHEPQEKLPQAYAVIDPKREDCRY 188

Query: 205 GQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYV 264
               +C  GV F ++      L  D     N +    L++VALAT+CDV+P++  NR  V
Sbjct: 189 PFKGICGCGVAFKLI----HALSGDRDFYNNIN--RYLEIVALATICDVMPVLDENRIIV 242

Query: 265 VKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLIS 323
             GL +  R  N G++ L+   +I  + + + +LG+ IGP INA GR+G S LG  L  S
Sbjct: 243 KNGLEIMGRGNNIGMRELLGVCSILDTKMKSSHLGFAIGPRINASGRLGFSRLGVELFTS 302

Query: 324 DDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIV 383
            D Q+  +LA  +++ N+ R+++E+ +L +AEA ++ +    Q+  VIV+ G  WH GI+
Sbjct: 303 KDPQKARLLAESMNLKNEERQMVEAKILMEAEA-MIDRDSKYQEEKVIVLAGHGWHHGII 361

Query: 384 GLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMA 443
           G++A++L EK+ +P+  +   EDG   GS RSI+GFD+ K +S    + +++K GGH  A
Sbjct: 362 GIVASKLTEKYYKPTVLLCI-EDGVATGSARSIKGFDLFKAMSEC--KDLMMKFGGHEQA 418

Query: 444 AGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYG 503
           AGLT+   N   L +     A   +          I+  L   A+++ L+  L    P+G
Sbjct: 419 AGLTMAEGNIQALRERINAIADYELKKEDLIENINIEFELEEDAISLDLVKDLHILEPFG 478

Query: 504 AGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSR 561
             NP P F   ++K++   ++  +  HL+++ E +   T   I F + G  + +F   S 
Sbjct: 479 IKNPTPYFMVRDYKVKKAYLIGKDKNHLKLSIEKE--YTYDCIGFNM-GHLMDKF---SV 532

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLD 588
             R+ +   L  N ++G    Q+ + D
Sbjct: 533 DDRVDIVFQLDENTFKGRTTVQMLIKD 559


>gi|317128218|ref|YP_004094500.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           cellulosilyticus DSM 2522]
 gi|315473166|gb|ADU29769.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           cellulosilyticus DSM 2522]
          Length = 781

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 198/577 (34%), Positives = 299/577 (51%), Gaps = 29/577 (5%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLIL 75
           RW      E  N+ + +  +  I  I AR LV R    +  A+ FL+    ++  DP +L
Sbjct: 7   RWKITEANE--NQVMELANQLNISMIAARFLVQRGYDDVHKAQSFLHMDASMIH-DPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D +KA +RI  AI  +E I++FGDYD DG  S +LM   L     N   Y+P+R  +GY
Sbjct: 64  KDMEKAVKRIHTAIKENENILVFGDYDADGVTSTSLMYLTLKQLGANVGFYVPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN         E   LIITVD G  +    + A   G+D+I+ DHH+       AYA++
Sbjct: 124 GPNEQAFRHAKEENVSLIITVDTGIAANHEAEVAKELGVDLIITDHHEPPPTIPDAYAVI 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP + D      +L   GV F V   +       N+VP  +     +DLVA+ ++ D+VP
Sbjct: 184 NPKQDDCFYPNKNLAGVGVAFKVAHALL------NRVPTEY-----IDLVAIGSIADLVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           LI  NR    +G+    R+  PGLKAL+E  NI+   +  E++G+MIGP +NA GR+  +
Sbjct: 233 LIDENRFLAAEGIHSLTREQRPGLKALMEHCNINPLELNEEHIGFMIGPRLNAAGRLDSA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +   +LL+S+D  E   LA+ +D LN+ R+ + + M ++AE +VL + D +   SV++V 
Sbjct: 293 DPAIQLLLSEDDIEAYELAIMIDDLNKERQTIVNEMAKEAEEQVLAK-DTV--PSVLIVG 349

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGI 433
              W+ G++G++A+RL EKF RP+  +S +E  G   GS RSIEGFD+ + +S   E   
Sbjct: 350 QAGWNAGVIGIVASRLVEKFYRPTIVLSLDESTGLAKGSARSIEGFDLFQALSQCRE--W 407

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAGLT++  N   L +     A   V          +D  +  S V    I
Sbjct: 408 LPHFGGHPMAAGLTMKIENINLLQEKMCNIAETTVAEENWIKSLAVDLPVKVSEVTTEAI 467

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
             L+   P+G GNP P     N +L   + +     HL+++ + ++S  L  IAFR+ G 
Sbjct: 468 THLQEMAPFGVGNPAPKALIENVELAMTKKIGAKEDHLKLSLKDEES-VLDGIAFRM-GN 525

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              E    S   ++ V G L +N W G  + Q+ + D
Sbjct: 526 IADEL---SPIAKLSVVGQLSINEWNGHVKPQMIIED 559


>gi|257439395|ref|ZP_05615150.1| single-stranded-DNA-specific exonuclease RecJ [Faecalibacterium
           prausnitzii A2-165]
 gi|257198270|gb|EEU96554.1| single-stranded-DNA-specific exonuclease RecJ [Faecalibacterium
           prausnitzii A2-165]
          Length = 713

 Score =  300 bits (768), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 181/501 (36%), Positives = 276/501 (55%), Gaps = 19/501 (3%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           ++ G  W     +E     LA  QK A   ++A +L  R ++ D A+     S    + D
Sbjct: 39  TMDGEPW----SEEKYQMTLAAQQKEA--GLLAGILAARGIT-DPAEALTLLSGEEELTD 91

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P++LTD DKA  RI+ AI   E I++FGDYDVDG  + AL+ + L     N    +P R 
Sbjct: 92  PMLLTDMDKACARILDAIDREETIVVFGDYDVDGVTATALLYQHLKGMGANVKCMLPSRE 151

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            DGYG + + ++   ++G QLI+TVD G ++ +  ++A + G+D+IV DHH        A
Sbjct: 152 GDGYGLSKNAIQSIHDKGCQLIVTVDNGISALEEAEFAASLGVDLIVTDHHLPHDTLPKA 211

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A+V+P R DD S    LC AGV F +   +       +  P    L    DL A+ TV 
Sbjct: 212 VAVVDPRRADDTSPFKGLCGAGVAFKLCAAL-------DGCPPEEMLDYCGDLAAVGTVA 264

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGR 310
           DV+PL G NR  V  GL + +    PGL AL++ V +   P+TAEN+ Y I P INA GR
Sbjct: 265 DVMPLTGENRTLVKAGLHLLQHSDRPGLLALLDEVGLGGKPVTAENVSYAIAPRINAAGR 324

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +  +    +L++ +D +    LA KL+ +N  R+  E  + + A+A++  +   I +  V
Sbjct: 325 MDSAVTALQLVLCEDEERAAELAHKLNEINAARQETEGEIAKAAQAQLEAE-PAILEDRV 383

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           I++ G  WHPG++G++A+RL EK GRP   +S +E G+G GSGRS++GF++   ++    
Sbjct: 384 ILIWGRDWHPGVIGIVASRLVEKTGRPVIVVSIDEHGEGKGSGRSVQGFNLHACIASC-- 441

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           E +L++ GGHAMAAGL+V   N   L     ++A    P L+T P  + D  ++   + +
Sbjct: 442 EDLLLRFGGHAMAAGLSVREENLPELRRRLNEWAARECPVLVTPP-LECDLSIHLDRITV 500

Query: 491 ALIDMLESAGPYGAGNPNPVF 511
             +  L+   PYGA NP PVF
Sbjct: 501 ESVRRLDQLAPYGAENPAPVF 521


>gi|148263783|ref|YP_001230489.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter
           uraniireducens Rf4]
 gi|146397283|gb|ABQ25916.1| exonuclease RecJ [Geobacter uraniireducens Rf4]
          Length = 573

 Score =  299 bits (766), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 189/553 (34%), Positives = 286/553 (51%), Gaps = 22/553 (3%)

Query: 42  IVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           ++AR+LVNR V     A  FL  S+     DP +L   ++A  R+  A+   EK+ + GD
Sbjct: 31  LLARLLVNRAVIEPAAASRFLTSSLAQFH-DPFLLLGMERAVDRLAAAVKKGEKVCVHGD 89

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDG  SVAL++ F     ++A  YIPDR+VDGYG +   + +    GAQ+++TVDCG 
Sbjct: 90  YDVDGITSVALLLSFFRSIGLDAIYYIPDRLVDGYGLSADGVARAATLGAQVMVTVDCGI 149

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLV 220
           T+       +  GID+IV DHH        AYA++NP +         L   GV F +++
Sbjct: 150 TAVAEATLCSAAGIDLIVTDHHMPGDSLPEAYAVINPLQPGCTFPFKSLAGVGVAFNLMI 209

Query: 221 LIYRILRQD-----NKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQG 275
            +   LR++      + P   +L   LDLVAL TV DVVPL   NR  V  GL       
Sbjct: 210 ALRSRLREEGFFAGKEEP---NLREYLDLVALGTVADVVPLTDENRILVKHGLRELTNSQ 266

Query: 276 NPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMK 335
            PG++AL +   ++  +    +G+ + P +NA GR+  + +G  LL+  D ++ E LA  
Sbjct: 267 RPGVQALKDVAGVNGDVGCGAVGFRLAPRLNAAGRLENAAMGVELLLCGDRKKAEPLAAA 326

Query: 336 LDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFG 395
           LD  N  R+ +E  +L  A A V  +   ++    IV+  + WHPG++G++A+RL + F 
Sbjct: 327 LDASNAERQAVEREILNDALAMV-KETPALRNRKSIVLASEAWHPGVIGIVASRLVDMFH 385

Query: 396 RPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           RP+  I+  +DG G GSGRSI  F +   ++   +   L+K GGH  AAGL++       
Sbjct: 386 RPTILIAL-KDGNGKGSGRSIANFHLHDALNVCFDH--LIKFGGHKHAAGLSIAEETLEA 442

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
               F + A  ++ A   TP+  IDG L AS +   L+D LE+  P+G GNP PVF   +
Sbjct: 443 FVARFDEVAAGLLTAEDLTPLLLIDGELEASEITSELVDGLETMKPFGMGNPEPVFLLRD 502

Query: 516 HKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNY 575
            ++   R +   HL+M   +    +  AI F + G         ++G R+ V     +N 
Sbjct: 503 AEVSDCRTLKETHLKMRLNA-GCRSFDAIGFSLAGR-------AAQGDRLDVVFTPAINV 554

Query: 576 WRGSKRCQLRVLD 588
           W G    QL + D
Sbjct: 555 WNGRSSLQLTIKD 567


>gi|328954455|ref|YP_004371789.1| single-stranded-DNA-specific exonuclease RecJ [Desulfobacca
           acetoxidans DSM 11109]
 gi|328454779|gb|AEB10608.1| single-stranded-DNA-specific exonuclease RecJ [Desulfobacca
           acetoxidans DSM 11109]
          Length = 570

 Score =  299 bits (765), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 197/581 (33%), Positives = 317/581 (54%), Gaps = 31/581 (5%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLIL 75
           RW     Q  + R   ++++H +P++VA++L+NR ++     D FL+PS+  L+P P  L
Sbjct: 6   RWRPYPSQPELVRD--VSRRHQVPELVAQILLNRGLAQAGEIDSFLDPSLNRLLP-PGGL 62

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D   AA R+VQA+   E I I+GDYDVDG  + AL+  FL         YIP+R+  GY
Sbjct: 63  QDLPSAAARLVQALEKGETIAIYGDYDVDGLTATALLRHFLESLGAAVISYIPNRLNQGY 122

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G + S + +     AQ+++TVDCG ++    + A + G+DVI+ DHH+V +   PA A++
Sbjct: 123 GLHESALSELARR-AQVVVTVDCGISNASEARVARDLGLDVIITDHHEVPATLPPAIAIL 181

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN---KVPLNFDLLSLLDLVALATVCD 252
           NP R D       L   GV   + + +   LR+     + P   +L + LDLVAL T  D
Sbjct: 182 NPKRPDCGYAFKELAGVGVALNLALGLRAYLREMGWFARRP-EPNLKAYLDLVALGTAAD 240

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRI 311
           VVPL G+NR  V +GL V  +   PG++AL    ++   P++   + + + P +NA GR+
Sbjct: 241 VVPLAGVNRILVSQGLKVLAKSRRPGIEALKAVTHLEDRPVSLREVVFRLAPRLNAAGRM 300

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
           G++     LL+++D  +  +LA  LD LN+ R+ +E+ ++  AE ++L Q         +
Sbjct: 301 GQAQAALELLLTEDRDKARLLAGALDRLNRERQSLEAKIIRDAETQILQQ--GFGNRPAL 358

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V+ G+ WHPG++G++AA+L E+F RP   ++  ++G G GS RS+E FD+ K ++   E 
Sbjct: 359 VLAGEDWHPGVIGIVAAKLAERFFRPVALLTL-KNGVGRGSARSVEAFDLYKGLTSCQEH 417

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPV---FKIDGVLNASAV 488
             L++ GGHA AAG T+      R+ DF Q F   ++  L + P      +D V+  + +
Sbjct: 418 --LLQFGGHAAAAGFTLAP---DRVGDFRQAFEATVLQELGSEPKRPELAVDAVVTLAEL 472

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAF-R 547
           +      L+   P+G GNP PV A  + +L    VV   HL++   S+    + AIAF +
Sbjct: 473 DDEFFFHLDRLRPFGQGNPEPVLACLSAQLVDSWVVGEKHLKLKLASE-GRIMTAIAFDQ 531

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
               PL      + G R+        N+++G  + +LRVLD
Sbjct: 532 ASLHPLRGCYDVAFGTRL--------NFFQGRNQPELRVLD 564


>gi|77919486|ref|YP_357301.1| single-stranded-DNA-specific exonuclease RecJ [Pelobacter
           carbinolicus DSM 2380]
 gi|77545569|gb|ABA89131.1| exonuclease RecJ [Pelobacter carbinolicus DSM 2380]
          Length = 574

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 200/567 (35%), Positives = 296/567 (52%), Gaps = 19/567 (3%)

Query: 30  ALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQA 88
           A+A+ Q   +  + +  L+ R + S+D  + FL   +   MPDP ++ D DKA  R+ QA
Sbjct: 20  AVALQQCLGLSRLASEALLRRGLGSLDEVQAFLQAKLSS-MPDPCLMADMDKAVERLAQA 78

Query: 89  IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE 148
           + N EKI + GDYDVDG +  AL++  L       + +IP R+ DGYG + + +E     
Sbjct: 79  VCNREKIAVHGDYDVDGISGTALLVETLRAFGARVSYHIPLRLKDGYGVSAAALEDCATH 138

Query: 149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGH 208
           GA L +TVDCG +++     A   G+D+I+ DHHQV      A A+VNP+R D      +
Sbjct: 139 GATLAVTVDCGVSAHAQAMRAAELGLDLIITDHHQVPETLPAALAIVNPSRPDCGYPFKN 198

Query: 209 LCAAGVVFLVLVLIYRILRQ--DNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVK 266
           L   GV FL+LV + + LR     K     DL   LDLVAL T+ D+VPL GLNRA    
Sbjct: 199 LAGVGVAFLLLVALRKHLRDLGHWKTVCEPDLRYGLDLVALGTIADIVPLKGLNRALTKA 258

Query: 267 GLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDS 326
           GL +    G  GL+AL ++V     +T  ++G+ + P INA GR+ +  +G  LL+ +  
Sbjct: 259 GLELLSHSGRAGLQAL-KKVAGVDKVTCGSIGFRLAPRINAAGRLEDGAVGVELLLQESV 317

Query: 327 QELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLL 386
           Q+    A  LD +N +R+ +E   LEQA+ +   +      +  IV+  +RWHPG++G++
Sbjct: 318 QDAMATAEMLDRVNSDRQAIEQQTLEQADERWRQRSSGATHS--IVLADERWHPGVIGIV 375

Query: 387 AARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGL 446
           A+RL EK+ RP+  I+  E G G GSGRSI+G  + + +S    +  L   GGH  AAGL
Sbjct: 376 ASRLVEKYHRPTILIALNE-GVGKGSGRSIKGLHLYQALSDC--QAFLQGFGGHEYAAGL 432

Query: 447 TVERVNFGRLCDFFQKFA-HNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAG 505
           T++          F+K A   + P  +    F  DG ++   +++  ID L    P+G G
Sbjct: 433 TIDAGRVEAFARDFEKLARQTLSPEDLRFRQFH-DGEVSLEEIDLDSIDELSRLAPFGPG 491

Query: 506 NPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRM 565
           NP PV+      LQS++ V   HL+     Q    L  IAF      + E   Q  G + 
Sbjct: 492 NPQPVYLARGVHLQSVQRVGDKHLRF-IACQGGHGLPCIAF-----GMAERQAQLAGPQ- 544

Query: 566 HVTGHLCVNYWRGSKRCQLRVLDASPV 592
            +      N WR     QL+V D  PV
Sbjct: 545 DILFTPQRNEWRERVSVQLQVRDIRPV 571


>gi|20807647|ref|NP_622818.1| single-stranded DNA-specific exonuclease [Thermoanaerobacter
           tengcongensis MB4]
 gi|20516192|gb|AAM24422.1| Single-stranded DNA-specific exonuclease [Thermoanaerobacter
           tengcongensis MB4]
          Length = 820

 Score =  298 bits (762), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 193/577 (33%), Positives = 300/577 (51%), Gaps = 33/577 (5%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLIL 75
           +RWV  + +  + +   +  K+ +  IVA++L +R V     ++FL PS+  L+  P  L
Sbjct: 5   YRWV--VRERDLKKIEELKVKYHLDGIVAQILSSRGVK--GVEEFLMPSLDRLIS-PFEL 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
               +A   I + I     I I+GDYDVDG  S +L+   L       + YIP+R+ +GY
Sbjct: 60  KGVKEAKELIEKHIKEGSLITIYGDYDVDGITSTSLLYLALKKLGAKVDYYIPERLSEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYAL 194
           G N   +EK   EGA+L+ITVDCG T+   ++ A   G+DVI+ DHH +  EEIP A  +
Sbjct: 120 GINEEALEKIAYEGAKLVITVDCGITALKEVEKAKKMGLDVIITDHHSI-PEEIPKADVV 178

Query: 195 VNPNRLDDLSGQGHLCAAGVVF-LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +NP+ L        L   GV F L   LI                   LDLVAL TV D+
Sbjct: 179 INPH-LPGAYPFSELAGVGVAFKLAQALIGE------------QAFEFLDLVALGTVADI 225

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VPLIG NR  V +GL      GN GLKALIE   +S   +   ++G++I P +NA GR+ 
Sbjct: 226 VPLIGENRVIVKEGLKRLNNTGNLGLKALIEIAGVSGRELDEYHIGFIIAPRLNAAGRLK 285

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            +    RLLI+ D +E + +A  L+  N  R+ ME+ +L++A  K+  + + ++   VIV
Sbjct: 286 SAEAAVRLLITSDEKEAQDIAKYLNEENLRRQNMENTILKEAIEKI--EKEGLKDDKVIV 343

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           +  + WHPG++G++++++ E +GRPS  I    E+GK  GSGRS+EGF+I K +++   +
Sbjct: 344 LWQEGWHPGVIGIVSSKITEMYGRPSILIGLIGEEGK--GSGRSVEGFNIYKALNYC--K 399

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +LVK GGH MA GLT+++ N     D   ++A   V  +   P  KID V+     ++ 
Sbjct: 400 DLLVKYGGHEMAGGLTIQKENLKLFKDKINEYADRFVKEIDLVPALKIDAVVKKDKADLG 459

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGT 551
           +   ++   P+G GNP P+  F    +  I  +           +D    + + F     
Sbjct: 460 IAKKIQQLKPFGVGNPKPLLLFEGLTIDKIFDIKDGKHIKILAKKDEMVYELLIF----N 515

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              + L  S G  +   G L +++W G +   + V D
Sbjct: 516 SSSDGLKISEGDVVDAVGTLEISHWNGIESAIVNVKD 552


>gi|254479344|ref|ZP_05092681.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Carboxydibrachium pacificum DSM 12653]
 gi|214034710|gb|EEB75447.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Carboxydibrachium pacificum DSM 12653]
          Length = 820

 Score =  296 bits (759), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 193/577 (33%), Positives = 299/577 (51%), Gaps = 33/577 (5%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLIL 75
           +RWV  + +  + +   +  K+ +  IVA++L +R V     ++FL PS+  L+  P  L
Sbjct: 5   YRWV--VRERDLKKIEELKVKYHLDGIVAQILSSRGVK--GVEEFLMPSLDRLIS-PFKL 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
               +A   I + I     I I+GDYDVDG  S +L+   L       + YIP+R+ +GY
Sbjct: 60  KGVKEAKELIEKHIKEGSLITIYGDYDVDGITSTSLLYLALKKLGAKVDYYIPERLSEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYAL 194
           G N   +EK   EG +L+ITVDCG T+   ++ A   G+DVI+ DHH +  EEIP A  +
Sbjct: 120 GINEEALEKIAYEGTKLVITVDCGITALKEVEKAKKMGLDVIITDHHSI-PEEIPKADVV 178

Query: 195 VNPNRLDDLSGQGHLCAAGVVF-LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +NP+ L        L   GV F L   LI                   LDLVAL TV DV
Sbjct: 179 INPH-LPGAYPFSELAGVGVAFKLAQALIGE------------QAFEFLDLVALGTVADV 225

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VPLIG NR  V +GL      GN GLKALIE   +S   +   ++G++I P +NA GR+ 
Sbjct: 226 VPLIGENRVIVKEGLKRLNNTGNLGLKALIEIAGVSGRELDEYHIGFIIAPRLNAAGRLK 285

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            +    RLLI+ D +E + +A  L+  N  R+ ME+ +L++A  K+  + + ++   VIV
Sbjct: 286 SAEAAVRLLITSDEKEAQDIAKYLNEENLRRQNMENTILKEAIEKI--EKEGLKDDKVIV 343

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           +  + WHPG++G++++++ E +GRPS  I    E+GK  GSGRS+EGF+I K +++   +
Sbjct: 344 LWQEGWHPGVIGIVSSKITEMYGRPSILIGLIGEEGK--GSGRSVEGFNIYKALNYC--K 399

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +LVK GGH MA GLT+++ N     D   ++A   V  +   P  KID V+     ++ 
Sbjct: 400 DLLVKYGGHEMAGGLTIQKENLKLFKDKINEYADRFVKEIDLVPALKIDAVVKKDKADLG 459

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGT 551
           +   ++   P+G GNP P+  F    +  I  +           +D    + + F     
Sbjct: 460 IAKKIQQLKPFGVGNPKPLLLFEGLTIDKIFDIKDGKHIKILAKKDEMVYELLIF----N 515

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              + L  S G  +   G L +++W G +   + V D
Sbjct: 516 SSSDGLKISEGDVVDAVGTLEISHWNGIESAIVNVKD 552


>gi|300914189|ref|ZP_07131505.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           sp. X561]
 gi|307724576|ref|YP_003904327.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           sp. X513]
 gi|300889124|gb|EFK84270.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           sp. X561]
 gi|307581637|gb|ADN55036.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           sp. X513]
          Length = 815

 Score =  296 bits (757), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 185/575 (32%), Positives = 304/575 (52%), Gaps = 25/575 (4%)

Query: 16  FRWVSLLGQEGINRALAITQK-HAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLI 74
           +RW+  L +   +R     QK + +P I+A +L  R +++   K FLNP ++ L   P +
Sbjct: 9   YRWI--LKENKDSRLSEEVQKTYGLPKIIADMLSAR-LNLQEVKSFLNPDLKDLYS-PYL 64

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L    +A   I Q I + + I I+GDYDVDG  + +++   L       + YIP+R+V+G
Sbjct: 65  LRGIKEAKDLIQQHIASKDLITIYGDYDVDGITATSILYLTLKKLGAKVDYYIPERLVEG 124

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   ++K    G +LII+VDCG TS   ++ A   GIDVI+ DHH +  E   A  +
Sbjct: 125 YGINEEAIDKIAQRGTKLIISVDCGITSVKEVEKAKFLGIDVIITDHHSIPKEIPQADVV 184

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP+  D       L   GV F +           ++  +  +   LLD+V++ T+ D+V
Sbjct: 185 INPHLPDSEYPFCDLAGVGVAFKL-----------SQALIGEEAYELLDIVSIGTIADIV 233

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGE 313
           PL+G NR  V +GL       N GLKALI+   + +S I   ++G+++ P +NA GR+  
Sbjct: 234 PLLGENRIIVKEGLKRLNETQNIGLKALIKASGLQNSEIDEYHVGFILAPRLNAAGRLRS 293

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +    RLLIS D +E+E +A  L+  N NR+ +E+ +L++A  K+  +  D+ +  VIV+
Sbjct: 294 AEAAVRLLISQDEKEVEEIAEYLNQENLNRQQIENQILQEAIKKI-KETVDLNKEKVIVL 352

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WHPG++G++A+R+ E+F RPS  IS  E G+G GSGRSIEGF++ K + +   +  
Sbjct: 353 WDKNWHPGVIGIVASRITERFHRPSILISLGE-GEGKGSGRSIEGFNLYKALEYC--KDY 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+K GGH MAAG+ +E+ N         ++A  ++  L   P  +ID  +    ++I + 
Sbjct: 410 LIKYGGHEMAAGINIEKNNLEIFKTKINEYADTVLSDLDLIPSLRIDAKVKNEKIDIEIA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
             ++   P+G+ NP P F F    +  +  +N    +     +D    + + F    +  
Sbjct: 470 KQVQRFKPFGSNNPRPNFLFEGLTVTKVFDLNGGKYKKIIVQKDKFVYELMLFD--ASEK 527

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           G  +    G  + V G + +N W G +   + V D
Sbjct: 528 GNDV--KIGDVIDVVGSIEINSWNGIELVVINVKD 560


>gi|323490005|ref|ZP_08095226.1| single-stranded-DNA-specific exonuclease recJ [Planococcus
           donghaensis MPA1U2]
 gi|323396301|gb|EGA89126.1| single-stranded-DNA-specific exonuclease recJ [Planococcus
           donghaensis MPA1U2]
          Length = 780

 Score =  296 bits (757), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 197/556 (35%), Positives = 301/556 (54%), Gaps = 27/556 (4%)

Query: 39  IPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           I  ++A++LV R + + + A+ F+   +   M DP ++ D D A  RI QAI N EKI++
Sbjct: 27  ISSVLAKILVTRGLNTAEAARSFMKMDVSG-MHDPYLMKDMDIAIARIRQAIDNQEKIVV 85

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYD DG  S  +MM  L     + +  IP+R   GYGPN  L ++  + G +LI+TVD
Sbjct: 86  YGDYDADGVTSTTVMMTALQDLGADVSFMIPNRFKHGYGPNTDLFQQAFDNGTKLIVTVD 145

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVF 216
            G +  + + +A N G+DVI+ DHH +  E++P A A+V+P   +     G L   GV F
Sbjct: 146 NGISGIEQVDFANNLGMDVIISDHHDI-GEQLPNALAIVHPRHPEGHYPFGELAGVGVAF 204

Query: 217 LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGN 276
            +   +Y       +VP +     L++L A+ TV D+VPL G NR +V +GL       +
Sbjct: 205 KMAHALYE------EVPDH-----LIELTAIGTVADLVPLHGENRLFVKEGLAALIDSPS 253

Query: 277 PGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMK 335
           P + AL E   I    IT E +G+M GP INA GR+ +++   ++ +++D  E   LA  
Sbjct: 254 PAIGALCEVAGIKQQDITEETIGFMFGPRINAIGRLQDADPAVQMFLTEDPAEARSLASG 313

Query: 336 LDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFG 395
           LDVLN+ R+ +   + E+A  +V  +  +     V+VV  + W+PG+VG++A++L EKF 
Sbjct: 314 LDVLNKERQAIVKQITEEAMLQVEQRYPE-GVPRVLVVAQEGWNPGVVGIVASKLTEKFY 372

Query: 396 RPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
           RPS  +S   E+GK  GS RSI+GF +      A    IL   GGH MAAG+T+E  +  
Sbjct: 373 RPSIVLSLNPENGKAKGSARSIDGFHLYN--ELAKNRDILPHFGGHPMAAGMTLEASDVD 430

Query: 455 RLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFP 514
            L +   + A   + A    PV  ID  L    ++I  I+ + S  P+G G   P F   
Sbjct: 431 ELRERLIRQAETSLTAEDLLPVVDIDIPLRLDEIDITAIESMRSLAPFGMGFAKPKFYLE 490

Query: 515 NHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLC 572
           +  + SIR +  A  HL+M   +Q + TL A+ F +    +G+ L  +   ++ V G L 
Sbjct: 491 SVHVSSIRKIGAAQNHLKMEL-TQHAVTLDAVGFGLGS--VGDEL--TPDVKIDVIGDLQ 545

Query: 573 VNYWRGSKRCQLRVLD 588
           VN W G K+ QL V D
Sbjct: 546 VNEWNGRKKPQLMVED 561


>gi|108761402|ref|YP_632854.1| single-stranded-DNA-specific exonuclease RecJ [Myxococcus xanthus
           DK 1622]
 gi|108465282|gb|ABF90467.1| single-stranded-DNA-specific exonuclease RecJ [Myxococcus xanthus
           DK 1622]
          Length = 573

 Score =  296 bits (757), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 191/548 (34%), Positives = 295/548 (53%), Gaps = 30/548 (5%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLL-MP 70
           +S  RW  LL         ++  + ++  + A+VL++R   + + A  FL  S RL  +P
Sbjct: 1   MSSVRW--LLPDVVEQEVASLAGELSLHPLAAKVLLHRGYRTPESASAFL--SDRLADLP 56

Query: 71  DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
           DP  +     A  RI++AI + EK+ ++GDYDVDG  S +L+  F+         YIP R
Sbjct: 57  DPFRMKGMPGAVDRIIRAIRSREKVTLYGDYDVDGVCSTSLLYLFMKELGAPPATYIPHR 116

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           + +GYG N   +E+   EG ++++T+DCG TS   +  A   G+DV+V+DHH V     P
Sbjct: 117 LDEGYGLNVGAVERIAAEGTRVLVTLDCGITSVAEITRAKELGLDVLVVDHHTVPPTLPP 176

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD-----NKVPLNFDLLSLLDLV 245
           A A++NP++         LCAAGV F   + I + LR +      K P   +L S++DLV
Sbjct: 177 AVAVLNPHQPGCEYPTKALCAAGVAFNFCMGIRKRLRDEGFFATRKEP---NLRSMMDLV 233

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI--SSPITAENLGYMIGP 303
           ALATV DVVPL G NR  V  GL        PG++AL E   +   + +TA  +G+ +GP
Sbjct: 234 ALATVADVVPLTGANRILVTHGLQELSAGRRPGVRALKEVAGMDPDASVTAGQVGFRLGP 293

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INA GR+ +++LG +LL S+  +    LA  LD  N  R+ +ES++L QA    L Q +
Sbjct: 294 RINAAGRLHDASLGLQLLCSESPETARSLAAVLDRANAERQGIESSILTQA----LAQAE 349

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
            ++ A  +V+  + WHPG++G++A+R+ E+F RP+  +   +DG G GS RSIE F +  
Sbjct: 350 SLKDARGLVLYDEGWHPGVIGIVASRVVERFYRPTVMVGV-KDGVGKGSARSIEAFHLHD 408

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +S   E  +L + GGH  AAGLT++        + F+K A+  +      P  ++D V+
Sbjct: 409 ALSGCAE--LLTRFGGHKHAAGLTIDAERLPAFREAFEKIAYQRLTPEDLIPRCRVDAVV 466

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNH-----KLQSIRVVNLAHLQMTFESQDS 538
           N + ++   ++ L+  GP+G GNP PV            LQ        HL++     D+
Sbjct: 467 NPNELDAHAVESLQRLGPFGQGNPEPVLVLRRQVARPRVLQPKSGTGSGHLKLAL--ADA 524

Query: 539 ETLQAIAF 546
             L AI F
Sbjct: 525 PELDAIGF 532


>gi|126700361|ref|YP_001089258.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile 630]
 gi|115251798|emb|CAJ69633.1| Single-stranded-DNA-specific exonuclease [Clostridium difficile]
          Length = 816

 Score =  296 bits (757), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 186/577 (32%), Positives = 309/577 (53%), Gaps = 25/577 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLIL 75
           +W+  L  +G       ++K  I   + ++L NR +  +   + F+NPS+  L  DP ++
Sbjct: 3   KWI--LKYKGKIEESEFSKKLNISPEICQILKNRGICTEKDSEIFMNPSLDYLR-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  KA  RI  A+  +EKI I+GDYDVDG +S +++  +      N + YIP+R+ +GY
Sbjct: 60  KDMQKAVDRIKLAVEKNEKIWIYGDYDVDGVSSTSILCLYFKSIGYNVDYYIPNRLEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++   + G  LII+VDCG TS   +  A + GIDVI+ DHH+ +SE   A+A++
Sbjct: 120 GINEDAIKLISSRGCDLIISVDCGITSVSEVNTANDLGIDVIITDHHECQSEIPSAFAVI 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP + D       LC  GV F ++  +        K      + + L++V LAT+CD+VP
Sbjct: 180 NPKQEDCNYPFDSLCGCGVAFKMIQALTP------KEEFKTSMYNYLEIVTLATICDIVP 233

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           LI  NR  V  GL   +   N GL+ LI+   + S  I + ++G+ IGP INA GR+G S
Sbjct: 234 LIDENRIIVKNGLKSMKEGKNIGLRELIKVCGVESDKIGSSHIGFAIGPRINASGRLGYS 293

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            LG  L  +   +E   +A  L+  N  R+++E+ M  +AE ++L          V+V+ 
Sbjct: 294 YLGVELFTTQSQEEAVEIASILEEKNNERQMIEAKMYHEAE-EMLKSNSRYNDDKVLVLA 352

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + W  GI+G++A++L EK+ +P+  +   E+G+  GS RSI+GF+I + +     + ++
Sbjct: 353 KEGWQHGIIGIVASKLTEKYYKPTILLGI-ENGEATGSARSIKGFNIFEALIKC--KDLM 409

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFA-HNIVPALITTPVFKIDGVLNASAVNIALI 493
            K GGH  AAGL+++  N   L +   KFA +N+    +   V  ++  L  + +N+ L+
Sbjct: 410 TKFGGHEQAAGLSLDSDNVEILANEINKFADYNLTEDDMIENV-NVEFELQENVINLNLV 468

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGT 551
           + L    P+G  NPNP F   N+ L+ ++V+  N  HL+++ E + S   + I F +   
Sbjct: 469 EELHKLEPFGLNNPNPRFIVRNYILKDLKVIGKNQQHLKLSIEKEKS--YECIGFNMSHL 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
                 M   G ++ V   L  N + G+++ Q  + D
Sbjct: 527 K----SMYKVGDKVDVLFQLDENNYMGNRKVQFLLKD 559


>gi|284929094|ref|YP_003421616.1| exonuclease RecJ [cyanobacterium UCYN-A]
 gi|284809553|gb|ADB95258.1| exonuclease RecJ [cyanobacterium UCYN-A]
          Length = 650

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 179/563 (31%), Positives = 300/563 (53%), Gaps = 24/563 (4%)

Query: 33  ITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + ++  I D++ +V++NR +     A+ +LNP+  +L P      D  K+   + +AI  
Sbjct: 21  LAEEMKISDLIVKVILNRGIDTSSLARIYLNPNEEILPPPLAEFPDLYKSISLLTRAIKE 80

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
             KI I GDYD DG  S +L++R L +   + +  IPDRI DGYG N  ++E     G +
Sbjct: 81  KSKIAICGDYDADGMTSTSLLLRALKYFGGDIHYKIPDRIKDGYGINTQIVENLAKNGVE 140

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LI+TVD G ++YD +Q A   G++VI+ DHH +  +  PA A++NP  L   S    L  
Sbjct: 141 LILTVDNGISAYDPIQRAVELGVNVIITDHHDIPKKLPPADAILNPKLLSHESPYSGLAG 200

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV +++ + + + L +   +     + SLL+L  L T+ D+ PLIG+NR ++ +GL   
Sbjct: 201 VGVAYILALTLAQTLNKTEGI-----IASLLELFTLGTIADLAPLIGVNRRWLKQGLKQL 255

Query: 272 RRQGNPGLKALIERVNISSP---ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQE 328
                PG++ALI+   IS     + ++++G+ +GP INA GRIG+  +   LL +DD + 
Sbjct: 256 PNSQLPGIQALIKVSGISDEQKQLRSDDIGFKLGPRINAVGRIGDPKVAIELLTTDDPEL 315

Query: 329 LEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
               A++ + +N  R+ +   + ++A   V     + Q+  V+VV  D WH G++G++A+
Sbjct: 316 ALEKALECEEINNVRKSLCEKIEKEAINLVENTPLNYQEKRVLVVIKDEWHHGVIGIVAS 375

Query: 389 RLKEKFGRPSFAISFEEDG--KGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGL 446
           RL E++G P F  ++EE+   K  GS R I  FD+   + +   + +L K GGH  A G 
Sbjct: 376 RLVERYGVPVFIGTYEENDIEKIRGSARGIPEFDVFNALQYC--DDLLDKFGGHKAAGGF 433

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
            ++R           +F+H  +      P+ KID  +N   +N  L + L+S  P+G GN
Sbjct: 434 GLKRKYLNSFEKRLSEFSHQHLKLHHIKPLIKIDSEINFKDINHNLYETLDSLQPWGIGN 493

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGT--PLGEFLMQSRGKR 564
             P+F  PN  +   +++   HL+++    D E ++AIA+R +GT  PL         K+
Sbjct: 494 AIPIFWTPNVIILKQKIIGDNHLKISLVQNDGEKIEAIAWR-FGTYYPL--------PKQ 544

Query: 565 MHVTGHLCVNYWRGSKRCQLRVL 587
           + +   L  N W G    QL ++
Sbjct: 545 LDIAYKLSKNSWNGKSNIQLEIV 567


>gi|254976341|ref|ZP_05272813.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile QCD-66c26]
 gi|255093726|ref|ZP_05323204.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile CIP 107932]
 gi|255101917|ref|ZP_05330894.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile QCD-63q42]
 gi|255315478|ref|ZP_05357061.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile QCD-76w55]
 gi|255518141|ref|ZP_05385817.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile QCD-97b34]
 gi|255651257|ref|ZP_05398159.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile QCD-37x79]
 gi|260684321|ref|YP_003215606.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile CD196]
 gi|260687980|ref|YP_003219114.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile R20291]
 gi|306521099|ref|ZP_07407446.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile QCD-32g58]
 gi|260210484|emb|CBA64963.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile CD196]
 gi|260213997|emb|CBE06114.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile R20291]
          Length = 816

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 186/577 (32%), Positives = 309/577 (53%), Gaps = 25/577 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLIL 75
           +W+  L  +G       ++K  I   + ++L NR +  +   + F+NPS+  L  DP ++
Sbjct: 3   KWI--LKYKGKIEESEFSKKLNISPEICQILKNRGICTEKDSEIFMNPSLDYLR-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  KA  RI  A+  +EKI I+GDYDVDG +S +++  +      N + YIP+R+ +GY
Sbjct: 60  KDMQKAVDRIKLAVEKNEKIWIYGDYDVDGVSSTSILCLYFKSIGYNVDYYIPNRLEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++   + G  LII+VDCG TS   +  A + GIDVI+ DHH+ +SE   A+A++
Sbjct: 120 GINEDAIKLISSRGCDLIISVDCGITSVSEVNTANDLGIDVIITDHHECQSEIPSAFAVI 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP + D       LC  GV F ++  +        K      + + L++V LAT+CD+VP
Sbjct: 180 NPKQEDCNYPFDSLCGCGVAFKMIQALTP------KEEFKTSMYNYLEIVTLATICDIVP 233

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           LI  NR  V  GL   +   N GL+ LI+   + S  I + ++G+ IGP INA GR+G S
Sbjct: 234 LIDENRIIVKNGLKSMKEGKNIGLRELIKVCGVESDKIGSSHIGFAIGPRINASGRLGYS 293

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            LG  L  +   +E   +A  L+  N  R+++E+ M  +AE ++L          V+V+ 
Sbjct: 294 YLGVELFTTQSQEEAVEIASILEEKNNERQMIEAKMYHEAE-EMLKSNSRYNDDKVLVLA 352

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + W  GI+G++A++L EK+ +P+  +   E+G+  GS RSI+GF+I + +     + ++
Sbjct: 353 KEGWQHGIIGIVASKLTEKYYKPTILLGI-ENGEATGSARSIKGFNIFEALIKC--KDLM 409

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFA-HNIVPALITTPVFKIDGVLNASAVNIALI 493
            K GGH  AAGL+++  N   L +   KFA +N+    +   V  ++  L  + +N+ L+
Sbjct: 410 TKFGGHEQAAGLSLDSDNVEILANEINKFADYNLTEDDMIENV-NVEFELQENVINLNLV 468

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGT 551
           + L    P+G  NPNP F   N+ L+ ++V+  N  HL+++ E + S   + I F +   
Sbjct: 469 EELHKLEPFGLNNPNPRFIVRNYILKDLKVIGKNQQHLKLSIEKEKS--YECIGFNMSHL 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
                 M   G ++ V   L  N + G+++ Q  + D
Sbjct: 527 K----SMYKVGDKVDVLFQLDENNYMGNRKVQFLLKD 559


>gi|288555360|ref|YP_003427295.1| single-strand DNA-specific exonuclease [Bacillus pseudofirmus OF4]
 gi|288546520|gb|ADC50403.1| single-strand DNA-specific exonuclease [Bacillus pseudofirmus OF4]
          Length = 789

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 193/588 (32%), Positives = 309/588 (52%), Gaps = 31/588 (5%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW   + ++  ++A  +  +  + ++VA++LVNR +   + A+ FL  +  +   DP +L
Sbjct: 7   RWK--IQEQDEHKAGRLVSELGVDELVAQLLVNRGIETPEAARTFLY-TKEMTYHDPYLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              DKA  RI +AI N EKI+IFGDYD DG +S ++M+  L+      + YIP+R  +GY
Sbjct: 64  KGMDKAVARIKEAIANQEKILIFGDYDADGVSSTSVMIYTLNELGAVFDYYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN   + +   EG  L++TVD G ++      A    +D IV DHH+       AYA+V
Sbjct: 124 GPNEPALRRAKEEGYSLVVTVDTGISAVHEANVAKEIDLDFIVTDHHEAPPVLPEAYAIV 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLV-LVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           NP + D       L   GV F V   L+ RI ++            LLD+V + T+ D+V
Sbjct: 184 NPKQPDCTYPFKGLAGVGVAFKVSQALLGRIPKE------------LLDIVVIGTIADLV 231

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGE 313
           PLI  NR    +GL        PGL+AL++   I    +T +++G+ IGP INA GR+  
Sbjct: 232 PLIDENRLMAKEGLKALESTSKPGLRALMKVCGIGQDALTGDHVGFGIGPRINAAGRLDS 291

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           ++    L+I++DS E E LA ++D LN+ R+ + + + E+A  +V+       +  V+++
Sbjct: 292 ADPAVELMITNDSNEAEHLAAEIDSLNKQRQSIVNTITEEA-VEVVESKYPPDENDVLII 350

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
            G  W+ G++G++A+RL E+F RP+  +S  EE G   GS RSIEGFD+ K +S + +  
Sbjct: 351 AGAGWNAGVIGIVASRLVERFYRPTIVLSIDEEKGLAKGSARSIEGFDMFKELSKSRD-- 408

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           IL   GGH MAAGLT++  +   L +     A  ++      P+ KID       +++ +
Sbjct: 409 ILPHFGGHPMAAGLTMKEPDLNLLRERLNNQAKEVLTEEDFKPLTKIDLSTTVDRISLTV 468

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYG 550
           I  LE+  P+G  NP P        +  +R +     HL+M+F  Q+  +L  I F    
Sbjct: 469 IKQLEALAPFGVNNPTPKVMLEGVHIDQMRRIGSESNHLKMSF-VQNGASLDGIGFH--- 524

Query: 551 TPLGEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
             LG    + S+  ++   G L +N W G  + Q+ + D +  E   F
Sbjct: 525 --LGHLHDEISQTAKLSAIGTLSINEWNGHVKPQMMLEDLAVKEWQLF 570


>gi|304317001|ref|YP_003852146.1| single-stranded-DNA-specific exonuclease RecJ
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778503|gb|ADL69062.1| single-stranded-DNA-specific exonuclease RecJ
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 819

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 191/576 (33%), Positives = 305/576 (52%), Gaps = 31/576 (5%)

Query: 15  GFRWVSLLGQEGINRALA--ITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPD 71
            + WVS   ++ +N  L   I  K+ + + +A+ +VNR    +    ++LNP + + M  
Sbjct: 2   AYNWVS---KKILNENLVEKIKIKYKLKEYIAQTIVNRGYDDLKKVDEYLNPDLNM-MHS 57

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L   +KA+  I   I  + KI I+GDYDVDG    +++ + L     + N YIPDR+
Sbjct: 58  PFLLDGIEKASSVIKYHIEKNNKITIYGDYDVDGITGTSILYKTLKKLGADVNFYIPDRL 117

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYG N + +EK  N G+ LIITVDCG TS   +++A   GI++IV DHHQV      A
Sbjct: 118 QEGYGINLNAIEKIYNLGSSLIITVDCGITSVIEVEHAKKLGIEIIVTDHHQVPDVLPDA 177

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVF-LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
             ++NP+  +       L   GV F L L LI              D L  LD+VAL TV
Sbjct: 178 TCVINPHIKNCTYPYRELSGVGVAFKLCLALI------------GDDALDYLDIVALGTV 225

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGG 309
            D+VPL G NR  V +GL + +   N GLKALI    +++  I   ++G+++ P +NA G
Sbjct: 226 ADIVPLTGENRIIVKEGLKMMKNSKNKGLKALINVSGLNNKDINTYHVGFVLAPRLNAAG 285

Query: 310 RIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQAS 369
           R+  +     LL +DD  E   +A  L+  N  R+ +E  ML++A  +V T+  D+ +  
Sbjct: 286 RLESAVSCVNLLTTDDDIEANRIAEYLNSENIKRQELEKKMLDEAIVQVETKI-DLDKEK 344

Query: 370 VIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV 429
            IV+  + WHPGI+G++++R+ EK+ RPS  IS   D  G GSGRSI+GF+I   + +A 
Sbjct: 345 FIVLYSEDWHPGIIGIVSSRITEKYNRPSILISICGDT-GKGSGRSIKGFNIYDAIKYAG 403

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
           +   L+  GGH MAAG+T+++       D   ++A + +  +   P  +I+  +    ++
Sbjct: 404 D--CLIGFGGHEMAAGITIKKDEIESFKDKLNEYAESKLNDIDLIPTIEIETSIENETID 461

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPN-HKLQSIRVVNLAHLQMTFESQDSETLQAIAFRV 548
           +   + L    P+G  NP P +   + H  Q+  V N  HL++  +  D      I F +
Sbjct: 462 LEGANQLSLLEPFGNSNPMPAYIINHLHVKQTYTVGNNKHLRIIAQKNDM-CYDIILFHM 520

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
            G+   +F     G  + + G++ VN W G K+ ++
Sbjct: 521 -GSEANKF---KEGYIIDIAGYINVNEWNGDKKVEI 552


>gi|167040105|ref|YP_001663090.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           sp. X514]
 gi|166854345|gb|ABY92754.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           sp. X514]
          Length = 811

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 185/575 (32%), Positives = 304/575 (52%), Gaps = 25/575 (4%)

Query: 16  FRWVSLLGQEGINRALAITQK-HAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLI 74
           +RW+  L +   +R     QK + +P I+A +L  R +++   K FLNP ++ L   P +
Sbjct: 5   YRWI--LKENKDSRLSEEVQKTYGLPKIIADMLSAR-LNLQEVKSFLNPDLKDLYS-PYL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L    +A   I Q I + + I I+GDYDVDG  + +++   L       + YIP+R+V+G
Sbjct: 61  LRGIKEAKDLIQQHIASKDLITIYGDYDVDGITATSILYLTLKKLGAKVDYYIPERLVEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   ++K    G +LII+VDCG TS   ++ A   GIDVI+ DHH +  E   A  +
Sbjct: 121 YGINEEAIDKIAQRGTKLIISVDCGITSVKEVEKAKFLGIDVIITDHHSIPKEIPQADVV 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP+  D       L   GV F +           ++  +  +   LLD+V++ T+ D+V
Sbjct: 181 INPHLPDSEYPFCDLAGVGVAFKL-----------SQALIGEEAYELLDIVSIGTIADIV 229

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGE 313
           PL+G NR  V +GL       N GLKALI+   + +S I   ++G+++ P +NA GR+  
Sbjct: 230 PLLGENRIIVKEGLKRLNETQNIGLKALIKASGLQNSEIDEYHVGFILAPRLNAAGRLRS 289

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +    RLLIS D +E+E +A  L+  N NR+ +E+ +L++A  K+  +  D+ +  VIV+
Sbjct: 290 AEAAVRLLISQDEKEVEEIAEYLNQENLNRQQIENQILQEAIKKI-KETVDLNKEKVIVL 348

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WHPG++G++A+R+ E+F RPS  IS  E G+G GSGRSIEGF++ K + +   +  
Sbjct: 349 WDKNWHPGVIGIVASRITERFHRPSILISLGE-GEGKGSGRSIEGFNLYKALEYC--KDY 405

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+K GGH MAAG+ +E+ N         ++A  ++  L   P  +ID  +    ++I + 
Sbjct: 406 LIKYGGHEMAAGINIEKNNLEIFKTKINEYADTVLSDLDLIPSLRIDAKVKNEKIDIEIA 465

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
             ++   P+G+ NP P F F    +  +  +N    +     +D    + + F    +  
Sbjct: 466 KQVQRFKPFGSNNPRPNFLFEGLTVTKVFDLNGGKYKKIIVQKDKFVYELMLFD--ASEK 523

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           G  +    G  + V G + +N W G +   + V D
Sbjct: 524 GNDV--KIGDVIDVVGSIEINSWNGIELVVINVKD 556


>gi|125973861|ref|YP_001037771.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum ATCC 27405]
 gi|256004315|ref|ZP_05429297.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum DSM 2360]
 gi|281418022|ref|ZP_06249042.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum JW20]
 gi|125714086|gb|ABN52578.1| exonuclease RecJ [Clostridium thermocellum ATCC 27405]
 gi|255991749|gb|EEU01849.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum DSM 2360]
 gi|281409424|gb|EFB39682.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum JW20]
 gi|316939941|gb|ADU73975.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum DSM 1313]
          Length = 827

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 200/563 (35%), Positives = 308/563 (54%), Gaps = 20/563 (3%)

Query: 33  ITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           +++K  I  ++A + ++R V   DY KDFLNPS+  L  DP  L D +KA  RIV+A+  
Sbjct: 20  LSKKAGISKLLAGIFLSRGVDDPDYIKDFLNPSLDKLH-DPFELRDMEKAVDRIVKALRQ 78

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
           +EKI+I+GDYDVDG  S +++  F    + +   YIPDR+ +GYG + +  EK       
Sbjct: 79  NEKILIYGDYDVDGITSTSILYDFFRRQNADVCYYIPDRLNEGYGISMAAAEKMPEMDVD 138

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           L+ITVDCG T+++ ++Y T+  ID+I+ DHH+ +     A A+VNP+R D       L  
Sbjct: 139 LVITVDCGITAFEEVKYITDNNIDIIITDHHECRESVPDALAVVNPHRFDCAYPFKELAG 198

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV + +L      L +   +P  F+    LDLVAL TV DVVPL+G NR  V  GL + 
Sbjct: 199 VGVAYKLL----EALSKKMNIP-GFE-RQYLDLVALGTVADVVPLLGENRIIVKYGLPMI 252

Query: 272 RRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
            +  N GL++LI+   I +  I    +G+++ P INA GRIG+++   RLL +D+ +E  
Sbjct: 253 EKTSNVGLRSLIKVAGIENKEINTFLVGFVLAPRINAAGRIGDASRAVRLLTTDNEEEAL 312

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A +LD  N  R+  E  ++E+A   ++    D+Q+  VIVV G+RWH G++G++++++
Sbjct: 313 EIAKELDEQNIFRKQNELEIMEEA-VNIIETGIDLQREKVIVVAGERWHHGVIGIVSSKI 371

Query: 391 KEKFGRPSFAISFEEDGKGI-GSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
            E++ RPS  IS   DG+G  GS RSIEGF++ + +    +  +L K GGH  AAGL ++
Sbjct: 372 TERYYRPSVLISV--DGEGAKGSARSIEGFNLFEALVHCGK--VLEKYGGHEQAAGLALK 427

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
             N         ++A +++      P  KID  +    + +     L+   P+G  NP P
Sbjct: 428 PENIDEFRRMINEYADSVLDEDDLVPRMKIDVRITKEDMTLENCKELKLLEPFGESNPPP 487

Query: 510 VFAFPNHKLQSIRVVNLAHLQMTFESQDSETL-QAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           VF + N K+  IR V            D+ TL  AI F   G  L +    S    + V 
Sbjct: 488 VFRYDNLKVHEIRPVGQDSRHAKIRFDDNGTLIDAICFN--GGGLTDCYELS--DIVDVV 543

Query: 569 GHLCVNYWRGSKRCQLRVLDASP 591
             + +N W G +  QL + D  P
Sbjct: 544 CSMEINLWNGRENVQLNIKDIRP 566


>gi|255656731|ref|ZP_05402140.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile QCD-23m63]
          Length = 816

 Score =  294 bits (753), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 184/577 (31%), Positives = 308/577 (53%), Gaps = 25/577 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLIL 75
           +W+  L  +G       ++K  I   + ++L NR +  +   + F+NPS+  L  DP ++
Sbjct: 3   KWI--LKYKGKIEESEFSKKLNISPEICQILKNRGICTEKDSEIFMNPSLDYLR-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  KA  RI  A+  +EKI I+GDYDVDG +S +++  +      + + YIP+R+ +GY
Sbjct: 60  KDMQKAVDRIKSAVEKNEKIWIYGDYDVDGVSSTSILCLYFKSIGYHVDYYIPNRLEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++   + G  LII+VDCG TS   +  A + GIDVI+ DHH+ ++E   A+A++
Sbjct: 120 GINEDAIKLISSRGCDLIISVDCGITSVSEVNTANDLGIDVIITDHHECQNEIPVAFAVI 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP + D       LC  GV F ++  +        K      +   L++V LAT+CD+VP
Sbjct: 180 NPKQEDCNYPFDSLCGCGVAFKIIQALTP------KEEFKTSMYDYLEIVTLATICDIVP 233

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           LI  NR  V  GL   +   N GL+ LI+   + S  I + ++G+ IGP INA GR+G S
Sbjct: 234 LIDENRIIVKNGLKSMKEGKNIGLRELIKVCGVESDKIGSSHIGFAIGPRINASGRLGYS 293

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            LG  L  +   +E   +A  L+  N  R+++E+ M  +AE ++L          V+V+ 
Sbjct: 294 YLGVELFTTQSQEEAVEIASILEEKNNERQMIEAKMYHEAE-EMLKSNSRYNDDKVLVLA 352

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + W  GI+G++A++L EK+ +P+  +S  E+G+  GS RSI+GF+I +  +    + ++
Sbjct: 353 KEGWQHGIIGIVASKLTEKYYKPTILLSI-ENGEATGSARSIKGFNIFE--ALVKCKDLM 409

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFA-HNIVPALITTPVFKIDGVLNASAVNIALI 493
            K GGH  AAGL+++  N   L +   KFA +N+    +   +  ++  L  + +N+ L+
Sbjct: 410 TKFGGHEQAAGLSLDSDNVEILANEINKFADYNLTEDDMIENI-NVEFELQENVINLNLV 468

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGT 551
           + L    P+G  NPNP F   N+ L+ ++V+  N  HL++  E + S   + I F +   
Sbjct: 469 EELHKLEPFGLNNPNPRFIVRNYILKDLKVIGKNQQHLKLNIEKEKS--YECIGFNMSHL 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
                 M   G ++ V   L  N + G+++ Q  + D
Sbjct: 527 K----SMYKVGDKVDVLFQLDENNYMGNRKVQFLLKD 559


>gi|325570352|ref|ZP_08146167.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus ATCC 12755]
 gi|325156680|gb|EGC68856.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus ATCC 12755]
          Length = 766

 Score =  293 bits (751), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 189/583 (32%), Positives = 292/583 (50%), Gaps = 26/583 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDP 72
           + F WV     E       + Q   IP+ +  +L  RN+    A D FL+  ++ L  DP
Sbjct: 4   ANFHWVLPQDSEATPVFKELIQARKIPERIGALLWQRNIRTAEALDAFLSTDLQYLH-DP 62

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +  D DKA  RI +AI N E+I+I+GDYD DG  S  ++   L      A  Y+P+R  
Sbjct: 63  FLFHDMDKAVERIHEAILNGERILIYGDYDADGITSTTVLKETLELLGAEAEYYLPNRFS 122

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           DGYGPN ++ +  I  G QLIITVD G + ++A+ YA  QG+DVIV DHH++ +E   A+
Sbjct: 123 DGYGPNITVYKDKIAAGTQLIITVDNGVSGHEAIAYAQGQGVDVIVTDHHELPAELPEAF 182

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+V+P   +     G L   GV F V   +        +VP     + LLDLVA+ T+ D
Sbjct: 183 AIVHPRHPEGNYPFGDLAGVGVAFKVACALLE------EVP-----VELLDLVAIGTIAD 231

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE-NLGYMIGPSINAGGRI 311
           +V L   NR  V  GL + ++    GL  L+    +      E ++G+ +GP +NA GR+
Sbjct: 232 MVSLTDENRLLVSNGLKMIQQTDRLGLNELLTVSGLKKRTVNETDIGFAVGPRLNAIGRL 291

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
            + N   RLL + D +E   LA  LD +NQ R+     ++++A+ K+    D      ++
Sbjct: 292 EDPNPAVRLLTTFDEEEAVTLAKTLDTINQQRKTFVEEIMKEAQEKI----DPANHVHLV 347

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V  GD WH G++G++A R+ +  G+P   ++ +E+G   GSGRS+   ++ +M+  A  +
Sbjct: 348 V--GDNWHEGVLGIVAGRIMQSTGQPVIVLTKKENGLAKGSGRSVAALNLFEML--ATMK 403

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +    GGH  A GL++   +   L     ++       L       ID  L  + V+I 
Sbjct: 404 DMFTSFGGHHAAVGLSIPIDHLDMLQAQMNRYVEENGIDLSQGIPLAIDEELPLAEVSIN 463

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGT 551
            I+ L    P+G  NP P F F N   Q+ R +   +  +     D   LQ     V G 
Sbjct: 464 FIESLNVLAPFGTDNPLPKFLFSNLSTQNARQIGTENQHLKLVMTDESNLQ---LDVIGF 520

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
             G+  ++    R+ + G L +N W G+K+ QL +LD   VEG
Sbjct: 521 GFGKDSVEFENDRLSIVGQLSINEWNGNKKPQL-MLDDFAVEG 562


>gi|167037439|ref|YP_001665017.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|166856273|gb|ABY94681.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
          Length = 811

 Score =  293 bits (751), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 183/575 (31%), Positives = 303/575 (52%), Gaps = 25/575 (4%)

Query: 16  FRWVSLLGQEGINRALAITQK-HAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLI 74
           +RW+  L +   +R     QK + +P I+A +L  R +++   K FLNP ++ L   P +
Sbjct: 5   YRWI--LKENKDSRLSEEVQKTYGLPKIIADMLSAR-LNLQEVKSFLNPDLKDLYS-PYL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L    +A   I Q I + + I I+GDYDVDG  + +++   L       + YIP+R+V+G
Sbjct: 61  LRGIKEAKDLIQQHIASKDLITIYGDYDVDGITATSILYLTLKKLGAKVDYYIPERLVEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   ++K    G +LII+VDCG TS   ++ A   GIDVI+ DHH +  E   A  +
Sbjct: 121 YGINEEAIDKIAQRGTKLIISVDCGITSVKEVEKAKFLGIDVIITDHHSIPKEIPQADVV 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP+  D       L   GV F +           ++  +  +   LLD+V++ T+ D+V
Sbjct: 181 INPHLPDSEYPFCDLAGVGVAFKL-----------SQALIGEEAYELLDIVSIGTIADIV 229

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGE 313
           PL+G NR  V +GL       N GLKA+I+   + +  I   ++G+++ P +NA GR+  
Sbjct: 230 PLLGENRIIVKEGLKRLNETQNIGLKAIIKASGLENIEIDEYHVGFILAPRLNAAGRLRS 289

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +    RLLIS D +E+E +A  L+  N NR+ +E+ +L++A  K+  +  D+ +  VIV+
Sbjct: 290 AEAAVRLLISQDEKEVEEIAEYLNQENLNRQQIENQILQEAIKKI-KETVDLNKEKVIVL 348

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WHPG++G++A+R+ E+F RPS  IS  E G+G GSGRSIEGF++ K + +   +  
Sbjct: 349 WDKNWHPGVIGIVASRITERFHRPSILISLGE-GEGKGSGRSIEGFNLYKALEYC--KDY 405

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+K GGH MAAG+ +E+ N         ++A  ++  L   P  +ID  +    ++I + 
Sbjct: 406 LIKYGGHEMAAGINIEKNNLEIFKTKINEYADTVLSDLDLIPSLRIDAKVKNEKIDIEIA 465

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
             ++   P+G+ NP P F F    +  +  +N    +     +D    + + F    +  
Sbjct: 466 KQVQRFKPFGSNNPRPNFLFEGLTVTKVFDLNGGKYKKIIVQKDKFVYELMLFD--ASEK 523

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           G  +    G  + V G + +N W G +   + V D
Sbjct: 524 GNDV--KIGDVIDVVGSIEINSWNGIELVVINVKD 556


>gi|313672628|ref|YP_004050739.1| single-stranded-DNA-specific exonuclease recj [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939384|gb|ADR18576.1| single-stranded-DNA-specific exonuclease RecJ [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 586

 Score =  293 bits (750), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 194/588 (32%), Positives = 305/588 (51%), Gaps = 36/588 (6%)

Query: 16  FRWVSLLGQEG--INRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPL 73
           +RW+     E   I+  L   +   +P  +  VL+NR  +     D    +    M DP 
Sbjct: 15  YRWLYKKADEKKIIDLKLLYPE---LPKSILEVLINRGFTNKKEIDEFFEAPLSGMIDPF 71

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +L D  KA +R+V AI N EKI I+GDYDVDG  + +LM  FLS  +   + YIP+RI +
Sbjct: 72  LLKDIHKAVKRVVHAIKNREKICIYGDYDVDGITATSLMYEFLSSITPLVDYYIPNRIEE 131

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP--A 191
           GY  N   + +   +  +++ITVDCG TS D + YA + G+D IV DHHQ+ S+++P  A
Sbjct: 132 GYSLNIDALNELKKKDVKVVITVDCGITSIDEIDYAKSIGLDTIVTDHHQL-SDKLPSSA 190

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVF-LVLVLIYRILRQ-DNKVPLNFDLLSLLDLVALAT 249
           YA++NP +  D     HL   GV F  VL L Y I +Q D K+P    L   LDLVAL T
Sbjct: 191 YAIINPLQPGDAYPFKHLSGVGVAFKFVLALKYVIEKQFDIKLP---PLKYFLDLVALGT 247

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN--ISSPITAENLGYMIGPSINA 307
           + DVVP+IG NR +V  GL +      PG+ A +++++  IS+ +T+ N+GY + P INA
Sbjct: 248 IADVVPMIGENRIFVKHGLKLLENSPRPGI-AELKKISGLISTDLTSANIGYSLAPRINA 306

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GR+G+S    +LLI+ +  E +  A +L+  N+ R+ +E A+L++   K+  +  + + 
Sbjct: 307 VGRLGKSETSVKLLITKNQNEAKWFAEELETENRYRQELEKAVLKETIEKIERKKLNERY 366

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
            S+I+   + WHPG++G++A+RL E++ +P+  +S + D    GS RSI   DI   +  
Sbjct: 367 KSIIMYSKN-WHPGVIGIIASRLVERYSKPAIVLSIDND-LAKGSARSIPNIDIFSFLKT 424

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
             +  +L++ GGH  AAGL +   N   L      +     P     P   ID  LN   
Sbjct: 425 IPD--LLIEFGGHKYAAGLKLYTKNIRHLQRKLDDYIEKNSPNESLIPEIVIDAFLNPED 482

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA-- 545
           +N  L+  +    P+G  N  PVF      +Q ++       + +   ++   ++     
Sbjct: 483 INEDLVKYINKLRPFGNTNSEPVFC-----MQKVKKAQ----EFSIMGKEKNIIKGFIGK 533

Query: 546 ----FRVYGTPLGEFLMQSRG-KRMHVTGHLCVNYWRGSKRCQLRVLD 588
               F V G  +GE+    R      +   + +N W G    QL++ D
Sbjct: 534 NDSFFEVVGFNMGEYRDLIRSCDTFDIVFTIDINNWMGGSNIQLKLKD 581


>gi|320115852|ref|YP_004186011.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|319928943|gb|ADV79628.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 815

 Score =  293 bits (750), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 183/575 (31%), Positives = 303/575 (52%), Gaps = 25/575 (4%)

Query: 16  FRWVSLLGQEGINRALAITQK-HAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLI 74
           +RW+  L +   +R     QK + +P I+A +L  R +++   K FLNP ++ L   P +
Sbjct: 9   YRWI--LKENKDSRLSEEVQKTYGLPKIIADMLSAR-LNLQEVKSFLNPDLKDLYS-PYL 64

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L    +A   I Q I + + I I+GDYDVDG  + +++   L       + YIP+R+V+G
Sbjct: 65  LRGIKEAKDLIQQHIASKDLITIYGDYDVDGITATSILYLTLKKLGAKVDYYIPERLVEG 124

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   ++K    G +LII+VDCG TS   ++ A   GIDVI+ DHH +  E   A  +
Sbjct: 125 YGINEEAIDKIAQRGTKLIISVDCGITSVKEVEKAKFLGIDVIITDHHSIPKEIPQADVV 184

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP+  D       L   GV F +           ++  +  +   LLD+V++ T+ D+V
Sbjct: 185 INPHLPDSEYPFCDLAGVGVAFKL-----------SQALIGEEAYELLDIVSIGTIADIV 233

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGE 313
           PL+G NR  V +GL       N GLKA+I+   + +  I   ++G+++ P +NA GR+  
Sbjct: 234 PLLGENRIIVKEGLKRLNETQNIGLKAIIKASGLENIEIDEYHVGFILAPRLNAAGRLRS 293

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +    RLLIS D +E+E +A  L+  N NR+ +E+ +L++A  K+  +  D+ +  VIV+
Sbjct: 294 AEAAVRLLISQDEKEVEEIAEYLNQENLNRQQIENQILQEAIKKI-KETVDLNKEKVIVL 352

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WHPG++G++A+R+ E+F RPS  IS  E G+G GSGRSIEGF++ K + +   +  
Sbjct: 353 WDKNWHPGVIGIVASRITERFHRPSILISLGE-GEGKGSGRSIEGFNLYKALEYC--KDY 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+K GGH MAAG+ +E+ N         ++A  ++  L   P  +ID  +    ++I + 
Sbjct: 410 LIKYGGHEMAAGINIEKNNLEIFKTKINEYADTVLSDLDLIPSLRIDAKVKNEKIDIEIA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
             ++   P+G+ NP P F F    +  +  +N    +     +D    + + F    +  
Sbjct: 470 KQVQRFKPFGSNNPRPNFLFEGLTVTKVFDLNGGKYKKIIVQKDKFVYELMLFD--ASEK 527

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           G  +    G  + V G + +N W G +   + V D
Sbjct: 528 GNDV--KIGDVIDVVGSIEINSWNGIELVVINVKD 560


>gi|296452440|ref|ZP_06894141.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           difficile NAP08]
 gi|296877789|ref|ZP_06901815.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           difficile NAP07]
 gi|296258770|gb|EFH05664.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           difficile NAP08]
 gi|296431240|gb|EFH17061.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           difficile NAP07]
          Length = 816

 Score =  293 bits (750), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 184/577 (31%), Positives = 307/577 (53%), Gaps = 25/577 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLIL 75
           +W+  L  +G       ++K  I   + ++L NR +  +   + F+NPS+  L  DP ++
Sbjct: 3   KWI--LKYKGKIEESEFSKKLNISPEICQILKNRGICTEKDSEIFMNPSLDYLR-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  KA  RI  A+  +EKI I+GDYDVDG +S +++  +      + + YIP+R+ +GY
Sbjct: 60  KDMQKAVDRIKSAVEKNEKIWIYGDYDVDGVSSTSILCLYFKSIGYHVDYYIPNRLEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++   + G  LII+VDCG TS   +  A + GIDVI+ DHH+ ++E   A+A++
Sbjct: 120 GINEDAIKLISSRGCDLIISVDCGITSVSEVNTANDLGIDVIITDHHECQNEIPVAFAVI 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP + D       LC  GV F ++  +        K      +   L++V LAT+CD+VP
Sbjct: 180 NPKQEDCNYPFDSLCGCGVAFKIIQALTP------KEEFKTSMYDYLEIVTLATICDIVP 233

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           LI  NR  V  GL   +   N GL+ LI+   + S  I + ++G+ IGP INA GR+G S
Sbjct: 234 LIDENRIIVKNGLKSMKEGKNIGLRELIKVCGVESDKIGSSHIGFAIGPRINASGRLGYS 293

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            LG  L  +   +E   +A  L   N  R+++E+ M  +AE ++L          V+V+ 
Sbjct: 294 YLGVELFTTQSQEEAVEIASILKEKNNERQMIEAKMYHEAE-EMLKSNSRYNDDKVLVLA 352

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + W  GI+G++A++L EK+ +P+  +S  E+G+  GS RSI+GF+I +  +    + ++
Sbjct: 353 KEGWQHGIIGIVASKLTEKYYKPTILLSI-ENGEATGSARSIKGFNIFE--ALVKCKDLM 409

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFA-HNIVPALITTPVFKIDGVLNASAVNIALI 493
            K GGH  AAGL+++  N   L +   KFA +N+    +   +  ++  L  + +N+ L+
Sbjct: 410 TKFGGHEQAAGLSLDSDNVEILANEINKFADYNLTEDDMIENI-NVEFELQENVINLNLV 468

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGT 551
           + L    P+G  NPNP F   N+ L+ ++V+  N  HL++  E + S   + I F +   
Sbjct: 469 EELHKLEPFGLNNPNPRFIVRNYILKDLKVIGKNQQHLKLNIEKEKS--YECIGFNMSHL 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
                 M   G ++ V   L  N + G+++ Q  + D
Sbjct: 527 K----SMYKVGDKVDVLFQLDENNYMGNRKVQFLLKD 559


>gi|291286458|ref|YP_003503274.1| single-stranded-DNA-specific exonuclease RecJ [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290883618|gb|ADD67318.1| single-stranded-DNA-specific exonuclease RecJ [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 592

 Score =  293 bits (750), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 177/448 (39%), Positives = 262/448 (58%), Gaps = 16/448 (3%)

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P ++ D +KAA  I ++I N+ KI I+GDYDVDG  SVALM  FL     +   YIP+R+
Sbjct: 65  PFLIKDMEKAAAAIAESIKNNTKICIYGDYDVDGVTSVALMFLFLKEVGADVTYYIPNRL 124

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP- 190
            +GYG N + ++     G++LIITVDCG  + + +QYA + G++VI+ DHHQ  SE IP 
Sbjct: 125 QEGYGLNKTAIKDIAEAGSRLIITVDCGINAMEEVQYAVSMGVEVIITDHHQ-PSESIPE 183

Query: 191 -AYALVNPNRLDDLSGQGHLCAAGVVF-LVLVLIYRIL---RQDNKVPLNFDLLSLLDLV 245
            A A+VNP R DD S    L   GV F LV+ L Y++    R   K+P   ++   LDLV
Sbjct: 184 GAAAVVNPMREDDTSAFKGLSGVGVAFKLVMALRYKLNESGRFKGKIP---NIKKYLDLV 240

Query: 246 ALATVCDVVPLIGLNRAYVVKGL-MVARRQGNPGLKALIERVNIS-SPITAENLGYMIGP 303
            L T+ DVVPL+G NR  V  GL +++ +   PGL+ L     I    +T  ++G+ + P
Sbjct: 241 TLGTIADVVPLVGENRIIVRHGLEILSGKNCRPGLRELKRVAGIDGQKVTTTHVGFGLAP 300

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INA GR+G S+ G RLLI++D ++   LA +LD  N++R+ +E  ++E++  +V  +  
Sbjct: 301 RINAVGRMGASDKGLRLLITNDREQSLYLAEELDKENKSRQDIERHIIEESFKRV-EKNK 359

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
             ++   +V+  + WH G++G++A+RL EK+  P+  ++F EDG G GSGRSI  FD+ K
Sbjct: 360 LHEKYKGLVLYSEEWHQGVIGIVASRLVEKYNLPAIVLTF-EDGVGKGSGRSIPSFDLYK 418

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
                  + IL+  GGH  AAGL +E  +   L   F K   +++         KID ++
Sbjct: 419 --GLEQMQDILLSFGGHKYAAGLRIEEQHITSLQKRFHKAVEDLLEPKDFVAELKIDALM 476

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVF 511
             S V+  L+  L    PYGAGN  PVF
Sbjct: 477 EPSDVSSELMKWLGRMEPYGAGNREPVF 504


>gi|255307786|ref|ZP_05351957.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           difficile ATCC 43255]
          Length = 816

 Score =  293 bits (749), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 185/577 (32%), Positives = 308/577 (53%), Gaps = 25/577 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLIL 75
           +W+  L  +G       ++K  I   + ++L NR +  +   + F+NPS+  L  DP ++
Sbjct: 3   KWI--LKYKGKIEESEFSKKLNISPEICQILKNRGICTEKDSEIFMNPSLDYLR-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  KA  RI  A+  +EKI I+GDYDVDG +S +++  +      N + YIP+R+ +GY
Sbjct: 60  KDMQKAVDRIKLAVEKNEKIWIYGDYDVDGVSSTSILCLYFKSIGYNVDYYIPNRLEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++   +    LII+VDCG TS   +  A + GIDVI+ DHH+ +SE   A+A++
Sbjct: 120 GINEDAIKLISSRECDLIISVDCGITSVSEVNTANDLGIDVIITDHHECQSEIPSAFAVI 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP + D       LC  GV F ++  +        K      + + L++V LAT+CD+VP
Sbjct: 180 NPKQEDCNYPFDSLCGCGVAFKMIQALTP------KEEFKTSMYNYLEIVTLATICDIVP 233

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           LI  NR  V  GL   +   N GL+ LI+   + S  I + ++G+ IGP INA GR+G S
Sbjct: 234 LIDENRIIVKNGLKSMKEGKNIGLRELIKVCGVESDKIGSSHIGFAIGPRINASGRLGYS 293

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            LG  L  +   +E   +A  L+  N  R+++E+ M  +AE ++L          V+V+ 
Sbjct: 294 YLGVELFTTQSQEEAVEIASILEEKNNERQMIEAKMYHEAE-EMLKSNSRYNDDKVLVLA 352

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + W  GI+G++A++L EK+ +P+  +   E+G+  GS RSI+GF+I + +     + ++
Sbjct: 353 KEGWQHGIIGIVASKLTEKYYKPTILLGI-ENGEATGSARSIKGFNIFEALIKC--KDLM 409

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFA-HNIVPALITTPVFKIDGVLNASAVNIALI 493
            K GGH  AAGL+++  N   L +   KFA +N+    +   V  ++  L  + +N+ L+
Sbjct: 410 TKFGGHEQAAGLSLDSDNVEILANEINKFADYNLTEDDMIENV-NVEFELQENVINLNLV 468

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGT 551
           + L    P+G  NPNP F   N+ L+ ++V+  N  HL+++ E + S   + I F +   
Sbjct: 469 EELHKLEPFGLNNPNPRFIVRNYILKDLKVIGKNQQHLKLSIEKEKS--YECIGFNMSHL 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
                 M   G ++ V   L  N + G+++ Q  + D
Sbjct: 527 K----SMYKVGDKVDVLFQLDENNYMGNRKVQFLLKD 559


>gi|257875789|ref|ZP_05655442.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus EC20]
 gi|257809955|gb|EEV38775.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus EC20]
          Length = 758

 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 186/566 (32%), Positives = 290/566 (51%), Gaps = 30/566 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + Q+  IP+ +  +L  RN+    A D FL+  ++ L  DP +  D  KA  RI +AI N
Sbjct: 15  LIQERKIPERIGALLWQRNIRTAEALDAFLSTDLQYLH-DPFLFHDMAKAVERIHEAILN 73

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E+I+I+GDYD DG  S  ++   L      A  Y+P+R  DGYGPN ++ +  I  G Q
Sbjct: 74  GERILIYGDYDADGITSTTVLKETLELLGAEAEYYLPNRFTDGYGPNLTVYQDKIAAGTQ 133

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LIITVD G + ++A+ YA  QG+DVIV DHH++ +E   A+A+V+P         G L  
Sbjct: 134 LIITVDNGVSGHEAIAYAQGQGVDVIVTDHHELPAELPEAFAIVHPRHPQGNYPFGDLAG 193

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F V   +        +VP     + LLDLVA+ T+ D+V L   NR  V  GL + 
Sbjct: 194 VGVAFKVACALLE------EVP-----VELLDLVAIGTIADMVSLTDENRLLVSNGLKMI 242

Query: 272 RRQGNPGLKALIERVNISSPITAE-NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           ++    GL  L+    +      E ++G+ +GP +NA GR+ + N   RLL + D +E  
Sbjct: 243 QQSDRIGLNELLSVSGLKKQTVNETDIGFAVGPRLNAIGRLEDPNPAVRLLTTFDEEEAV 302

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            LA  LD +NQ R+     ++++A+ K+    D      ++V  GD WH G++G++A R+
Sbjct: 303 SLAKTLDTINQQRKTFVEEIMKEAQEKI----DPANHVHLVV--GDHWHEGVLGIVAGRI 356

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
            +  G+P   ++ +E+G   GSGRSI   ++ +M+S    + +    GGH  A GL++  
Sbjct: 357 MQSTGQPVIVLTKKENGLAKGSGRSIAALNLFEMLS--TMKDMFTSFGGHHAAVGLSIPI 414

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            +   L     ++       L       ID  L  + V+I+ I+ L+   P+G  NP P 
Sbjct: 415 DHLDMLQAQMNRYVEENAIDLSQGIPLAIDEELPLTEVSISFIESLKVLAPFGTDNPLPK 474

Query: 511 FAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           F F N   Q+ R +     HL++    + +  L  I F       G+ L+     R+ + 
Sbjct: 475 FLFSNLMTQNARQIGSENQHLKLVMSDESNTQLDVIGF-----GFGKDLVAFENDRLSIV 529

Query: 569 GHLCVNYWRGSKRCQLRVLDASPVEG 594
           G L +N W G+K+ QL +LD   VEG
Sbjct: 530 GQLSINEWNGNKKPQL-MLDDFAVEG 554


>gi|260887826|ref|ZP_05899089.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           sputigena ATCC 35185]
 gi|330838607|ref|YP_004413187.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           sputigena ATCC 35185]
 gi|260862432|gb|EEX76932.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           sputigena ATCC 35185]
 gi|329746371|gb|AEB99727.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           sputigena ATCC 35185]
          Length = 656

 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 180/567 (31%), Positives = 309/567 (54%), Gaps = 24/567 (4%)

Query: 29  RALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLILTDCDKAARRIVQ 87
           RA+  +Q+       A +L++R ++ D  A+ FL+P  +    DP ++ D +KA  RI Q
Sbjct: 14  RAVEFSQRIGTTPFTAALLLHRGITSDEEARAFLHPE-KQPFHDPFLMRDMEKAVSRIEQ 72

Query: 88  AIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFIN 147
           AI   E+I+++GDYDVDG  + +L+ R L      A+ +IP R  DGYG +   +++ I 
Sbjct: 73  AIEAQERIVVYGDYDVDGITATSLLCRNLRQLGAAADYFIPHRQKDGYGLHKETLDEIIA 132

Query: 148 EGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQG 207
            GA+LI+TVDCG ++ +    A ++ +D+I+ DHH    E   A A+++P+R D      
Sbjct: 133 GGARLIVTVDCGISAVEEAAAAKDK-VDLIITDHHLPGKELPKALAVIDPHRADCSYPDK 191

Query: 208 HLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKG 267
           ++   GV F +   +++ +R              LD+VAL TV DVVPL+G NR  V +G
Sbjct: 192 NIAGVGVAFKLCQALWQKMRGKA-------FTGDLDIVALGTVADVVPLLGENRKIVQQG 244

Query: 268 LMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDS 326
           L V ++   PG++AL+    +    ITA ++G+++ P +NA GR+  +  G  LL+++D 
Sbjct: 245 LRVLKKSKRPGIQALLAVTELQEKEITAGHIGFVLAPRLNAAGRLASALRGVELLLTEDG 304

Query: 327 QELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLL 386
           +E + +A +LD  N+ R+ +E  +L+ AE ++  +  D+++A V+V+ G+ WHPG++G++
Sbjct: 305 EEAQAIAEELDAANRERQAVEQEILQVAEKQI--EEIDVKRAHVLVLHGEGWHPGVIGIV 362

Query: 387 AARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGL 446
           A+R+ E++ RP+  I+ EEDG G GS RSI GF + + +S   E   L+  GGHA AAGL
Sbjct: 363 ASRIVERYYRPTVIIA-EEDGIGKGSCRSIRGFHMFEALSACGEH--LLGFGGHAQAAGL 419

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           ++   +     +  + +A  ++      P+  I+  L    +   L+  ++   PYG GN
Sbjct: 420 SLRSADVASFREAMEAYAAKVLTEEDFVPILDIELELAPEKITEQLMTEIKLLEPYGMGN 479

Query: 507 PNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKR 564
           P P+F+    +    R +     HL+   +  D+    +I    +G   GE       +R
Sbjct: 480 PKPLFSTHGVRGSYARQIGKEGQHLKFELDGLDA----SIDVLAWGK--GEEAPLVNRER 533

Query: 565 MHVTGHLCVNYWRGSKRCQLRVLDASP 591
           + +      + WR  +  QL + D  P
Sbjct: 534 IDIAYFPEYHVWREKRSLQLMLEDFRP 560


>gi|307243796|ref|ZP_07525927.1| single-stranded-DNA-specific exonuclease RecJ [Peptostreptococcus
           stomatis DSM 17678]
 gi|306492799|gb|EFM64821.1| single-stranded-DNA-specific exonuclease RecJ [Peptostreptococcus
           stomatis DSM 17678]
          Length = 827

 Score =  292 bits (747), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 179/523 (34%), Positives = 288/523 (55%), Gaps = 17/523 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           +W  L  QE     L   +  +I   + ++L+NR + S D  + F +PS++ L  DP +L
Sbjct: 3   KWNILHRQEPSRNDL--MESMSISKEIGQILLNRGIESQDQVEMFTDPSLKYLR-DPFLL 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA  RI QAI   EKI IFGDYDVDG +S ++M+ +        + YIP+R+ +GY
Sbjct: 60  KDMDKAVERIRQAISRKEKIWIFGDYDVDGVSSTSIMVLYFKSIGYPVDYYIPNRLEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++   ++  +LIITVDCG TS   ++YA   GIDVI+ DHH+ +     AYA+V
Sbjct: 120 GLNIEAIDHIGSQDGRLIITVDCGITSVKEVEYARGLGIDVIITDHHECQESLPAAYAVV 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       +C  GV F ++      L  +     N +    L++V+LAT+CD++P
Sbjct: 180 DPKREDCSYPFEGICGCGVAFKLI----HALSGNEDFYKNIN--RYLEIVSLATICDIMP 233

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           ++  NR  V  G+ +  +  N G+KAL+E   +  + I + +LG+ IGP INA GR+G S
Sbjct: 234 ILDENRIIVKNGMEILGQGNNIGMKALLEVCGLDGTKIKSSHLGFAIGPRINASGRLGFS 293

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           NLG  L  SD+ QE   LA+ +D  N  R+ +E+ +  + E  ++++    +   V+VV 
Sbjct: 294 NLGVDLFTSDNLQEARNLALMMDTKNTERQEVEARIHMEVE-DIISKDPSYRDDKVLVVS 352

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
           G+ WH GI+G++A+++ EK+ +P   +  EE    +GS RSI+GFDI    +       +
Sbjct: 353 GEDWHHGIIGIVASKVTEKYYKPCILLC-EEGDIAVGSARSIKGFDI--FSALYECRDYM 409

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
            K GGH  AAG+++E    G L +   + A+  +       V +++  ++ S++N+ L++
Sbjct: 410 TKFGGHQQAAGMSMEVAKIGLLREKINQIANYELDQEDLVEVIRVEYEIDQSSLNLDLVE 469

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFES 535
            L    P+G  NP P F      L+ +  +  +  HL+M  E 
Sbjct: 470 NLHLLEPFGIKNPTPYFMLRKCLLKRLMTIGRDKNHLKMVVEK 512


>gi|295105336|emb|CBL02880.1| exonuclease RecJ [Faecalibacterium prausnitzii SL3/3]
          Length = 710

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 167/445 (37%), Positives = 252/445 (56%), Gaps = 14/445 (3%)

Query: 69  MPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP 128
           + DP +LTD D A +RI QAI N E I +FGDYDVDG  + AL+ + L          +P
Sbjct: 85  LSDPALLTDMDAACQRIWQAIDNGETIAVFGDYDVDGVTATALLYQHLKGMGATVKCMLP 144

Query: 129 DRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE 188
            R  DGYG + + ++   N+G  LI+TVD G ++ +   +A + G+D+I+ DHH +  E 
Sbjct: 145 SREGDGYGLSKNAIQSMHNKGCTLIVTVDNGISAVEEADFAASLGMDLIITDHH-LPPET 203

Query: 189 IP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVAL 247
           +P A A+V+P R DD S    LC AGV F +   +       +  P    L    DL A+
Sbjct: 204 LPKAVAVVDPRREDDHSPFKGLCGAGVAFKLCAAL-------DGCPPEEMLDYCGDLAAV 256

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSIN 306
            TV DV+PL+G NR  V  GL   ++   PG  AL+E V ++  PITAEN+ Y I P IN
Sbjct: 257 GTVADVMPLVGENRTLVKAGLRQLQQTDRPGFGALLEEVGLAGKPITAENISYAIAPRIN 316

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           A GR+  +    +L++ +D    E LA KL+ +N +R+  E  + + AE ++L Q  +  
Sbjct: 317 AAGRMDNAVTALQLVLCEDPDRAEELAHKLNEINAHRQETEQQIFKAAE-ELLEQQPERL 375

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
              ++++ G  WHPG++G++A+RL E+ GRP   ++ +E G+G GSGRS++GF++   + 
Sbjct: 376 DDRIMLLWGRDWHPGVIGIVASRLVERTGRPVIVVTIDEHGEGKGSGRSVQGFNLHACIG 435

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
              +  +LV+ GGHAMAAGL+V   N  +L     ++A    P L  TP    D  ++  
Sbjct: 436 SCAD--LLVRYGGHAMAAGLSVREENLPQLRRRLNEWAARECPVL-HTPPLTCDVAIHLD 492

Query: 487 AVNIALIDMLESAGPYGAGNPNPVF 511
            + +  +  L+   PYGA NP PVF
Sbjct: 493 RITVECVRHLDQLAPYGAENPTPVF 517


>gi|310822730|ref|YP_003955088.1| single-stranded-DNA-specific exonuclease recj [Stigmatella
           aurantiaca DW4/3-1]
 gi|309395802|gb|ADO73261.1| Single-stranded-DNA-specific exonuclease RecJ [Stigmatella
           aurantiaca DW4/3-1]
          Length = 570

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 194/586 (33%), Positives = 309/586 (52%), Gaps = 34/586 (5%)

Query: 16  FRWVSLLGQEGINRALA-ITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDPL 73
            RW   L  E +++ +A + ++  +  + ARVL++R      A   FL+  +  L PDP 
Sbjct: 1   MRW---LLPEAVDQQVASLARELGLHPLSARVLLHRGYRTPEAVSAFLSDKLADL-PDPF 56

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +L     A  R+ +A+   EKI ++GDYDVDG  S +L+  FL         YIP R+ +
Sbjct: 57  LLKGMTSAVERLARALRLGEKITLYGDYDVDGVCSTSLLTLFLRQLGAQPATYIPHRLGE 116

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG N   M++   EG +L++T+DCG TS   +  A   G+DV+++DHH V +    A A
Sbjct: 117 GYGLNLQAMDRIAQEGTRLLVTLDCGITSVAEVARARELGMDVVIVDHHTVPTTLPAAVA 176

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD-----NKVPLNFDLLSLLDLVALA 248
           ++NP++         LCAAGV F + + + + LR +      K PL   L  L+DLVALA
Sbjct: 177 VLNPHQPGCDYPTKTLCAAGVAFNLCMGLRKHLRDEGFFATRKEPL---LKGLMDLVALA 233

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI--SSPITAENLGYMIGPSIN 306
           TV DVVPL G NR  V  GL        PG++AL E   +   +P+TA  +G+ +GP IN
Sbjct: 234 TVADVVPLTGANRILVAHGLQELTAARRPGVRALKEVAGVEPEAPVTAGQVGFRLGPRIN 293

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           A GR+ +++LG +LL ++  ++   LA  LD  N  R+ +ES++L +A    L Q + + 
Sbjct: 294 AAGRLHDASLGLQLLTAESLEDARRLAGVLDRANAERQGIESSILTEA----LKQAESLP 349

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            A  +V+  + WHPG++G++A+R+ E+F RP+  +   E G G GS RSIEGF +   + 
Sbjct: 350 HARGLVLYAEGWHPGVIGIVASRVVERFHRPTVMVGVNE-GIGKGSARSIEGFHLYDALH 408

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
              +  +L + GGH  AAGLT+E        + F++ A   +      P  K+D V+   
Sbjct: 409 GCAD--MLSRFGGHKYAAGLTIEAGRLPAFREAFERIALERLTPEDLIPRCKVDAVVTPH 466

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV----NLAHLQMTFESQDSETLQ 542
            ++   ++ L+  GP+G GNP PV      ++   RV+       H  +     D+  + 
Sbjct: 467 ELDERAVESLQRLGPFGQGNPEPVLVL-RKQMARPRVLPPKTGHGHAHLKLALVDAPGVD 525

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AI F      + + L    G  + +   + ++ +RG +R  LR+ D
Sbjct: 526 AIGFG-----MADRLSLVEGP-VDLAFQVGMDTFRGQRRVSLRLKD 565


>gi|76786929|ref|YP_329907.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae A909]
 gi|77405405|ref|ZP_00782499.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae H36B]
 gi|76561986|gb|ABA44570.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae A909]
 gi|77175987|gb|EAO78762.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae H36B]
          Length = 732

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 195/585 (33%), Positives = 301/585 (51%), Gaps = 40/585 (6%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           + + WV L  Q+        ++K  I + VA ++ +R +        FL  ++  L  DP
Sbjct: 4   AKYSWV-LNNQKPDAGFFEASKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  
Sbjct: 62  YLLNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFT 121

Query: 133 DGYGPNPSLMEKFI-NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           DGYGPN S+ + FI  +G  LIITVD G   ++A+ YA NQG+DV+V DHH + ++   A
Sbjct: 122 DGYGPNESVYKYFIEQQGVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P   D      +L   GV F V   +   +  +           +LDLVA+ T+ 
Sbjct: 182 YAIIHPEHPDANYPFPYLAGCGVAFKVACALLETIPTE-----------MLDLVAIGTIA 230

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR
Sbjct: 231 DMVSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGR 290

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           + + N    LL   D +E + +A  +D  N+ R+ +   + +QA  ++L Q   +Q    
Sbjct: 291 LDDPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQA-MQMLDQTKPVQ---- 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
            V+  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI +  +F   
Sbjct: 346 -VLAKENWHPGVLGIVAGRILERTGQPVIVLNI-EDGIAKGSARSVEALDIFQ--AFDQH 401

Query: 431 EGILVKGGGHAMAAGLTVERVNFGR----LCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
             + +  GGH+ AAG+T+E    G     LCD+  K   ++      T    ID  L   
Sbjct: 402 RELFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMGQKKTLT----IDSELRFD 457

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAI 544
            +++  +   E   P+G  N  PVF   + K+   RV+  N AHL++  E QD + L  +
Sbjct: 458 ELSLDTVRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLV 516

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF + G+ L EF  Q++   + VT  L VN W G+   QL + DA
Sbjct: 517 AFNM-GSQLQEF-QQAQHLELAVT--LSVNQWNGATTLQLMLEDA 557


>gi|332637914|ref|ZP_08416777.1| single-stranded DNA-specific exonuclease [Weissella cibaria KACC
           11862]
          Length = 768

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 195/565 (34%), Positives = 307/565 (54%), Gaps = 32/565 (5%)

Query: 30  ALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQA 88
           A  I +   + ++VA++LVNR   +I+ A  FL P +  L  DP +L D D A  RI+ A
Sbjct: 19  AKEIAETFGVSELVAKILVNRGYDTIETANAFLRPGVEGLY-DPFLLHDMDVAITRIMTA 77

Query: 89  IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE 148
           I N EKI+++GDYDVDG  S A+M   L     + + Y+P+R  DGYGPN +  ++   E
Sbjct: 78  IDNGEKIVVYGDYDVDGITSTAIMTWALELMGADVSYYVPNRFKDGYGPNLAQYQRLAGE 137

Query: 149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGH 208
           G QL+ITVD G +  D + +  N G+DVIV DHH++ +E   A A+V+P   D     G 
Sbjct: 138 GMQLLITVDNGVSGRDEVAWLMNNGVDVIVTDHHEMPAELPEAVAVVHPRHPDGAYPFGG 197

Query: 209 LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGL 268
           L  AGV F V   +        + P +     ++DL AL  V DV+ L+  NRA V  GL
Sbjct: 198 LSGAGVAFKVASALL-------EEPAD----EVMDLAALGAVADVMELVDENRAIVAMGL 246

Query: 269 MVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQ 327
              +    PGL AL++    + + I +  +G+ IGP +NA GR+ ++  G RLL++DD +
Sbjct: 247 ANLKEDPRPGLAALLQTAGTNQADIDSMTIGFTIGPRLNALGRLADATDGVRLLLADDPE 306

Query: 328 ELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLA 387
           E   LA +++ LN+ R+ + + + ++A A+  T   D     V+V+ G  WH G++G++A
Sbjct: 307 EASALAGQIETLNRERQELVATISDEALAQAQTLAAD----PVLVIAGHGWHEGVLGIVA 362

Query: 388 ARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG---ILVKGGGHAMAA 444
           +++ E  G+P+  ++ +EDG+  GSGRS+  FD+     FA  +G   +L   GGHA AA
Sbjct: 363 SKVVEATGKPAIVLN-DEDGQMKGSGRSVPAFDL-----FAGLDGHRDLLTAFGGHASAA 416

Query: 445 GLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGA 504
           G+T+   N   + D  +  A     A    P  +I   + A   N    + L+   P+G 
Sbjct: 417 GMTIPTANLQAVRDVLRTEADAQGLAEAGLPEIRIAAEVTAKEFNAQNYEQLQVLAPFGE 476

Query: 505 GNPNPVFAFPNHKLQSIRVVNLA-HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGK 563
           GNP P+FA   + +Q+++ ++   HL+ T  +Q   +L  IAF   G+ L E L   R +
Sbjct: 477 GNPEPLFAVALNGVQNVKTMSEGKHLRFTASTQVG-SLPVIAFG-RGS-LAEDLA-GRFE 532

Query: 564 RMHVTGHLCVNYWRGSKRCQLRVLD 588
            + + G +  N +RG    Q+ + D
Sbjct: 533 SIKIVGTMSENRFRGDVTYQMMLTD 557


>gi|257866155|ref|ZP_05645808.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus EC30]
 gi|257872485|ref|ZP_05652138.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus EC10]
 gi|257800089|gb|EEV29141.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus EC30]
 gi|257806649|gb|EEV35471.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus EC10]
          Length = 758

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 186/566 (32%), Positives = 290/566 (51%), Gaps = 30/566 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + Q+  IP+ +  +L  RN+    A D FL+  ++ L  DP +  D  KA  RI +AI N
Sbjct: 15  LIQERKIPERIGALLWQRNIRTAEALDAFLSTDLQYLH-DPFLFHDMAKAVERIHEAILN 73

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E+I+I+GDYD DG  S  ++   L      A  Y+P+R  DGYGPN ++ +  I  G Q
Sbjct: 74  GERILIYGDYDADGITSTTVLKETLELLGAEAEYYLPNRFTDGYGPNLTVYQDKIAAGTQ 133

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LIITVD G + ++A+ YA  QG+DVIV DHH++ +E   A+A+V+P         G L  
Sbjct: 134 LIITVDNGVSGHEAIAYAQGQGVDVIVTDHHELPAELPEAFAIVHPRHPQGNYPFGDLAG 193

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F V   +        +VP     + LLDLVA+ T+ D+V L   NR  V  GL + 
Sbjct: 194 VGVAFKVACALLE------EVP-----VELLDLVAIGTIADMVSLTDENRLLVSNGLKMI 242

Query: 272 RRQGNPGLKALIERVNISSPITAE-NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           ++    GL  L+    +      E ++G+ +GP +NA GR+ + N   RLL + D +E  
Sbjct: 243 QQSDRIGLNELLSVSGLKKQTVNETDIGFAVGPRLNAIGRLEDPNPAVRLLTTFDEEEAV 302

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            LA  LD +NQ R+     ++++A+ K+    D      ++V  GD WH G++G++A R+
Sbjct: 303 SLAQTLDTINQQRKTFVEEIMKEAQEKI----DPANHVHLVV--GDHWHEGVLGIVAGRI 356

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
            +  G+P   ++ +E+G   GSGRSI   ++ +M+S    + +    GGH  A GL++  
Sbjct: 357 MQSTGQPVIVLTKKENGLAKGSGRSIAALNLFEMLS--TMKDMFTSFGGHHAAVGLSIPI 414

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            +   L     ++       L       ID  L  + V+I+ I+ L+   P+G  NP P 
Sbjct: 415 DHLDMLQAQMNRYVEENGIDLSQGIPLAIDEELPLTEVSISFIESLKVLAPFGTDNPLPK 474

Query: 511 FAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           F F N   Q+ R +     HL++    + +  L  I F       G+ L+     R+ + 
Sbjct: 475 FLFSNLMTQNARQIGSENQHLKLVMSDESNTQLDVIGF-----GFGKDLVAFENDRLSIV 529

Query: 569 GHLCVNYWRGSKRCQLRVLDASPVEG 594
           G L +N W G+K+ QL +LD   VEG
Sbjct: 530 GQLSINEWNGNKKPQL-MLDDFAVEG 554


>gi|160945517|ref|ZP_02092743.1| hypothetical protein FAEPRAM212_03046 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443248|gb|EDP20253.1| hypothetical protein FAEPRAM212_03046 [Faecalibacterium prausnitzii
           M21/2]
          Length = 710

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 167/445 (37%), Positives = 252/445 (56%), Gaps = 14/445 (3%)

Query: 69  MPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP 128
           + DP +LTD D A +RI QAI N E I +FGDYDVDG  + AL+ + L     +    +P
Sbjct: 85  LSDPALLTDMDAACQRIWQAIDNGETIAVFGDYDVDGVTATALLYQHLKGMGASVKCMLP 144

Query: 129 DRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE 188
            R  DGYG + + ++   N+G  LI+TVD G ++ +   +A + G+D+I+ DHH +  E 
Sbjct: 145 SREGDGYGLSKNAIQSMHNKGCTLIVTVDNGISAVEEADFAASLGMDLIITDHH-LPPET 203

Query: 189 IP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVAL 247
           +P A A+V+P R DD S    LC AGV F +   +       +  P    L    DL A+
Sbjct: 204 LPKAVAVVDPRREDDHSPFKGLCGAGVAFKLCAAL-------DGCPPEEMLDYCGDLAAV 256

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSIN 306
            TV DV+PL+G NR  V  GL   ++   PG  AL+E V ++  PITAEN+ Y I P IN
Sbjct: 257 GTVADVMPLVGENRTLVKAGLRQLQQTDRPGFGALLEEVGLAGKPITAENISYAIAPRIN 316

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           A GR+  +    +L++ +D    E LA KL+ +N +R+  E  + + AE ++L Q  +  
Sbjct: 317 AAGRMDNAVTALQLVLCEDPDRAEELAHKLNEINAHRQETEQQIFKAAE-ELLEQQPERL 375

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
              ++++ G  WHPG++G++A+RL E+ GRP   ++ +E G+G GSGRS++GF++   + 
Sbjct: 376 DDRIMLLWGRDWHPGVIGIVASRLVERTGRPVIVVTIDEHGEGKGSGRSVQGFNLHACIG 435

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
              +  +LV+ GGHAMAAGL+V   N   L     ++A    P L  TP    D  ++  
Sbjct: 436 SCAD--LLVRYGGHAMAAGLSVREENLPELRRRLNEWAARECPVL-HTPPLTCDVTIHLD 492

Query: 487 AVNIALIDMLESAGPYGAGNPNPVF 511
            + +  +  L+   PYGA NP PVF
Sbjct: 493 RITVESVRHLDQLAPYGAENPTPVF 517


>gi|310658611|ref|YP_003936332.1| single-stranded-DNA-specific exonuclease [Clostridium sticklandii
           DSM 519]
 gi|308825389|emb|CBH21427.1| putative single-stranded-DNA-specific exonuclease [Clostridium
           sticklandii]
          Length = 777

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 173/507 (34%), Positives = 287/507 (56%), Gaps = 16/507 (3%)

Query: 41  DIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           D+ + +L  R ++I+ +K FLNP+   L+  P +L D +K   RI  A Y S+ I I+GD
Sbjct: 15  DLKSHLLNVRQINIEESKSFLNPTKADLIS-PYLLKDMEKVVNRINTAKYKSQLICIYGD 73

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDG +SV+++++  +   +N+  YIP RI +GYG N   ++     GA LIITVDCG 
Sbjct: 74  YDVDGISSVSILLKTFNFLGINSIFYIPKRIEEGYGINTQAIDTIKKMGADLIITVDCGI 133

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLV 220
           TS D ++YA    +DVIV DHH+ K     A  ++NP + +      HLC AG+     +
Sbjct: 134 TSVDEIEYAKTIDLDVIVTDHHECKEILPDAIGIINPKQDECEYPYKHLCGAGIA----L 189

Query: 221 LIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLK 280
            I + L +DN   L FD   L+++  +AT+ D+V L G NR  V  GL+  ++  N GLK
Sbjct: 190 KIAQALIEDNDSAL-FD--ELIEIACIATIADIVELSGENRVIVKNGLLSLKKTINIGLK 246

Query: 281 ALIERV-NISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVL 339
           AL+E     SS I + N+ +++ P IN+ GR+G   LG  L+I DD +E  ++A K++ L
Sbjct: 247 ALMEVSGINSSNINSSNIAFILAPRINSTGRMGTPELGVSLIIEDDFEEAVIMARKIEEL 306

Query: 340 NQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSF 399
           N+ R+ +E  + E+A A +  +    +   +++     WH G++G++A++L EK+ +P+F
Sbjct: 307 NRERQTVELKIFEEAVALIEQKS---KNNKILIASSKNWHSGVIGIVASKLTEKYNKPTF 363

Query: 400 AISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDF 459
            I+ E++  G GS RSI+GF++ + +   ++E  L+K GGH  AAG+T+           
Sbjct: 364 VIAIEDENIGKGSARSIDGFNLFENL-LKLDEC-LIKFGGHNQAAGITIHEDRIAEFELM 421

Query: 460 FQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQ 519
             + A  I+       + +ID  L    +N   + +L    P+G GN  P+F   N+KL 
Sbjct: 422 INEIAEEILNKNHFQRIIEIDSKLKLKDINSNTLKILNELEPFGIGNRKPLFCLTNYKLS 481

Query: 520 SIRVVNLAHLQMTFESQDSETLQAIAF 546
           + + +    ++  F+S+ ++ ++ I F
Sbjct: 482 NYKYI--GKMKKHFKSEINDDIEIIGF 506


>gi|323706432|ref|ZP_08117994.1| single-stranded-DNA-specific exonuclease RecJ
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534217|gb|EGB24006.1| single-stranded-DNA-specific exonuclease RecJ
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 817

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 196/579 (33%), Positives = 304/579 (52%), Gaps = 40/579 (6%)

Query: 16  FRWVSLLGQEGINRALA--ITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDP 72
           + WVS   ++  N  L   I  K  +   VA+ +VNR    +    ++LNP++  L  +P
Sbjct: 3   YNWVS---KKAKNDKLVDEIANKFNLKTYVAQTIVNRGYDDLKKVYEYLNPTLNAL-NNP 58

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L   +KA   I   I  ++KI I+GDYDVDG  S +++   L     N + YIPDR++
Sbjct: 59  YLLEGIEKAVSIIKYHIGLNDKIAIYGDYDVDGITSTSILYIALKRLGANVDFYIPDRLL 118

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG N   ++   + G +LIITVDCG  S   +QYA   G+DVI+ DHHQV      A 
Sbjct: 119 EGYGINMDAVKILCDSGTKLIITVDCGIASLKEVQYARKLGLDVIITDHHQVPDILPEAN 178

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVF-LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            +VNP+  D       L   GV F L L L            L  + L  LD+VAL TV 
Sbjct: 179 CIVNPHIKDCAYPYRELAGVGVAFKLCLAL------------LGDEALEFLDVVALGTVA 226

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL G NR  V +GL + R   N GL+ALI    ++   I   ++G+++ P +NA GR
Sbjct: 227 DIVPLTGENRVIVKEGLKMMRNTKNKGLRALINSAGLNKRDIDTYHVGFILAPRLNAAGR 286

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +  + L   LL++DD  E + +A  L+  N  R+ +E  +LE+A  +V     D+++   
Sbjct: 287 LESAVLCVNLLVTDDPIEADRIAAYLNSENAKRQEIEKKILEEAIMQVENNV-DLEKEKF 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           IV+  + WHPG++G++++R+ E++ RPS  IS    G G GSGRSI+GF+I + + +A +
Sbjct: 346 IVLYSENWHPGVIGIVSSRITERYHRPSILISV-SGGFGKGSGRSIKGFNIYEAIKYAGD 404

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK----IDGVLNAS 486
              L+  GGH MAAGLT++            ++A   + A    P+ +    ID VL+  
Sbjct: 405 --CLINFGGHEMAAGLTIDSSQIDDFRFKLNEYAKTKLTAFDMMPIIEIETSIDDVLDCD 462

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV-NLAHLQMTFESQDSETLQAIA 545
             N   + +LE   P+G+GNP P++A  N  ++ I +  +  H+++  E  D      + 
Sbjct: 463 GAN--QVSLLE---PFGSGNPVPMYAIKNLVVKQISLFGDNKHIRIMVEKNDV-MYNVVL 516

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
           F        EF   S G  + + G + VN W G K+ ++
Sbjct: 517 F----NRACEFDKISTGAVLDIAGFVKVNEWNGEKKLEI 551


>gi|164687523|ref|ZP_02211551.1| hypothetical protein CLOBAR_01164 [Clostridium bartlettii DSM
           16795]
 gi|164603297|gb|EDQ96762.1| hypothetical protein CLOBAR_01164 [Clostridium bartlettii DSM
           16795]
          Length = 835

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 184/560 (32%), Positives = 296/560 (52%), Gaps = 24/560 (4%)

Query: 34  TQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNS 92
           TQ    P+I +++L NR++  +  A+ F+NPS+  L  DP ++ D  K   RI +AI   
Sbjct: 22  TQVGISPEI-SQILKNRDIITEKDAEIFMNPSLDYLR-DPFLMKDMQKGVDRIKKAIEKK 79

Query: 93  EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQL 152
           E+I I+GDYDVDG +S ++++ +      +   YIP+R+ +GYG +   +EK    G  L
Sbjct: 80  ERIFIYGDYDVDGVSSTSILVLYFKSIGYDVKYYIPNRLKEGYGISIEALEKINEIGCDL 139

Query: 153 IITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAA 212
           +I+VDCG TS   +++A   G+DVI+ DHH+ + E   A A++NP + D       LC  
Sbjct: 140 LISVDCGITSAKEVEFAKTLGMDVIITDHHECQDEIPDAIAVINPKQEDCTYPYDFLCGC 199

Query: 213 GVVFLVLVLIY--RILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
           GV F ++  +    + R+         +   L++V LAT+CD+VPL   NR  V  GL +
Sbjct: 200 GVAFKLIQALTPPEVFRE--------SMYDYLEIVTLATICDIVPLKDENRIIVKNGLKM 251

Query: 271 ARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQEL 329
            +   N GLK LI+   I +  + + ++GY +GP INA GR+G S LG  L  +D  ++ 
Sbjct: 252 MKDGRNIGLKELIKVCGIDTHQLKSSHIGYSVGPRINASGRLGYSYLGVELFTADSPEQA 311

Query: 330 EMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAAR 389
           + +AM L+  N  R+L+ES M  +AEA ++      +   V+VV  + W  GI+G++A++
Sbjct: 312 KEIAMDLEEKNSERQLIESKMYSEAEA-IIASNQSYEDDKVLVVANEGWQHGIIGIVASK 370

Query: 390 LKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE-EGILVKGGGHAMAAGLTV 448
           L EK+ +P+  ++ EE G   GS RSI+GF I   +   VE + ++ K GGH  AAGL++
Sbjct: 371 LTEKYYKPTILLTIEE-GMATGSARSIKGFSIFDAL---VECKDLMSKFGGHEQAAGLSM 426

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
           +  N   L     + A   +         K++  L    V++ L+D L    P+G  NP 
Sbjct: 427 DARNIDELRQRVNEIADYSLTKEDMIENIKVEYELQEGQVDLDLVDQLHLLEPFGMSNPT 486

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           P F   +  L +I  V  A   +    Q     +AI F +      EF   +RG ++ V 
Sbjct: 487 PRFIMRDLVLANIGFVGAAKQHLKLTLQKDSVYEAIGFNM-AYLADEF---TRGDKVDVL 542

Query: 569 GHLCVNYWRGSKRCQLRVLD 588
             L  N +  +++ Q  + D
Sbjct: 543 FQLDENNYNNNRKVQFLLKD 562


>gi|77411730|ref|ZP_00788068.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae CJB111]
 gi|77162238|gb|EAO73211.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae CJB111]
          Length = 732

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 194/585 (33%), Positives = 300/585 (51%), Gaps = 40/585 (6%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           + + WV L  Q+        ++K  I + VA ++ +R +        FL  ++  L  DP
Sbjct: 4   AKYSWV-LNNQKPDAGFFEASKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  
Sbjct: 62  YLLNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFT 121

Query: 133 DGYGPNPSLMEKFI-NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           DGYGPN S+ + FI  +   LIITVD G   ++A+ YA NQG+DV+V DHH + ++   A
Sbjct: 122 DGYGPNESVYKYFIEQQDVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P   D      +L   GV F V   +   +  +           +LDLVA+ T+ 
Sbjct: 182 YAIIHPEHPDANYPFPYLAGCGVAFKVACALLETIPTE-----------MLDLVAIGTIA 230

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR
Sbjct: 231 DMVSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGR 290

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           + + N    LL   D +E + +A  +D  N+ R+ +   + +QA  ++L Q   +Q    
Sbjct: 291 LDDPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQA-MQMLDQTKPVQ---- 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
            V+  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI +  +F   
Sbjct: 346 -VLAKENWHPGVLGIVAGRILERTGQPVIVLNI-EDGIAKGSARSVEALDIFQ--AFDQH 401

Query: 431 EGILVKGGGHAMAAGLTVERVNFGR----LCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
             + +  GGH+ AAG+T+E    G     LCD+  K   ++      T    ID  L   
Sbjct: 402 RELFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLT----IDSELRFD 457

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAI 544
            +++  +   E   P+G  N  PVF   + K+   RV+  N AHL++  E QD + L  +
Sbjct: 458 ELSLDTVRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNSAHLKLKLE-QDGQALDLV 516

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF + G+ L EF  Q++   + VT  L VN W G+   QL + DA
Sbjct: 517 AFNM-GSQLQEF-QQAQHLELAVT--LSVNQWNGATTLQLMLEDA 557


>gi|172035400|ref|YP_001801901.1| single-stranded-DNA-specific exonuclease [Cyanothece sp. ATCC
           51142]
 gi|171696854|gb|ACB49835.1| single-stranded-DNA-specific exonuclease [Cyanothece sp. ATCC
           51142]
          Length = 654

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 183/553 (33%), Positives = 297/553 (53%), Gaps = 22/553 (3%)

Query: 42  IVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPL-ILTDCDKAARRIVQAIYNSEKIMIFG 99
           ++A+V++NR + S + A+ ++NP +  L PDPL    D   +   + +AI   EKI I G
Sbjct: 30  LLAQVILNRGIDSPNLAQVYINPEVETL-PDPLDEFPDLLSSIELLKEAIEIGEKIAICG 88

Query: 100 DYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG 159
           DYD DG  S +L++R L+H   +A   IP R+ DGYG N  ++EKF  EG  +++TVD G
Sbjct: 89  DYDADGMTSTSLLLRALTHLGGDAYYEIPSRMKDGYGINERIVEKFAEEGVGVVLTVDNG 148

Query: 160 STSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVL 219
             +Y+ ++ A   G+ VI+ DHH +  +  PA A++NP  L   S    L   GV +++ 
Sbjct: 149 IAAYEPIKRAIELGLTVIITDHHDLPEKLPPADAILNPKLLSIHSPYRGLAGVGVAYILA 208

Query: 220 VLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGL 279
           V    +  Q NK     D  SLL+L  L T+ D+ PL+G+NR ++ KGL         G+
Sbjct: 209 V---TLAEQFNKTEEIID--SLLELFTLGTIADLAPLVGVNRRWLKKGLKQLPNSQLAGI 263

Query: 280 KALIERVNISSP---ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           +AL++   +S     +  +++G+ +GP INA GRIG+      LL +DD       AM+ 
Sbjct: 264 QALMQVAGVSEEQKQLKPDDIGFKLGPRINAVGRIGDPQTAIELLTTDDPGIALERAMQC 323

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           + +N  R+ +   + ++A   + T   + ++  V+VV   +WH G++G++A+RL E++G 
Sbjct: 324 EQINGKRKGLCEEIEKEAIHLIKTTPINYKKDRVLVVINHKWHHGVIGIVASRLVERYGV 383

Query: 397 PSFAISFEED--GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
           P F  ++EED   K  GS R IE F+I + + +   + +L K GGH  A G  ++  N  
Sbjct: 384 PVFIGTYEEDDPSKIRGSARGIEEFNIFEALVYC--DDLLGKYGGHKAAGGFGLKSNNLI 441

Query: 455 RLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFP 514
              +   +FAH ++      P+ KIDG  N   +N  L   ++S  P+G  N  PVF  P
Sbjct: 442 AFKERLSQFAHQLLEPHHIKPLVKIDGEANFKQLNAQLYQHIDSLQPWGIENAFPVFWTP 501

Query: 515 NHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVN 574
           N K+   R V   HL++    +D + ++AIA+R      G +      KR+ +   L  N
Sbjct: 502 NVKILEQRTVGKNHLKLVLGQEDGQEMKAIAWR-----FGSYF--PLPKRLDIAYKLTEN 554

Query: 575 YWRGSKRCQLRVL 587
           YW G+   +L ++
Sbjct: 555 YWNGTVNIELEIV 567


>gi|307266557|ref|ZP_07548089.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306918411|gb|EFN48653.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 815

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 181/580 (31%), Positives = 300/580 (51%), Gaps = 35/580 (6%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLIL 75
           +RW+ L     +     I +++ +  I+A +L ++ ++    K+FLNP ++ L   P +L
Sbjct: 9   YRWI-LKENPNLQLTQEIQREYGLHKIIADILSSK-LNAQEVKNFLNPDLKDLYS-PYLL 65

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
               +A   I Q I   + I I+GDYDVDG  + +++   L       + YIP+R+V+GY
Sbjct: 66  RGIKEAKELIQQHIALKDLITIYGDYDVDGITATSVLYLTLKKLGAKVDYYIPERLVEGY 125

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++K    G +LII+VDCG TS   ++ A   GIDVI+ DHH +  E   A  ++
Sbjct: 126 GINEEAIDKIAQRGTKLIISVDCGITSVKEVEKAQFLGIDVIITDHHSIPKEIPQADVVI 185

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP+  D       L   GV F +           ++  +  +   LLD+V++ T+ D+VP
Sbjct: 186 NPHLPDIEYPFCDLAGVGVAFKL-----------SQALIGEEAYELLDIVSIGTIADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L+G NR  V +GL       N GLKALI+   + +  I   ++G+++ P +NA GR+  +
Sbjct: 235 LLGENRIIVKEGLKRLNETRNIGLKALIKASGLQNIEIDEYHVGFILAPRLNAAGRLRSA 294

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
               RLLIS D +E+E +A  L+  N  R+ +E+ +L++A  K+  +  D+ +  VIV+ 
Sbjct: 295 EAAVRLLISQDEKEVEEIAEYLNQENLKRQQIENQILQEAIKKI-KETVDLNKEKVIVLW 353

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
              WHPG++G++A+R+ E+F RPS  IS  E G+G GSGRSIEGF++ K + +   +  L
Sbjct: 354 DKNWHPGVIGIVASRITERFHRPSILISLGE-GEGKGSGRSIEGFNLYKALEYC--KDYL 410

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           +K GGH MAAG+ +E+ N         ++A  ++  L   P  +ID  +    ++I +  
Sbjct: 411 IKYGGHEMAAGINIEKNNLEIFKTKINEYADTVLSDLDLIPSLRIDAKVKNEKIDIEIAK 470

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLG 554
            L+   P+G+ NP P F F    +  +  +N    +     +D           +G  L 
Sbjct: 471 QLQRFKPFGSNNPRPNFLFEGLTVTKVFDLNGGKYKKIIAQKDK----------FGYELM 520

Query: 555 EFLMQSRGKRMH------VTGHLCVNYWRGSKRCQLRVLD 588
            F +  +G  +       V G + +N W G +   + V D
Sbjct: 521 LFDVSDQGNDVKIGDIIDVVGSIEINSWNGIESVMINVKD 560


>gi|150390115|ref|YP_001320164.1| single-stranded-DNA-specific exonuclease RecJ [Alkaliphilus
           metalliredigens QYMF]
 gi|149949977|gb|ABR48505.1| single-stranded-DNA-specific exonuclease RecJ [Alkaliphilus
           metalliredigens QYMF]
          Length = 841

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 190/561 (33%), Positives = 309/561 (55%), Gaps = 32/561 (5%)

Query: 43  VARVLVNRNVSIDY--AKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
            A++L NR V ID   AK F++ S+  L  DP +L D  KA  RI +AI  +EKI I+GD
Sbjct: 29  TAQILTNRKV-IDTREAKRFIDSSLEQLH-DPFLLKDMKKAVDRIQEAIQKNEKIWIYGD 86

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDG +S ++M+++      + + YIPDR+ +GYG N   ++   + G  LIITVDCG 
Sbjct: 87  YDVDGVSSTSIMLQYFKTIDFSVDYYIPDRVQEGYGINQEAIQLIKSRGGNLIITVDCGI 146

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLV 220
           TS++ +  A +  ID+I+ DHH+ +     AYA++NP + D       +C  G   L L 
Sbjct: 147 TSFEEIALANSLSIDMIITDHHECQGAVPEAYAIINPKQHDCSYPFDSICGCG---LALK 203

Query: 221 LIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLK 280
           LI  +  ++        +   +D+VA+ATV D+VPL+  NR +V  GL       N G++
Sbjct: 204 LIQALTPKEE---FKSTIYLYIDIVAIATVADIVPLVDENRIFVKNGLQYMPDTKNLGVQ 260

Query: 281 ALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVL 339
           AL+E   +    + A ++G+ +GP INA GRIG ++ G +LL S D  E++ LA  L+  
Sbjct: 261 ALLEVCKLKDRKLNAGHIGFSLGPRINAAGRIGSADSGVKLLTSSDPAEVQQLAHFLNEE 320

Query: 340 NQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSF 399
           NQNR+ +E  +L++A   ++          V+V+  + WH G++G++A+R+ E++ +P  
Sbjct: 321 NQNRQEIEVKILDEA-INMIESSGQFNIDKVLVLAKEGWHHGVIGIVASRIVERYHKPVI 379

Query: 400 AISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDF 459
            ++ E D K  GS RSI   ++ + ++    + + +K GGH  AAGLT++  N     + 
Sbjct: 380 ILAIEGD-KAKGSARSIPKLNLFEAMNQC--KDLFLKIGGHEQAAGLTLKSEN----IEA 432

Query: 460 FQKFAHNIVPALITTPVF----KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
           F+   ++IV   ++   F      DG+L+   V  +LID L +  PYG GNP+P F   +
Sbjct: 433 FRMKINDIVNQTLSPEDFIAQIHCDGLLSLDVVEDSLIDELGNLEPYGMGNPSPKFIGYD 492

Query: 516 HKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTGHLC 572
             +  IR V +   HL++   S+ S+ + AI F       G++     +G ++H+     
Sbjct: 493 FTIVDIRAVGVDGKHLKLKLGSK-SKQVDAIGFN-----FGDYSDHIEQGDKIHLVYTPE 546

Query: 573 VNYWRGSKRCQLRVLDASPVE 593
            N +RG K  QL++ D   V+
Sbjct: 547 FNEFRGQKNIQLQIKDIKTVK 567


>gi|77412804|ref|ZP_00789009.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae 515]
 gi|77161100|gb|EAO72206.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae 515]
          Length = 732

 Score =  290 bits (741), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 194/585 (33%), Positives = 301/585 (51%), Gaps = 40/585 (6%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           + + WV L  Q+        ++K  I + VA ++ +R +        FL  ++  L  DP
Sbjct: 4   AKYSWV-LNNQKPDAGFFEASKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L+       +Y+P+R  
Sbjct: 62  YLLNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALNMMGAEVQVYLPNRFT 121

Query: 133 DGYGPNPSLMEKFI-NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           DGYGPN S+ + FI  +   LIITVD G   ++A+ YA NQG+DV+V DHH + ++   A
Sbjct: 122 DGYGPNESVYKYFIEQQDVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P   D      +L   GV F V   +   +  +           +LDLVA+ T+ 
Sbjct: 182 YAIIHPEHPDANYPFPYLAGCGVAFKVACALLETIPTE-----------MLDLVAIGTIA 230

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR
Sbjct: 231 DMVSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGR 290

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           + + N    LL   D +E + +A  +D  N+ R+ +   + +QA  ++L Q   +Q    
Sbjct: 291 LDDPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQA-MQMLDQTKPVQ---- 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
            V+  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI +  +F   
Sbjct: 346 -VLAKENWHPGVLGIVAGRILERTGQPVIVLNI-EDGIAKGSARSVEALDIFQ--AFDQH 401

Query: 431 EGILVKGGGHAMAAGLTVERVNFGR----LCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
             + +  GGH+ AAG+T+E    G     LCD+  K   ++      T    ID  L   
Sbjct: 402 RELFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLT----IDSELRFD 457

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAI 544
            +++  +   E   P+G  N  PVF   + K+   RV+  N AHL++  E QD + L  +
Sbjct: 458 ELSLDTVRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLV 516

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF + G+ L EF  Q++   + VT  L VN W G+   QL + DA
Sbjct: 517 AFNM-GSQLQEF-QQAQHLELAVT--LSVNQWNGATTLQLMLEDA 557


>gi|22537366|ref|NP_688217.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae 2603V/R]
 gi|25011329|ref|NP_735724.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae NEM316]
 gi|22534239|gb|AAN00090.1|AE014247_5 single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae 2603V/R]
 gi|24412867|emb|CAD46939.1| Unknown [Streptococcus agalactiae NEM316]
          Length = 732

 Score =  290 bits (741), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 194/585 (33%), Positives = 300/585 (51%), Gaps = 40/585 (6%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           + + WV L  Q+        ++K  I + VA ++ +R +        FL  ++  L  DP
Sbjct: 4   AKYSWV-LNNQKPDAGFFEASKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  
Sbjct: 62  YLLNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFT 121

Query: 133 DGYGPNPSLMEKFI-NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           DGYGPN S+ + FI  +   LIITVD G   ++A+ YA NQG+DV+V DHH + ++   A
Sbjct: 122 DGYGPNQSVYKYFIEQQDVSLIITVDNGVAGHEAITYAQNQGVDVVVTDHHSMPADLPCA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P   D      +L   GV F V   +   +  +           +LDLVA+ T+ 
Sbjct: 182 YAIIHPEHPDANYPFPYLAGCGVAFKVACALLETIPTE-----------MLDLVAIGTIA 230

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR
Sbjct: 231 DMVSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGR 290

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           + + N    LL   D +E + +A  +D  N+ R+ +   + +QA  ++L Q   +Q    
Sbjct: 291 LDDPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQA-MQMLDQTKPVQ---- 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
            V+  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI +  +F   
Sbjct: 346 -VLAKENWHPGVLGIVAGRILERTGQPVIVLNI-EDGIAKGSARSVEALDIFQ--AFDQH 401

Query: 431 EGILVKGGGHAMAAGLTVERVNFGR----LCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
             + +  GGH+ AAG+T+E    G     LCD+  K   ++      T    ID  L   
Sbjct: 402 RELFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLT----IDSELRFD 457

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAI 544
            +++  +   E   P+G  N  PVF   + K+   RV+  N AHL++  E QD + L  +
Sbjct: 458 ELSLDTVRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLV 516

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF + G+ L EF  Q++   + VT  L VN W G+   QL + DA
Sbjct: 517 AFNM-GSQLQEF-QQAQHLELAVT--LSVNQWNGATTLQLMLEDA 557


>gi|319745216|gb|EFV97535.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae ATCC 13813]
          Length = 732

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 194/585 (33%), Positives = 300/585 (51%), Gaps = 40/585 (6%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           + + WV L  Q+        ++K  I + VA ++ +R +        FL  ++  L  DP
Sbjct: 4   AKYSWV-LNNQKPDAGFFEASKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  
Sbjct: 62  YLLNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFT 121

Query: 133 DGYGPNPSLMEKFI-NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           DGYGPN S+ + FI  +   LIITVD G   ++A+ YA NQG+DV+V DHH + ++   A
Sbjct: 122 DGYGPNESVYKYFIEQQDVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P   D      +L   GV F V   +   +  +           +LDLVA+ T+ 
Sbjct: 182 YAIIHPEHPDANYPFPYLAGCGVAFKVACALLETIPTE-----------MLDLVAIGTIA 230

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR
Sbjct: 231 DMVSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGR 290

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           + + N    LL   D +E + +A  +D  N+ R+ +   + +QA  ++L Q   +Q    
Sbjct: 291 LDDPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQA-MQMLDQTKPVQ---- 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
            V+  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI +  +F   
Sbjct: 346 -VLAKENWHPGVLGIVAGRILERTGQPVIVLNI-EDGIAKGSARSVEALDIFQ--AFDQH 401

Query: 431 EGILVKGGGHAMAAGLTVERVNFGR----LCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
             + +  GGH+ AAG+T+E    G     LCD+  K   ++      T    ID  L   
Sbjct: 402 RELFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLT----IDSELRFD 457

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAI 544
            +++  +   E   P+G  N  PVF   + K+   RV+  N AHL++  E QD + L  +
Sbjct: 458 ELSLDTVRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLV 516

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF + G+ L EF  Q++   + VT  L VN W G+   QL + DA
Sbjct: 517 AFNM-GSQLQEF-QQAQHLELAVT--LSVNQWNGATTLQLMLEDA 557


>gi|312110096|ref|YP_003988412.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y4.1MC1]
 gi|311215197|gb|ADP73801.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y4.1MC1]
          Length = 785

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 189/590 (32%), Positives = 313/590 (53%), Gaps = 27/590 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           I+  RW      E I + L   ++  I  ++A +LV+R V + + A  FL P ++    D
Sbjct: 3   IAKTRWDVKRPDENIVKHL--VEQLRIDPLIATLLVHRGVRTAEEANAFLYP-LKQPFHD 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L   ++A  RI +AI + E I+++GDYD DG +S  +M+  L       + YIP+R 
Sbjct: 60  PFLLDGMERAVVRIQRAIQDGEHILVYGDYDADGVSSTTVMVSALKEAGAIVDFYIPNRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN        ++G  LIITVD G  +   +  A   G+DVI+ DHH+V      A
Sbjct: 120 TEGYGPNEKAFRWAKDQGFSLIITVDNGIAAVKEVALANELGMDVIITDHHEVGPTLPEA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           Y +++P +         L   GV F V   +        +VP       LLD+ A+ T+ 
Sbjct: 180 YEIIHPKKPGSTYPFRELAGVGVAFKVAHALL------GEVP-----RYLLDVAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGR 310
           D+V L G NR  V +GL   R+    GL+AL  +  I +  I  + +G++I P +NA GR
Sbjct: 229 DLVSLTGENRVLVAQGLEQLRKTKRIGLRALCTQCGIDAEKIDEQTVGFIIAPRMNAAGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +GE++   RLL+++D +E + LA ++D LN+ R+ + + + E+A A+++ +     +  V
Sbjct: 289 LGEADPAVRLLMTEDEEEAKRLAKEMDDLNRERQQLVAEIAEEA-AQIIQEQFPPSENKV 347

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAV 429
           +VV  + W+PG++G++A+RL E+F RP+  +S + E G   GS RSI GFD+    S + 
Sbjct: 348 LVVAKEGWNPGVIGIVASRLVEQFYRPTIVLSIDAEKGIAKGSARSIHGFDM--FSSLST 405

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL+  GGH MAAG+T+   + G L       A +++     TP+  ID V + S + 
Sbjct: 406 CRDILLHFGGHPMAAGMTLSLEDVGELRRRLNALADDMLTDDDFTPITSIDAVCSVSDLT 465

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFR 547
           +A+ + LE   P+G GN  P+F   N  ++++R V  + +HL+  F +Q+   + ++ F 
Sbjct: 466 MAVAEQLEKFAPFGVGNAKPLFLMENVSVETMRRVGADQSHLKAVF-AQNGAAIDSVGFG 524

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
            +G    E    +   ++ V G L +N W   ++ QL + D +  E   F
Sbjct: 525 -FGYLRDEI---APDAKVSVVGELVINEWNHLRKPQLMIYDMAVHECQLF 570


>gi|295399344|ref|ZP_06809326.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978810|gb|EFG54406.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 785

 Score =  289 bits (740), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 189/590 (32%), Positives = 313/590 (53%), Gaps = 27/590 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           I+  RW      E I + L   ++  I  ++A +LV+R V + + A  FL P ++    D
Sbjct: 3   IAKTRWDVKRPDENIVKHL--VEQLRIDPLIATLLVHRGVRTAEEANVFLYP-LKQPFHD 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L   ++A  RI +AI + E I+++GDYD DG +S  +M+  L       + YIP+R 
Sbjct: 60  PFLLDGMERAVVRIQRAIQDGEHILVYGDYDADGVSSTTVMVSALKEAGAIVDFYIPNRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN        ++G  LIITVD G  +   +  A   G+DVI+ DHH+V      A
Sbjct: 120 TEGYGPNEKAFRWAKDQGFSLIITVDNGIAAVKEVALANELGMDVIITDHHEVGPTLPEA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           Y +++P +         L   GV F V   +        +VP       LLD+ A+ T+ 
Sbjct: 180 YEIIHPKKPGSTYPFRELAGVGVAFKVAHALL------GEVP-----RYLLDVAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGR 310
           D+V L G NR  V +GL   R+    GL+AL  +  I +  I  + +G++I P +NA GR
Sbjct: 229 DLVSLTGENRVLVAQGLEQLRKTKRIGLRALCTQCGIDAEKIDEQTVGFIIAPRMNAAGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +GE++   RLL+++D +E + LA ++D LN+ R+ + + + E+A A+++ +     +  V
Sbjct: 289 LGEADPAVRLLMTEDEEEAKRLAKEMDDLNRERQQLVAEIAEEA-AQIIQEQFPPSENKV 347

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAV 429
           +VV  + W+PG++G++A+RL E+F RP+  +S + E G   GS RSI GFD+    S + 
Sbjct: 348 LVVAKEGWNPGVIGIVASRLVEQFYRPTIVLSIDAEKGIAKGSARSIHGFDM--FSSLST 405

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL+  GGH MAAG+T+   + G L       A +++     TP+  ID V + S + 
Sbjct: 406 CRDILLHFGGHPMAAGMTLSLEDVGELRRRLNALADDMLTDDDFTPITSIDAVCSVSDLT 465

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFR 547
           +A+ + LE   P+G GN  P+F   N  ++++R V  + +HL+  F +Q+   + ++ F 
Sbjct: 466 MAVAEQLEKFAPFGVGNAKPLFLMENVSVETMRRVGADQSHLKAVF-AQNGAAIDSVGFG 524

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
            +G    E    +   ++ V G L +N W   ++ QL + D +  E   F
Sbjct: 525 -FGYLRDEI---APDAKVSVVGELVINEWNHLRKPQLMIYDMAVHECQLF 570


>gi|77407833|ref|ZP_00784586.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae COH1]
 gi|77173580|gb|EAO76696.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae COH1]
          Length = 732

 Score =  289 bits (740), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 194/585 (33%), Positives = 300/585 (51%), Gaps = 40/585 (6%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           + + WV L  Q+        ++K  I + VA ++ +R +        FL  ++  L  DP
Sbjct: 4   AKYSWV-LNNQKPDAGFFEASKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  
Sbjct: 62  YLLNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFT 121

Query: 133 DGYGPNPSLMEKFI-NEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           DGYGPN S+ + FI  +   LIITVD G   ++A+ YA NQG+DV+V DHH + ++   A
Sbjct: 122 DGYGPNQSVYKYFIEQQDVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P   D      +L   GV F V   +   +  +           +LDLVA+ T+ 
Sbjct: 182 YAIIHPEHPDANYPFPYLAGCGVAFKVACALLETIPTE-----------MLDLVAIGTIA 230

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR
Sbjct: 231 DMVSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGR 290

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           + + N    LL   D +E + +A  +D  N+ R+ +   + +QA  ++L Q   +Q    
Sbjct: 291 LDDPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQA-MQMLDQTKPVQ---- 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
            V+  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI +  +F   
Sbjct: 346 -VLAKENWHPGVLGIVAGRILERTGQPVIVLNI-EDGIAKGSARSVEALDIFQ--AFDQH 401

Query: 431 EGILVKGGGHAMAAGLTVERVNFGR----LCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
             + +  GGH+ AAG+T+E    G     LCD+  K   ++      T    ID  L   
Sbjct: 402 RELFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLT----IDSELRFD 457

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAI 544
            +++  +   E   P+G  N  PVF   + K+   RV+  N AHL++  E QD + L  +
Sbjct: 458 ELSLDTVRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLV 516

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF + G+ L EF  Q++   + VT  L VN W G+   QL + DA
Sbjct: 517 AFNM-GSQLQEF-QQAQHLELAVT--LSVNQWNGATTLQLMLEDA 557


>gi|303229401|ref|ZP_07316191.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515937|gb|EFL57889.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 664

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 190/554 (34%), Positives = 297/554 (53%), Gaps = 22/554 (3%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           IVAR++VNRN+  D    FL  +++ L+ DP  L D + A   I++ I   + I+++GDY
Sbjct: 28  IVARLMVNRNIDSDEGHRFLEGTLKDLL-DPFTLKDMETAVALILETIEAEKSIVVYGDY 86

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDG  + +L+ RFL       + YIP+R  +GYG N   ++  I++GA L+ITVDCG +
Sbjct: 87  DVDGITATSLLYRFLVKMGARVSYYIPERQSEGYGLNLEALDHIISDGASLVITVDCGIS 146

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
           SYD ++   ++ ID+I+ DHH    +  PA A++N  + D      +L   GV F +   
Sbjct: 147 SYDIVEAVCDR-IDIIITDHHTAPPQIPPARAVINHKQPDCPYRDKNLSGVGVAFKLCQA 205

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           ++  LRQ  +  L+      LD+VAL TV DVVPL+G NR  V  GL       N G+  
Sbjct: 206 LW--LRQCGEWYLDD-----LDIVALGTVADVVPLVGENRIIVQAGLKKMNELPNLGIDK 258

Query: 282 LIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           LI+   +    ITA ++G+ + P +NA GR+  +     LL++DD    E +A +L   N
Sbjct: 259 LIDVAGLHDKTITAGHIGFTLAPRLNAAGRVTHATRAVELLVTDDVDLAETIAQELQETN 318

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
             R+ +E ++ E+A A V  Q        V VV G+ WHPG++G++A+RL E+F +P+  
Sbjct: 319 MERQEIERSIHEEARANVAAQGH--LAGYVTVVAGENWHPGVIGIVASRLVEEFYKPTLV 376

Query: 401 ISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF 460
           IS  ++G G GS RSIEGF+I   + F   E IL++ GGHA AAG +++      L    
Sbjct: 377 ISI-DNGVGKGSCRSIEGFNIYNALKFC--EDILIQFGGHAAAAGFSIDASRIDELRQRL 433

Query: 461 QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQS 520
            ++    V      PV  ID  L    +++ ++D + +  PYG GN  P+F   + K+Q 
Sbjct: 434 TEYCKAHVSPDEYIPVVSIDATLPVDDIDVDIVDRVSALEPYGMGNSTPIFGVMDAKVQD 493

Query: 521 IRVVNL--AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG 578
           I ++     H ++   + +  ++ AIA+      L   + Q  G  + V   L  N W+G
Sbjct: 494 IMLMGQLKNHCKVILATANG-SVDAIAWN--RPDLFRHIFQ--GMNVKVAFTLQKNEWQG 548

Query: 579 SKRCQLRVLDASPV 592
               QL + D  P+
Sbjct: 549 FVSPQLMIQDIEPI 562


>gi|126660250|ref|ZP_01731366.1| single-stranded-DNA-specific exonuclease [Cyanothece sp. CCY0110]
 gi|126618489|gb|EAZ89242.1| single-stranded-DNA-specific exonuclease [Cyanothece sp. CCY0110]
          Length = 654

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 184/553 (33%), Positives = 299/553 (54%), Gaps = 22/553 (3%)

Query: 42  IVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPL-ILTDCDKAARRIVQAIYNSEKIMIFG 99
           ++A+V++NR + S + A+ ++NP++  L PDPL    D   + + + +AI   EKI I G
Sbjct: 30  LLAQVILNRGIDSPNLAQVYINPNVETL-PDPLDEFPDLFPSIKLLKEAINIGEKIAICG 88

Query: 100 DYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG 159
           DYD DG  S +L++R L+H   +A   IP R+ DGYG N  ++EKF  EG  +I+TVD G
Sbjct: 89  DYDADGMTSTSLLLRALTHLGGDAYYEIPSRMKDGYGINERIVEKFAEEGVGVILTVDNG 148

Query: 160 STSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVL 219
             +Y+ ++ A   G+ VI+ DHH +  +  PA A++NP  L   S    L   GV +   
Sbjct: 149 IAAYEPIKRAVELGLTVIITDHHDLPEKLPPADAILNPKLLSIHSPYRGLAGVGVAY--- 205

Query: 220 VLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGL 279
           +L   + +Q NK     D  SLL+L  L T+ D+ PL+G+NR ++ KGL         G+
Sbjct: 206 ILAITLAKQFNKTEEIID--SLLELFTLGTIADLAPLVGVNRRWLKKGLKQLPNSQLAGI 263

Query: 280 KALIERVNISSP---ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           +AL++   +S     +  +++G+ +GP INA GRIG+      LL +DD       AM+ 
Sbjct: 264 QALMQVGGVSEEQKQLKPDDIGFKLGPRINAVGRIGDPQTAIELLTTDDPGIALERAMQC 323

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           + +N  R+ +   + ++A   + T   + +Q  V+VV   +WH G++G++A+RL E++G 
Sbjct: 324 EQINGKRKGLCEEIEKEAIHLIKTTPINYKQDRVLVVIHHKWHHGVIGIVASRLVERYGV 383

Query: 397 PSFAISFEED--GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
           P F  ++EED   K  GS R IE F+I + + +   + +L K GGH  A G  ++  N  
Sbjct: 384 PVFIGTYEEDDPSKIRGSARGIEEFNIFEALVYC--DDLLGKYGGHKAAGGFGLKSENLI 441

Query: 455 RLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFP 514
              +   KFAH ++      P+ KIDG  + + +N  L   ++S  P+G  N  PVF  P
Sbjct: 442 AFKERLSKFAHQLLEPHHIKPLVKIDGEADFNQLNAHLYQHIDSLQPWGIQNAFPVFWTP 501

Query: 515 NHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVN 574
           N K+   R V   HL++     D + ++AIA+R      G +      KR+ +   L  N
Sbjct: 502 NVKILEQRTVGKNHLKLVLGQDDGQEMKAIAWR-----FGSYF--PLPKRLDIAYKLTEN 554

Query: 575 YWRGSKRCQLRVL 587
           +W G+   +L ++
Sbjct: 555 HWNGNVNIELEII 567


>gi|326390126|ref|ZP_08211687.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325993774|gb|EGD52205.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 815

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 180/580 (31%), Positives = 301/580 (51%), Gaps = 35/580 (6%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLIL 75
           +RW+ L     +     I +++ +  I+A +L ++ ++    K+FLNP ++ L   P +L
Sbjct: 9   YRWI-LKENPNLQLTQEIQREYGLHKIIADILSSK-LNAQEVKNFLNPDLKDLYS-PYLL 65

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
               +A   I Q I   + I I+GDYDVDG  + +++   L       + YIP+R+V+GY
Sbjct: 66  RGIKEAKELIQQHIALKDLITIYGDYDVDGITATSVLYLTLKKLGAKVDYYIPERLVEGY 125

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++K    G +LII+VDCG TS   ++ A   GIDVI+ DHH +  E   A  ++
Sbjct: 126 GINEEAIDKIAQRGTKLIISVDCGITSVKEVEKAQFLGIDVIITDHHSIPKEIPQADVVI 185

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP+  D       L   GV F +           ++  +  +   LLD+V++ T+ D+VP
Sbjct: 186 NPHLPDIEYPFCDLAGVGVAFKL-----------SQALIGEEAYELLDIVSIGTIADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L+G NR  V +GL       N GLKALI+   + +  I   ++G+++ P +NA GR+  +
Sbjct: 235 LLGENRIIVKEGLKRLNETRNIGLKALIKASGLQNIEIDEYHVGFILAPRLNAAGRLRSA 294

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
               RLLIS D +E++ +A  L+  N NR+ +E+ +L++A  K+  +  D+ +  VIV+ 
Sbjct: 295 EAAVRLLISQDEKEVKEIAEYLNQENLNRQQIENQILQEAIKKI-KETVDLNKEKVIVLW 353

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
              WHPG++G++A+R+ E+F RPS  IS  E G+G GSGRSIEGF++ K + +   +  L
Sbjct: 354 DKNWHPGVIGIVASRITERFHRPSILISLGE-GEGKGSGRSIEGFNLYKALEYC--KDYL 410

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           +K GGH MAAG+ +E+ N         ++A  ++  L   P  +ID  +    ++I +  
Sbjct: 411 IKYGGHEMAAGINIEKNNLEIFKTKINEYAATVLSDLDLIPSLRIDAKVKNEKIDIEIAK 470

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLG 554
            ++   P+G+ NP P F F    +  +  +N    +     +D           +G  L 
Sbjct: 471 QVQRFKPFGSNNPRPNFLFEGLTVTKVFDLNGGKYKKIIAQKDK----------FGYELM 520

Query: 555 EFLMQSRGKRMH------VTGHLCVNYWRGSKRCQLRVLD 588
            F +  +G  +       V G + +N W G +   + V D
Sbjct: 521 LFDVSDQGNDVKIGDIIDVVGSIEINSWNGIESVMINVKD 560


>gi|239827849|ref|YP_002950473.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           WCH70]
 gi|239808142|gb|ACS25207.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           WCH70]
          Length = 785

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 187/583 (32%), Positives = 310/583 (53%), Gaps = 27/583 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           I+  RW      E I   L + Q H  P ++A++LV+R V +++ A  FL P ++    D
Sbjct: 3   IAKTRWDVKRPDENIVTHL-VEQSHMDP-LIAKLLVHRGVRTVEEANAFLYP-LKQPFHD 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L   ++A  RI +AI + E I+++GDYD DG +S  +M+  L       + YIP+R 
Sbjct: 60  PFLLDGMERAIERIQRAIQHGEHILVYGDYDADGVSSTTVMVSALKEAGAIVDFYIPNRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN +       +G  LIITVD G  +   +  A   G+DVI+ DHH+V      A
Sbjct: 120 TEGYGPNENAFRWAKEQGFSLIITVDNGIAAVKEVALANELGMDVIITDHHEVGPALPEA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           Y +++P +         L   GV F V   +         VP +F     LD+VA+ T+ 
Sbjct: 180 YEIIHPKKPGSTYPFRELAGVGVAFKVAHALL------GDVPRHF-----LDVVAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGR 310
           D+V L G NR  V +GL   R     GL+AL ++  I +  I  + +G++I P +NA GR
Sbjct: 229 DLVSLTGENRLLVAQGLEQLRNTKRIGLRALCKQCGIEAKEINEQTVGFVIAPRMNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +GE+    RLL+++  +E + LA ++D LN+ R+ + + + E+A A+++ +     +  V
Sbjct: 289 LGEATPAVRLLMTEKEEEAQRLAKEMDDLNRERQQLVAKIAEEA-AQIVNEQFPPSENKV 347

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAV 429
           +V+  + W+PG++G++A+RL E+F RP+  +S + E G   GS RSI GFD+    S + 
Sbjct: 348 LVIAKEGWNPGVIGIVASRLVEQFYRPTIVLSIDSEKGIAKGSARSIHGFDM--FSSLST 405

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L       A +++ A   TP+  ID V + S + 
Sbjct: 406 CRDILPHFGGHPMAAGMTLSVDHIDELRQRLNALADDMLTADDFTPITPIDAVCSVSDLT 465

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFR 547
           +++ + LE   P+G  N  P+F   N  +++IR +  + +HL+  F +Q+   + ++ F 
Sbjct: 466 LSVAEQLEKFAPFGVDNAKPLFLMENVSVETIRRIGADQSHLKAVF-AQNGAAIDSVGFG 524

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +G    E    +   ++ V G L VN W   ++ QL + D +
Sbjct: 525 -FGYLCDEI---APDAKVSVVGELMVNEWNNLRKPQLMICDVA 563


>gi|153004194|ref|YP_001378519.1| single-stranded-DNA-specific exonuclease RecJ [Anaeromyxobacter sp.
           Fw109-5]
 gi|152027767|gb|ABS25535.1| single-stranded-DNA-specific exonuclease RecJ [Anaeromyxobacter sp.
           Fw109-5]
          Length = 599

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 196/557 (35%), Positives = 288/557 (51%), Gaps = 23/557 (4%)

Query: 42  IVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           + ARVL  R ++    A+ FL   +  L PDP  +   D A  R+VQA+   E+I  +GD
Sbjct: 50  VAARVLAGRGLADPADAEAFLASRLSEL-PDPFTMKGMDAAVSRLVQAVEAGERIACYGD 108

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDG  S AL+  FL     +   Y P R+V+GYG N   + K   +GA+L++T+DCG 
Sbjct: 109 YDVDGVTSTALLCGFLRAAGADVVTYTPHRLVEGYGLNTEAVRKLAAQGARLLVTLDCGI 168

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLV 220
           TS + ++ A   G+D +V+DHH V  E   A A++NP++         L A GV F + +
Sbjct: 169 TSVEEVRAAAALGLDTVVVDHHTVPVELPAARAILNPHQPGCAYPSKGLAAVGVTFALAM 228

Query: 221 LIYRILRQDNKVPLNF---DLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
            + R LR+  +        +L   LDLVAL T+ DVVPL+G NR  V  GL    +   P
Sbjct: 229 ALRRTLRERGRFGGGRAEPNLKDALDLVALGTIADVVPLVGANRILVRWGLEAIAKSRRP 288

Query: 278 GLKALIERVNISS--PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMK 335
           GL AL     I+    +TA  +G+ + P INA GR+ ++  G RLL+SDD      LA +
Sbjct: 289 GLCALKRVAGIAEGGEVTAGQVGFRLAPRINAAGRLDDAGRGVRLLLSDDEATARALAEE 348

Query: 336 LDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFG 395
           LD  N  R+ +E  +L++A      +     +  V+  +G  WH G+VG++A+R+ E+F 
Sbjct: 349 LDRENAARQEIERRILDEATEDARARVGAGVRGLVLARDG--WHAGVVGIVASRIVERFH 406

Query: 396 RPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           RP+  ++ EE G G GSGRSIE F +    + A   G L + GGH  AAG+TVER +   
Sbjct: 407 RPAVLVALEE-GSGKGSGRSIEAFHL--YDALAACSGHLARFGGHRHAAGVTVERGSLAA 463

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
               F+  A   +      P  +IDG L    V   + + L   GP+GAG+P PVFA   
Sbjct: 464 FRAAFEAHAAAQLAEEDLVPRCRIDGWLEERDVTERIAEDLAKLGPFGAGHPEPVFALRG 523

Query: 516 HKLQSIRV-VNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVN 574
              ++  V    AHL++         + AI F      +G+ L    G  +     L  +
Sbjct: 524 AATRARTVGAGNAHLKLAL----GRGIDAIGF-----GMGDRLAACAGP-VEAAFTLGFD 573

Query: 575 YWRGSKRCQLRVLDASP 591
            W G++R QL++ D  P
Sbjct: 574 AWDGARRLQLKLRDVRP 590


>gi|254455449|ref|ZP_05068878.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082451|gb|EDZ59877.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 567

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 183/583 (31%), Positives = 315/583 (54%), Gaps = 30/583 (5%)

Query: 12  SISGFRWVSLLGQEGI--NRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS-IRLL 68
           S+SG +W+    +E I  N    I Q     +IV++++++RN +        NPS IR  
Sbjct: 3   SVSGKKWI----EEKISKNSIEKIKQDFNFSEIVSKLIISRNFNYKEIYSIENPSVIRNE 58

Query: 69  MPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP 128
             +     D   A+  + ++I N E I IFGDYDVDG+A+ +L+ +F  +       YIP
Sbjct: 59  FKND---KDFINASLLLEKSINNKELICIFGDYDVDGSAATSLLAKFFDYIKQPYFFYIP 115

Query: 129 DRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE 188
           DR  DGYGP+ S+ +K I +  +L+I VDCGST+  ++ Y  ++ I  I+IDHH++    
Sbjct: 116 DRERDGYGPSNSVFKKLILKKPKLVIMVDCGSTANQSIAYLNDKKIKSIIIDHHEIDKPY 175

Query: 189 IPAYALVNPNR-LDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVAL 247
             A  ++NP + +++LS + + CA  + +  L +  +      K+  +FD+ + L  V L
Sbjct: 176 PKANVIINPKKNINNLS-KDYYCATTLTYFFLEIFIK------KIKSSFDITNYLIYVLL 228

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
           A VCDV+PL  +NR   +  +   + + N   + L E  N  + +T E+LG+ IGP IN+
Sbjct: 229 ALVCDVMPLRKINRYIGLNIIKDFKIKDNVVFRTLYELCNKRNNLTIEDLGFFIGPIINS 288

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGRI +S + + LLIS++   ++    +L  LN  R+ +E  +L +     L +    + 
Sbjct: 289 GGRISDSRIAADLLISENPNFVKAKLNELIRLNNIRKDIEQKILNEINFAKLEK----EN 344

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
             VI+        G++G++A+RLK+ F +PS  I+  ++    GS RS   ++IG ++  
Sbjct: 345 KDVIIYYNPTIKEGLIGIIASRLKDYFNKPSIVITSSQEILK-GSARSTINYNIGNVIKK 403

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQK-FA-HNIVPALITTPVFKIDGVLNA 485
            V++ ++  GGGH MAAG ++++     L DF  K FA  N   +L+ T     +  ++ 
Sbjct: 404 LVDKKLIQNGGGHNMAAGFSMKKNKLKDLEDFMLKDFALKNKKTSLVNT----YEAEISP 459

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           +A+N+  ++ +   GPYG  NP P F   N K+  ++  N  H+ + F+ +  + +++I 
Sbjct: 460 NAINMDFVNEINKIGPYGNRNPIPTFLIKNLKITKVKTFNEKHINVIFKPKVGKFIKSIC 519

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           F    T LG++L+  + K +HV   +  NYW  +K  QL + D
Sbjct: 520 FNSLNTKLGKYLLTYK-KNVHVIAQIHQNYWNNNKVLQLNIKD 561


>gi|118580215|ref|YP_901465.1| single-stranded-DNA-specific exonuclease RecJ [Pelobacter
           propionicus DSM 2379]
 gi|118502925|gb|ABK99407.1| exonuclease RecJ [Pelobacter propionicus DSM 2379]
          Length = 568

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 187/565 (33%), Positives = 286/565 (50%), Gaps = 16/565 (2%)

Query: 32  AITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           A+  + AI  + A +L  R +S   A D FL+PS+  ++ DP  +     A  R+++A  
Sbjct: 17  AMAGEKAILPLTAAILAGRGISEPDAMDAFLSPSLADML-DPSRMKGMADAVARLLEARR 75

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
             EKI ++GDYDVDG     L++ FL     + + +IP+R  DGYG N   +++ IN GA
Sbjct: 76  RQEKITVYGDYDVDGITGTTLLVSFLRQTGFDCDYFIPNRFDDGYGLNGEALDRIINAGA 135

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
            LI++VDCG T+ +   +   +G ++I++DHH  K     A A++NP +         L 
Sbjct: 136 ALILSVDCGITAVEEALFCRQRGAELIIVDHHAPKETLPDACAVLNPLQSGCDYAFKCLA 195

Query: 211 AAGVVFLVLVLIYRILRQDNKVPLNF--DLLSLLDLVALATVCDVVPLIGLNRAYVVKGL 268
             GV F +LV +   LR       +   DL   LDLVAL T+ DVVPLIG NR YV  GL
Sbjct: 196 GVGVAFNLLVALRAALRDQGSFGSDSGPDLRQWLDLVALGTIADVVPLIGQNRIYVTHGL 255

Query: 269 MVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQE 328
            +      PG++AL +   +   +++  +G+ + P +NA GR+  +  G  LL+ DD   
Sbjct: 256 RLLAAPCKPGIQALKKVAGVGGAVSSGQVGFRLAPRLNAAGRMESAVPGVELLLGDDPPH 315

Query: 329 LEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
              +A +LD  N  R+ +E A+L++A   ++ Q  +      IV+    WH G+VG++A+
Sbjct: 316 CLAIAEELDAANGERQAIERAILQEA-ISLVEQGGNYPDRRSIVLASPSWHQGVVGIVAS 374

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTV 448
           RL E+F RP+  I+ +E G+G GSGRSI GF +  + +  V   +L + GGH  A G+++
Sbjct: 375 RLAERFHRPTILIALDEQGQGKGSGRSIPGFHL--LDALKVCSPLLERFGGHRHAVGVSL 432

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
                      F+  A  ++      P   ID       V   L   L+   P+G GNP 
Sbjct: 433 SGERVDDFSATFEAEARRLLGNGELMPRLDIDAEAEPREVTKELALELKRLEPFGMGNPE 492

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           P+    +  +   RVV   HL++   S+D     AIAFR+    + E +  +    M   
Sbjct: 493 PLLMMRSLTVLEQRVVGEDHLRLRL-SRDDHVFNAIAFRMASRTVSETIDIAFFPEM--- 548

Query: 569 GHLCVNYWRGSKRCQLRVLDASPVE 593
                N W GS   QLRV D  P E
Sbjct: 549 -----NQWNGSSTLQLRVKDLRPTE 568


>gi|291278480|ref|YP_003495315.1| single-strand DNA-specific exonuclease [Deferribacter desulfuricans
           SSM1]
 gi|290753182|dbj|BAI79559.1| single-strand DNA-specific exonuclease [Deferribacter desulfuricans
           SSM1]
          Length = 582

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 190/592 (32%), Positives = 308/592 (52%), Gaps = 43/592 (7%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           ++W  L+ +  I +   +  K  +P  +   L  R + + D    F N  ++ L  +P  
Sbjct: 11  YKW--LIEEVNIEKLFDLIDKWRLPLPIGVTLFKRGILTSDDLHAFFNTPLQSL-KNPFH 67

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D +KA RR+ +AI + EKI ++GDYDVDG  S AL+  FL     N   YIP+RI +G
Sbjct: 68  MKDMEKAVRRVYEAIISGEKICVYGDYDVDGVTSTALIYLFLKEVGANVGYYIPNRIEEG 127

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   + +    G +L+ITVDCG T+ D +++A N G+DVI+ DHH+       A+++
Sbjct: 128 YGLNKEAINELRARGVELLITVDCGITALDEIKFAKNIGMDVIITDHHKPLESLPEAHSI 187

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN----KVPLNFDLLSLLDLVALATV 250
           +NP +  D     HL   GV F  ++ +   L  +N    K+P   +L   LD+VAL T+
Sbjct: 188 LNPLQPGDEYKFKHLSGVGVAFKFIMALRYSLSLNNFFKDKIP---NLKKYLDIVALGTI 244

Query: 251 CDVVPLIGLNRAYVVKGLMV-ARRQGNPGLKALIERVN--ISSPITAENLGYMIGPSINA 307
            DVVP++  NR +V  GL V +++    GL+ L +RV   +++ I   ++GY++ P INA
Sbjct: 245 ADVVPMVDENRIFVKHGLKVLSKKDVRIGLQEL-KRVTGLLNTNIEVSHVGYVLAPRINA 303

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GR+GES+ G +LLI+ +  E   LA +LD+ N+ R+ ME  +L     K+  +     +
Sbjct: 304 VGRLGESDRGVKLLITKNKNEARWLAEELDIENRYRQEMEKKILNDTFNKI-EKLGLANK 362

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
            + +V+  DRWHPGI+G++A+R+ EK+ +P+  IS  E+G G GS RSI  F +   +  
Sbjct: 363 YAGMVLFSDRWHPGIIGIVASRVAEKYNKPTIVISV-ENGIGKGSARSISDFHLYDCLQE 421

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK----IDGVL 483
             +  + +K GGH  AAGL +    + R     QK  H +V         K    ID ++
Sbjct: 422 LSD--LFLKFGGHKYAAGLQL----YERDIKVLQKRFHELVRKYRDVGSEKSSIVIDAIV 475

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
               +N+ L++ +E   P+G GNP PVF      L+ +R     + Q  F  +D   ++ 
Sbjct: 476 EPKDINMDLMNWIERMKPFGQGNPEPVFC-----LKRVR----KYQQFGFTGRDRSHVRG 526

Query: 544 IA------FRVYGTPLGEF-LMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
                   F + G  + E+        +  +     +N W G +   L++ D
Sbjct: 527 FVEKDGYIFEIVGYNMKEYKYFLKNYDKFDILFTPEINQWFGDRSILLKIKD 578


>gi|311031522|ref|ZP_07709612.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus sp. m3-13]
          Length = 781

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 192/587 (32%), Positives = 311/587 (52%), Gaps = 41/587 (6%)

Query: 14  SGFRW-VSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           S  RW VS   +E +++   + +   I  ++A +LVNR   +ID AK+FL  + +    D
Sbjct: 4   SKSRWNVSESNKELVDQ---LAESLDIAPLIASLLVNRGFDTIDAAKEFLYTNDQEFH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P ++ D DK   R+ QAI   EKI++FGDYD DG +S  +M+  L       + YIP+R 
Sbjct: 60  PFLMEDMDKLVERVNQAIAKEEKILVFGDYDADGVSSTTVMVTALQEVGALVDFYIPNRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN +  ++    G  +IITVD G ++    + A   G+D+I+ DHH+   E   A
Sbjct: 120 TEGYGPNENAFKQAKENGYSVIITVDTGISALYEAKVAKELGLDLIITDHHEPGPELPDA 179

Query: 192 YALVNPNR------LDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
           YA+++P +       DDL+G G   A  V   +L           K P +     LLD+ 
Sbjct: 180 YAIIHPKKETCSYPFDDLAGVG--VAYKVAHALL----------GKNPEH-----LLDVA 222

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPS 304
           A+ T+ D+VPL+G NR    KG+   ++    GLKAL+++  +    +T E +G+ IGP 
Sbjct: 223 AIGTIADLVPLVGENRLLASKGIKKMQQTTRVGLKALLQKCGVELHTVTEETVGFSIGPR 282

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INA GR+  ++    LL+++D +E +MLA +++  N+ R+ + + + E+A  +V  +   
Sbjct: 283 INAVGRLDNADPAVHLLMTNDQEEAKMLAEEMESYNKERQQIVTQITEEAIQQVEEKYPP 342

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGK 423
            +    I+VEG+ W+ G++G++A+RL ++F RP+  +S +ED G   GS RSI GFD+ +
Sbjct: 343 -EDNGFIIVEGNNWNAGVIGIVASRLVDRFYRPTIVLSLDEDKGLAKGSARSIVGFDLFE 401

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +S   +  IL   GGH MAAG+T++  +   L     + A  I+     TP+ ++D   
Sbjct: 402 NLSECRD--ILPHFGGHPMAAGMTLKIEDVNELRQRMNQKALEILTKEDFTPITEVDIEC 459

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETL 541
               V +A I+ LE   P+G  NP P     +   Q IR +     HL++  E Q+  +L
Sbjct: 460 TVGEVTLATIEQLEMLAPFGVANPKPKVLVKDVLPQQIRQIGNKSNHLKLVIE-QEGSSL 518

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
             + F    T    +   S G  + V G L +N W   ++ QL + D
Sbjct: 519 DCVGFGFGET----YHHVSPGASLDVLGELSINEWNNFRKPQLFLKD 561


>gi|210623792|ref|ZP_03294052.1| hypothetical protein CLOHIR_02003 [Clostridium hiranonis DSM 13275]
 gi|210153374|gb|EEA84380.1| hypothetical protein CLOHIR_02003 [Clostridium hiranonis DSM 13275]
          Length = 822

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 180/559 (32%), Positives = 288/559 (51%), Gaps = 21/559 (3%)

Query: 34  TQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNS 92
           T+K  +   ++++L NRN+ S +  K F NPS+  L  DP ++ D  KAA RI +AI  +
Sbjct: 18  TEKFKLSPEISQILENRNINSEEEIKLFTNPSLDYLR-DPFLMKDMGKAAERIKKAIELN 76

Query: 93  EKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQL 152
           E++ I+GDYDVDG +S ++++ +    + +   YIP+R+ +GYG N   +E   +EG  L
Sbjct: 77  ERVWIYGDYDVDGVSSTSVLLTYFRSINFDVKYYIPNRLEEGYGINKEAIEYINSEGCDL 136

Query: 153 IITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAA 212
           II+VDCG TS D ++YA   GI++I+ DHH+ +SE   AYA+VNP + D       LC  
Sbjct: 137 IISVDCGITSVDEVEYANELGIEMIITDHHECQSEIPNAYAVVNPKQDDCNYPFDMLCGC 196

Query: 213 GVVFLVLVLIYRILRQDNKVPLNFD--LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
           G+ F ++        Q    P  F   +   +++  LAT+CD+VPL+  NR  V  GL  
Sbjct: 197 GIAFKLV--------QALTPPEVFKTTVYDYIEIATLATICDIVPLVDENRIIVKNGLKA 248

Query: 271 ARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQEL 329
            +   N GL  LI    +    I + ++G+ IGP INA GR+G S+LG  L  + D    
Sbjct: 249 MKNGHNLGLSELINVCGVDKEKIGSSHIGFTIGPRINAAGRLGFSDLGVELFTATDKDTA 308

Query: 330 EMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAAR 389
             +A+ LD  N +R+++E  +  +AE  ++      +   VIV+  + W  G++G++A++
Sbjct: 309 HEIALALDEKNNDRQMIEMKIHHEAET-IIKNDPSYEDDKVIVLAHEGWQHGVIGIVASK 367

Query: 390 LKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
           L EK+ +P+  +   EDG+  GS RSI+GF I   ++   +  IL K GGH  AAGL++ 
Sbjct: 368 LTEKYYKPTILMCI-EDGEATGSARSIKGFSIFDALTECAD--ILTKFGGHEQAAGLSIS 424

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
                 L     + A   +         K++  L+  + N  LI+ L    P+G  NP P
Sbjct: 425 ADKVPELRRRINESADINLTEEDMIEEIKVEYELDEKSANFDLIEELRKLEPFGMSNPTP 484

Query: 510 VFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
            F   +  L+ +R +      +  E +     + + F       G       G R+ V  
Sbjct: 485 KFILRDCILRDMRFMGQNKQHIKLEIEKESVFECVGFNAAHLIDG----LKNGDRIDVLF 540

Query: 570 HLCVNYWRGSKRCQLRVLD 588
            L  N + G ++ Q  V D
Sbjct: 541 QLDENTFMGKRKLQFLVKD 559


>gi|114566343|ref|YP_753497.1| single-stranded DNA-specific exonuclease-like protein
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114337278|gb|ABI68126.1| Single-stranded DNA-specific exonuclease-like protein
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 932

 Score =  286 bits (733), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 189/559 (33%), Positives = 300/559 (53%), Gaps = 21/559 (3%)

Query: 33  ITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I ++  I  ++AR+LV R +S  + A  FL   +  L  DP  L D D A  RI QAI  
Sbjct: 17  IAEELGISCLLARILVKRGISETEEANRFLYGKLEDLN-DPFQLKDMDLAVARIEQAIAA 75

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            EKI+++GDYDVDG  S+ +++  L     N + Y+PDR ++GYG N   +EK  +EG Q
Sbjct: 76  GEKIVVYGDYDVDGVCSIVILLECLQLLGANCSYYVPDRFLEGYGLNSDAIEKLASEGCQ 135

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           L+ITVDCG +S    Q A + G+D+I+ DHH+   +  PA A++NP +L   +G   L  
Sbjct: 136 LLITVDCGISSLAEGQLACDLGMDLIITDHHRPLDKLPPAVAIINP-KLGGGAGSSDLAG 194

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
           AGV F +   ++R   +  K      L + L+LVALATV D+VPL   NR  V  GL   
Sbjct: 195 AGVAFNLAAALWRGRMEQEK------LYNWLELVALATVADIVPLRSDNRIMVKYGLKKI 248

Query: 272 RRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
            +    GL+AL+    +    +   ++ +++GP +N+ GR+  +     LL++ D +   
Sbjct: 249 GQTSRKGLRALLRETALEGKNLRTWHIAFVLGPRLNSAGRLNSARNSIELLLAQDEKRAA 308

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A  L  +N+ R+ +E  +  +A A++  Q  D+++  ++++ G++WH G++G++A+RL
Sbjct: 309 SMAAFLCRVNEERKRIEETIFREAVAEI-EQHIDLEKDPILLLGGEKWHDGVIGIVASRL 367

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
            E + RP   IS+E D  G GS RSI G DI   + +A   G L + GGH MAAGL +ER
Sbjct: 368 NEHYRRPCILISWEGDC-GRGSARSIAGIDIFAALDYA--SGFLQQFGGHKMAAGLRLER 424

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            NF    +   ++A     + +     KID  +  + +N AL+  LE   P G GNP P+
Sbjct: 425 RNFPAFKEKILEWAATQELSSLKPSERKIDAEIKPADINEALLKELELLQPCGEGNPVPL 484

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFL-MQSRGKRMHVTG 569
           F      + S  ++         +++  E L+ IAF        +++ +  R     +  
Sbjct: 485 FLLRQVSINSAALIGKGREHFKIKTEPDE-LEGIAFNQ-----AQYMELPWRNSCQDLLF 538

Query: 570 HLCVNYWRGSKRCQLRVLD 588
            L  N ++G KR QL+V D
Sbjct: 539 ELTENEYQGRKRIQLKVKD 557


>gi|258515504|ref|YP_003191726.1| single-stranded-DNA-specific exonuclease RecJ [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257779209|gb|ACV63103.1| single-stranded-DNA-specific exonuclease RecJ [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 907

 Score =  286 bits (732), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 176/565 (31%), Positives = 304/565 (53%), Gaps = 29/565 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           IT++  +  I+A+++VNR + +++  K+F+   +  L  +P IL D  KA  RI++A+  
Sbjct: 20  ITKELGVSPILAQLMVNRGLGTVEQIKNFMEYDLSSL-NNPYILQDMQKAVNRIIEAVNR 78

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
           SEKI+I+GDYDVDG    AL++  L   + + N YIP RI +GYG +   +EK   +G  
Sbjct: 79  SEKILIYGDYDVDGITGTALLVGALRRLTDHVNYYIPHRIKEGYGLHKEAVEKAAGQGYS 138

Query: 152 LIITVDCGSTSYDALQYAT-NQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
           LIITVDCG +  +A+ ++  N   D+I+ DHH+       A A++NP R D       L 
Sbjct: 139 LIITVDCGISGKEAVDWSVQNTKTDIIITDHHEPPPVLPAALAVINPKRKDCEYPFKELA 198

Query: 211 AAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
             GV   ++  +Y      ++    +     LD+V L T+ DVVPL+G NR  V  GL  
Sbjct: 199 GIGVALKLVQAVYAAANMSSETWKEY-----LDIVCLGTIADVVPLLGENRILVKYGLPY 253

Query: 271 ARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +    GL ALI+   +   IT+  +G+++ P +NA GR+G+  +   LL+++D  +  
Sbjct: 254 LTKTSKKGLIALIKASGLRGDITSGQVGFVLAPRLNAAGRLGDPFMAVELLLTEDEAQAN 313

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A+ LD  N+ R+ +E A L++A  +++ +    +Q+ V+V+  + WHPG++GL+A+RL
Sbjct: 314 QIAVVLDEKNRKRKSVEDAALKEA-IQMIEREISFKQSKVLVLASEEWHPGVIGLVASRL 372

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
            E++ +P  AI+ + + +G GS RSI GF++ + +    +   L   GGH MAAG +++R
Sbjct: 373 VERYYKPVLAIALDGE-QGKGSARSIPGFNLYQALEHCGKN--LSGYGGHTMAAGFSLKR 429

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            +          +A  ++   +  PV  +DG+ + + +   +I  +E   P+G  NP P+
Sbjct: 430 ESLDNFIREINVYADEVISEDLLVPVMNLDGIFSLNDITEQVIAEIEKLAPFGQANPGPL 489

Query: 511 FAFPNHKLQSIRVVNLA-------HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGK 563
              P      I+VVN         HL++    ++   +  I F +      E L  +  +
Sbjct: 490 LCCP-----EIQVVNFKGVGKEGEHLKIKIRKENG-FIDGIGFNL--ASYSEML--ATAE 539

Query: 564 RMHVTGHLCVNYWRGSKRCQLRVLD 588
           R+++     +N W+G +   LR+ D
Sbjct: 540 RVNLAFVPEINEWQGKRHISLRIKD 564


>gi|297544505|ref|YP_003676807.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842280|gb|ADH60796.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 815

 Score =  286 bits (731), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 173/506 (34%), Positives = 280/506 (55%), Gaps = 33/506 (6%)

Query: 16  FRWVSLLGQEGINRALA--ITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPL 73
           +RW+    +E  N  L+  I + + +  I+A +L +R +++   K FLNP ++ L   P 
Sbjct: 9   YRWIL---KESKNSQLSQEIQKTYGLSKIIADMLASR-LNLHEVKSFLNPDLKDLH-SPY 63

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +L    +A   I Q I + + I I+GDYDVDG  + A++   L       + YIP+R+V+
Sbjct: 64  LLRGIKEAKELIQQHIASKDLITIYGDYDVDGITATAILYLTLKKLGAKLDYYIPERLVE 123

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG N   ++K    G +LI++VDCG TS   ++ A   GIDVI+ DHH +  E   A  
Sbjct: 124 GYGINEEAIDKIAERGTKLIVSVDCGITSVKEVEKAKILGIDVIITDHHSIPKEIPQADV 183

Query: 194 LVNPNRLDDLSGQGH----LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALAT 249
           ++NP+    L G  +    L   GV F +           ++  +  +    LD+V++ T
Sbjct: 184 VINPH----LPGIEYPFCDLAGVGVAFKL-----------SQALIGEEAHKFLDIVSIGT 228

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAG 308
           + D+VPL+G NR  V +GL       N GLKALI+   + +  I   ++G+++ P +NA 
Sbjct: 229 IADIVPLLGENRIIVKEGLKRLNETQNIGLKALIKASGLENVEIDEYHVGFILAPRLNAA 288

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+  +    RLLIS   +E+E +A  L+  N NR+ +E+ +L+QA  KV  +  D+ + 
Sbjct: 289 GRLKSAEAAVRLLISHSKEEVEKIAEYLNQENLNRQQIENQILQQAIKKV-EETVDLNRE 347

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSF 427
            VIV+  + WHPG++G++A+R+ E+F RPS  IS  EE+GK  GSGRSIEGF++ K + +
Sbjct: 348 KVIVLWDENWHPGVIGIVASRITERFHRPSILISLGEEEGK--GSGRSIEGFNLYKALEY 405

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
              +  L+K GGH MAAG+ +E+ N         ++A  ++  L   P  KI+  +    
Sbjct: 406 C--KDYLIKYGGHEMAAGINIEKNNLEIFKAKINEYADTVLSELDLIPSLKIEAKVKNEK 463

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAF 513
           ++I +   ++   P+G+ NP P F F
Sbjct: 464 IDIEIAKQVQKLKPFGSNNPRPNFLF 489


>gi|289578224|ref|YP_003476851.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           italicus Ab9]
 gi|289527937|gb|ADD02289.1| single-stranded-DNA-specific exonuclease RecJ [Thermoanaerobacter
           italicus Ab9]
          Length = 815

 Score =  286 bits (731), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 173/506 (34%), Positives = 280/506 (55%), Gaps = 33/506 (6%)

Query: 16  FRWVSLLGQEGINRALA--ITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPL 73
           +RW+    +E  N  L+  I + + +  I+A +L +R +++   K FLNP ++ L   P 
Sbjct: 9   YRWIL---KESKNSQLSQEIQKTYGLSKIIADMLASR-LNLHEVKSFLNPDLKDLH-SPY 63

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +L    +A   I Q I + + I I+GDYDVDG  + A++   L       + YIP+R+V+
Sbjct: 64  LLRGIKEAKELIQQHIASKDLITIYGDYDVDGITATAILYLTLKKLGAKLDYYIPERLVE 123

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG N   ++K    G +LI++VDCG TS   ++ A   GIDVI+ DHH +  E   A  
Sbjct: 124 GYGINEEAIDKIAERGTKLIVSVDCGITSVKEVEKAKILGIDVIITDHHSIPKEIPQADV 183

Query: 194 LVNPNRLDDLSGQGH----LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALAT 249
           ++NP+    L G  +    L   GV F +           ++  +  +    LD+V++ T
Sbjct: 184 VINPH----LPGIEYPFCDLAGVGVAFKL-----------SQALIGEEAHKFLDIVSIGT 228

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAG 308
           + D+VPL+G NR  V +GL       N GLKALI+   + +  I   ++G+++ P +NA 
Sbjct: 229 IADIVPLLGENRIIVKEGLKRLNETQNIGLKALIKASGLENVEIDEYHVGFILAPRLNAA 288

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+  +    RLLIS   +E+E +A  L+  N NR+ +E+ +L+QA  KV  +  D+ + 
Sbjct: 289 GRLKSAEAAVRLLISHSKEEVEKIAEYLNQENLNRQQIENQILQQAIKKV-EETVDLNRE 347

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSF 427
            VIV+  + WHPG++G++A+R+ E+F RPS  IS  EE+GK  GSGRSIEGF++ K + +
Sbjct: 348 KVIVLWDENWHPGVIGIVASRITERFHRPSILISLGEEEGK--GSGRSIEGFNLYKALEY 405

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
              +  L+K GGH MAAG+ +E+ N         ++A  ++  L   P  KI+  +    
Sbjct: 406 C--KDYLIKYGGHEMAAGINIEKNNLEIFKAKINEYADTVLSELDLIPSLKIEAKVKNEK 463

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAF 513
           ++I +   ++   P+G+ NP P F F
Sbjct: 464 IDIEIAKQVQKLKPFGSNNPRPNFLF 489


>gi|319651682|ref|ZP_08005809.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus sp.
           2_A_57_CT2]
 gi|317396749|gb|EFV77460.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus sp.
           2_A_57_CT2]
          Length = 772

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 185/562 (32%), Positives = 302/562 (53%), Gaps = 27/562 (4%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           ++++  I  + A +L+NR + ++D A+ FL    +    DP ++TD  KA  RI +AI  
Sbjct: 4   LSKELNISPLAASLLINRGMDTVDSARYFLLDKDQEFH-DPCLMTDMAKAVSRIKEAIEK 62

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E I+IFGDYD DG  S ++MM  L     +   YIP+R  +GYGPN    E+  + G +
Sbjct: 63  QEPILIFGDYDADGVTSTSVMMMALRDLGADVQFYIPNRFTEGYGPNIPAFEQAADTGIR 122

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LIITVD G ++ +  + A   G+D+I+ DHH+   E   A+A+V+P   D       L  
Sbjct: 123 LIITVDTGISAVNEAKAAKELGMDLIITDHHEPGHELPEAWAIVHPKHPDSRYPFRELAG 182

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F +   +Y       ++P +     LL++ A+ T+ D+V L G NR    +G+   
Sbjct: 183 VGVAFKLAHALY------GEMPDH-----LLEIAAIGTIADLVSLTGENRLIAKRGIQKL 231

Query: 272 RRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           +   N GLKAL +   I  P I  E +G+ IGP +NA GR+  ++    LL+++D  E +
Sbjct: 232 KSTKNTGLKALFKAAGIELPSINEETIGFTIGPRLNAAGRLESADPAVDLLLTNDPYEAQ 291

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A ++++LN+ R+ + + +  QA  +V      I + SVIVV  + W+ G++G++A++L
Sbjct: 292 AIAEEIEMLNKERQAIVNDIAAQAVKEVEANF-PISKNSVIVVGKEGWNAGVIGIVASKL 350

Query: 391 KEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
            EKF RP+  +S++ D G   GS RSI+GFD+ K +S   +  IL   GGH MAAG+T+ 
Sbjct: 351 VEKFYRPAIVLSYDSDKGLAKGSARSIKGFDLFKNLSECRD--ILPHFGGHPMAAGMTLS 408

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
             +   L D     A+  +      PV  IDGV +   ++++ I+ ++   P+G GNP P
Sbjct: 409 IESVDDLRDRLNTLANEQLTEEDFIPVTSIDGVFHLKDISLSSIEEMQLLAPFGMGNPKP 468

Query: 510 VFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMH 566
                   + ++R +  +  H+++T E+ D  +L  I F      LG    Q S   ++ 
Sbjct: 469 KVMIKEANIAAMRKIGSDQTHIKVTIEN-DGSSLDGIGF-----GLGHLHEQISPYSKLS 522

Query: 567 VTGHLCVNYWRGSKRCQLRVLD 588
           V G L +N W   K+ Q+ + D
Sbjct: 523 VIGELSINEWNNIKKPQIFLQD 544


>gi|56421115|ref|YP_148433.1| single-strand DNA-specific exonuclease [Geobacillus kaustophilus
           HTA426]
 gi|56380957|dbj|BAD76865.1| single-strand DNA-specific exonuclease [Geobacillus kaustophilus
           HTA426]
          Length = 773

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 190/579 (32%), Positives = 300/579 (51%), Gaps = 31/579 (5%)

Query: 17  RW-VSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           RW V  L ++ + R   + ++  +  ++AR+LV R V +   A  FLNP +R    DP +
Sbjct: 7   RWEVERLDEQAVRR---LAEEAGVTPLLARLLVRRGVRTASEAAAFLNP-LRQPFHDPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L   ++A +R+ +AI   E+++++GDYD DG  S ++M+  L     +   YIP+R  +G
Sbjct: 63  LDGMERAIQRLKRAIDAGERVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YGPN +        G  +I+TVD G  +   +  A   G+DVIV DHH+       A+A+
Sbjct: 123 YGPNMAAFRSAKERGVSVIVTVDNGIAAVKEIAAANEWGMDVIVTDHHEPGPVLPEAHAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVL-VLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++P +         L   GV F V   L+ R+ R             LLDLVA+ T+ D+
Sbjct: 183 IHPKQPGSTYPFRDLAGVGVAFKVAHALLGRVPRH------------LLDLVAIGTIADL 230

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIG 312
           VPL+G NR +V  GL   R     GL+AL  +  I ++ I  + +G++I P +NA GR+G
Sbjct: 231 VPLVGENRLFVAHGLEALRATERIGLRALFRQCRIDAAAINEQTVGFVIAPRLNAAGRLG 290

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            ++    LL++DD  E   LA ++D LN+ R+ + + + E+A   V  Q    ++  V+V
Sbjct: 291 GADPAVALLMTDDENEAVQLAAEMDELNRERQQLVAQIAEEAADMVRRQFPP-EEHRVLV 349

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V G+ W+ G+VG++A++L E+F RP+  +S + E G   GS RSI GFD+    S +   
Sbjct: 350 VAGEGWNAGVVGIVASKLVEQFYRPAVVLSIDREKGIAKGSARSIHGFDL--FASLSQCR 407

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L   GGH MAAG+T+   +   L       A   +     TP   ID   + + + ++
Sbjct: 408 DLLPHFGGHPMAAGMTLSLDDVEELRQRLNDIAAETLSEDDFTPPTFIDASCSIAELTLS 467

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVY 549
               LE   P+G GNP P+       ++++R V  N AH++  F SQD   + AI F + 
Sbjct: 468 AARSLERFAPFGVGNPRPLVLIEGASVETMRRVGANGAHMKAVF-SQDGAAIDAIGFGL- 525

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
             PL E +      R+   G L VN W G  + QL + D
Sbjct: 526 -GPLCEEIAPD--ARISAVGELSVNEWNGFAKPQLSLCD 561


>gi|332799396|ref|YP_004460895.1| single-stranded-DNA-specific exonuclease RecJ [Tepidanaerobacter
           sp. Re1]
 gi|332697131|gb|AEE91588.1| single-stranded-DNA-specific exonuclease RecJ [Tepidanaerobacter
           sp. Re1]
          Length = 861

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 186/524 (35%), Positives = 289/524 (55%), Gaps = 25/524 (4%)

Query: 71  DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
           DP++L D DKA  RI +A+   +K+ I+GDYD DG  S A++M+ L +     N YIP R
Sbjct: 55  DPMLLKDMDKAVVRIKEALSKKQKVTIYGDYDADGITSCAVLMKLLKNLGGTVNYYIPSR 114

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           + +GYG N   ++    +G +LIITVD G +S + +QYA++ G+DVI+ DHH+ + +++P
Sbjct: 115 LDEGYGLNKDAIDMIHKQGTKLIITVDNGISSCEEVQYASSLGLDVIITDHHEPQ-QKMP 173

Query: 191 --AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALA 248
             A A+V+P R D       L   GV    L L   +  +D K         LL+L A+ 
Sbjct: 174 QAAIAIVDPKREDCSYPFKELAGVGV---ALKLACALKGKDLKFG-----KELLELAAIG 225

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINA 307
           TV D+VPL+  NR  V  GL       N GLKA++  +N++   I    + Y++ P +NA
Sbjct: 226 TVADIVPLLDENRIIVKNGLDDLGNTKNLGLKAMMNLLNLNDISIEPGKISYLLAPRLNA 285

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRI    +   LL+ +D++    LA  L+ +NQ R+ +E+ +L++A+  V+ Q  D+  
Sbjct: 286 AGRIANPEIAVELLLCEDAKRAFELATTLERINQERQTLEAKILDEAKT-VIEQEIDLDI 344

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
            ++IV+    WHPG+ G +A++L E + RP   IS E+  +G GSGRSI GF++   +S 
Sbjct: 345 ENIIVISSANWHPGVTGTVASKLVEIYSRPCIIIS-EKGDEGRGSGRSISGFNLFNALSK 403

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRL-CDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
                +L++ GGH  AAGL+++  N G    +  Q F  + V     +P   ID  LN S
Sbjct: 404 LSH--LLIRFGGHEQAAGLSIKVENIGTFRRELNQLFVQDTVQK-DASPKLDIDLELNQS 460

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAI 544
            +N+ L + LE   P+G GNP PVF   N  +Q++R V     HL++  +S ++  + AI
Sbjct: 461 DINLKLAEQLELMKPFGYGNPKPVFMCRNLHIQNLRTVGSGDKHLKLNLKSHEN-NIDAI 519

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            F  +G    +  M +    M    +L VN W+GS   QL + D
Sbjct: 520 GFN-FGLYKEDLDMAT---IMDAAFYLEVNRWKGSIEPQLNIKD 559


>gi|303230873|ref|ZP_07317620.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514633|gb|EFL56628.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 664

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 190/554 (34%), Positives = 296/554 (53%), Gaps = 22/554 (3%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           IVAR++VNRN+  D    FL  +++ L+ DP  L D + A   I++ I   + I+++GDY
Sbjct: 28  IVARLMVNRNIDSDEGHRFLEGTLKDLL-DPFTLKDMETAVALILETIEAKKSIVVYGDY 86

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDG  + +L+ RFL       + YIP+R  +GYG N   +E  I++GA L+ITVDCG +
Sbjct: 87  DVDGITATSLLYRFLVKMRARVSYYIPERQSEGYGLNLEALEHIISDGASLVITVDCGIS 146

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
           SYD ++   ++ ID+I+ DHH    +  PA A++N  + D      +L   GV F +   
Sbjct: 147 SYDIVEAVCDR-IDIIITDHHTAPPQIPPARAVINHKQPDCPYTDKNLSGVGVAFKLCQA 205

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           ++  LRQ  +  L+      LD+VAL TV DVVPL+G NR  V  GL       N G+  
Sbjct: 206 LW--LRQCGEWYLDD-----LDIVALGTVADVVPLVGENRIIVQAGLKKMNELPNLGIDK 258

Query: 282 LIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           LI+   +    ITA ++G+ + P +NA GR+  +     LL++DD    E +A +L   N
Sbjct: 259 LIDVAGLHDKTITAGHIGFTLAPRLNAAGRVTHATRAVELLVTDDVDLAETIAQELQETN 318

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
             R+ +E ++ E+A A V  Q        V VV G+ WHPG++G++A+RL E+F +P+  
Sbjct: 319 MERQEIERSIHEEARANVAAQGH--LADYVTVVAGENWHPGVIGIVASRLVEEFYKPTLV 376

Query: 401 ISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF 460
           IS  ++G G GS RSIEGF+I   +     E IL++ GGHA AAG +++      L    
Sbjct: 377 ISI-DNGVGKGSCRSIEGFNIYNALKSC--EDILIQFGGHAAAAGFSIDASRIDELRHRL 433

Query: 461 QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQS 520
            ++    V      PV  ID  L    +++ ++D + +  PYG GN  P+F   + K+Q 
Sbjct: 434 TEYCKVQVSPDEYIPVVSIDATLPVDDIDVDIVDRVSALEPYGMGNSTPIFGVMDAKVQD 493

Query: 521 IRVVNL--AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG 578
           I ++     H ++   + +  ++ AIA+      L   + Q  G  + V   L  N W+G
Sbjct: 494 IMLMGQLKNHCKVILATANG-SVDAIAWN--RPDLFRHIFQ--GMNVKVAFTLQKNEWQG 548

Query: 579 SKRCQLRVLDASPV 592
               QL + D  P+
Sbjct: 549 FVSPQLMIQDIEPI 562


>gi|290968823|ref|ZP_06560360.1| single-stranded-DNA-specific exonuclease RecJ [Megasphaera
           genomosp. type_1 str. 28L]
 gi|290781119|gb|EFD93710.1| single-stranded-DNA-specific exonuclease RecJ [Megasphaera
           genomosp. type_1 str. 28L]
          Length = 658

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 180/522 (34%), Positives = 285/522 (54%), Gaps = 27/522 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           +T++  I  +++++LVNR ++ ++  + FL  +I     DP  +   + A  R+ +AI  
Sbjct: 18  LTKELHISPVLSKMLVNRGITTVEEGRHFLRDTI-ADSADPYRMKGLEAAVLRLDKAIDE 76

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E+I+I+GDYDVDG  + A+M   L         YIP+R  +GYG +   +E     G Q
Sbjct: 77  QERIVIYGDYDVDGITATAIMCAVLRDLGAAPEFYIPERQSEGYGLHQEALEYLQQIGTQ 136

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           +++TVDCG  S+D L    N  +D+I+ DHH+  S+  PAYA+++  ++D       L  
Sbjct: 137 VLVTVDCGIASHD-LVARFNTAMDIIITDHHEPPSKVPPAYAVLDAKQVDCSYPYKELAG 195

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
           AGV +L+   +++  R     PL     +  ++ AL T+ D+VPL G NRA V  GL   
Sbjct: 196 AGVAYLLCRALWQKRRH---TPLE----NYAEIAALGTIADLVPLTGENRALVRAGLQRM 248

Query: 272 RRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           R+  N GL+AL +   I +  ITA  + Y I P +NA GRI  +  G +LL+S D +E  
Sbjct: 249 RQGANMGLQALFQEARIEAEKITAGRIAYTIAPRLNAAGRISHAKQGVQLLLSHDREETR 308

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A +L  LNQ R+ +E  + + A  ++  Q  +  +  V++  G+ WHPG++G+ A+RL
Sbjct: 309 TIAARLTALNQERQRLEQDIAQLAATQISAQGRE--KDGVLIAYGEDWHPGVIGIAASRL 366

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
            EKF RP+  IS  ++G G GS RSI GF++ + + FA  E +L++ GGH MAAG +V  
Sbjct: 367 VEKFYRPALVISI-QNGIGKGSCRSIPGFNMYQALQFA--EDLLLQYGGHTMAAGFSVRV 423

Query: 451 VNFG----RLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
            N      RLC++    A  + P     P   ID  L+   +++ LI  L    PYG GN
Sbjct: 424 ENIEALRRRLCEY---AAQQLCPD-DYIPRLAIDMQLDIQDISLELIQELSCLEPYGMGN 479

Query: 507 PNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAF 546
             P+F+     LQ I+ +     HL++  ++   E L AI +
Sbjct: 480 SRPIFSLSRAVLQHIQPIGAGNRHLRLVIDTPQRE-LTAIGW 520


>gi|297616953|ref|YP_003702112.1| single-stranded-DNA-specific exonuclease RecJ [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297144790|gb|ADI01547.1| single-stranded-DNA-specific exonuclease RecJ [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 951

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 189/570 (33%), Positives = 302/570 (52%), Gaps = 35/570 (6%)

Query: 33  ITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I +   I +++AR+L  R +   + A+ F++  +  L  DP +L D   A  R+ +A   
Sbjct: 20  IQESLGISEVLARLLYLRGIRTREEARLFIDGGLDDLC-DPFLLPDLAAAVNRLEKARQY 78

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            EK++I+GDYDVDG  SV ++  FL +  V  + YIP+R  +GYG N   +++ + +  Q
Sbjct: 79  REKVLIYGDYDVDGICSVVMLKEFLDYLGVENSYYIPNRFSEGYGLNEEAVKEAVQKQYQ 138

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           L++TVDCG +S   ++ A   G+DV+V DHHQ   +  PA A+VNP  + +  G   L  
Sbjct: 139 LLVTVDCGISSCREIELAAGLGLDVVVTDHHQPPEQLPPAVAIVNPKLVQE-PGLQELAG 197

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
           AGVVF ++         D   P  +D    LDLV LATV D+V L+G NR  V  GL   
Sbjct: 198 AGVVFKLVTAW-----ADIAAP-EYDKTKWLDLVCLATVADIVALLGENRLLVKAGLEFV 251

Query: 272 RRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
            +   PGL+AL++   ++   + A ++GY++ P +NA GRIG++++   LL++ D  +  
Sbjct: 252 AKTERPGLRALLDESGLNGKSLKAWHIGYVVAPRLNAAGRIGDADVAVELLLTQDPGKGL 311

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            LA  L   N+ R+ +E+ +L+QA  K +    DI+   V+VV GD WH G++G++A+RL
Sbjct: 312 DLARFLIQQNRQRQEVEAQILQQA-TKEVADSADIEAQRVLVVAGDGWHQGVIGIVASRL 370

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
            E+FGRP+  IS++ED  G GSGRS++GFD+ + +       IL + GGH  AAGL +ER
Sbjct: 371 TEQFGRPTILISWDED-YGKGSGRSVDGFDLYQALCQCSH--ILNRFGGHRYAAGLILER 427

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
             F    +   + A ++  +       +ID  +    ++  L++ L    P+G GNP P 
Sbjct: 428 ARFHEFREEINRVAASMTGSAGLVQRLEIDCEVALDDIDCQLLNELAMLEPFGEGNPVPN 487

Query: 511 FAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRV-------YGTPLGEFLMQSR 561
                  L  +  V  N  H +   ++     ++AIAF         Y + L + + Q  
Sbjct: 488 LLLRRSHLSDLMWVGKNSEHAKFWVDN-GKRKIEAIAFNAKIEKEVDYSSFLVDLVFQPE 546

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
                      ++ + G  R  L+V D  P
Sbjct: 547 -----------LDVYNGDTRLVLKVRDMKP 565


>gi|56459932|ref|YP_155213.1| hypothetical protein IL0824 [Idiomarina loihiensis L2TR]
 gi|56178942|gb|AAV81664.1| Single-stranded DNA-specific exonuclease [Idiomarina loihiensis
           L2TR]
          Length = 570

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 177/480 (36%), Positives = 270/480 (56%), Gaps = 9/480 (1%)

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY-IPDRIVD 133
           L D  KA   +  A+ N  K+ I GD+D DGA S ALM+  L    +    Y +P+R+ D
Sbjct: 53  LRDIGKAVELLQNALKNQAKVCICGDFDADGATSSALMVSALQAFGLQQVGYRVPNRMTD 112

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG + +++E+   E  QLI+TVD G  ++DA+  A  +GI V+V DHH    E  PA A
Sbjct: 113 GYGLSVAMVEQLAVENVQLIVTVDNGIAAHDAIVLAREKGIQVLVTDHHLPPEELPPANA 172

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +VNPN+        +L   GV F VL+ +   LR+    PL  +L   LDLVAL TV DV
Sbjct: 173 IVNPNQHGCEFSSKNLAGVGVAFYVLLALRSALREQGVEPLP-NLADWLDLVALGTVADV 231

Query: 254 VPLIGLNRAYVVKGLMVARR-QGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRI 311
           VPL   NR  V +G+   R+    PG+KAL+E  N  +S + A +LG+ +GP INA GR+
Sbjct: 232 VPLDYNNRVLVQQGIARIRKGMSRPGIKALLEVANRDASQLAASDLGFALGPRINAAGRL 291

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC-DDIQQASV 370
            +  LG   L++ +++  + LA +L+ LNQ R+ +E+ M E AE+ V   C D  Q   +
Sbjct: 292 DDIGLGIECLLAGETRA-QQLAQQLNDLNQQRKSIETEMREHAESAVAKLCFDQGQVPDL 350

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FA 428
           + +    WH G++G++A R+KE+  RP  A++ ++D    GS RS+ G  +  ++    +
Sbjct: 351 VTLYQPDWHAGVIGIVAGRVKEQVNRPVIALANDDDEFLKGSARSVSGLHMRDLLERVHS 410

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
           ++ GI+ + GGHAMAAGLT+++ N  R  +  ++ A   +       VF  DG L  + +
Sbjct: 411 LQPGIMERFGGHAMAAGLTMKKENLTRFSELAEQVASEWLSEEQKQRVFWSDGELTTTQL 470

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRV 548
           ++  ++ L+SAGP+G   P P+F     +L   R+V   HL++       E L AIAF V
Sbjct: 471 SLDSVNTLQSAGPWGQQFPEPMFD-GQFELVDQRIVGERHLKLVVRHPQGELLDAIAFNV 529


>gi|313113515|ref|ZP_07799104.1| single-stranded-DNA-specific exonuclease RecJ [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624242|gb|EFQ07608.1| single-stranded-DNA-specific exonuclease RecJ [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 710

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 182/519 (35%), Positives = 277/519 (53%), Gaps = 17/519 (3%)

Query: 30  ALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAI 89
           ALA  QK     ++A VL  R ++ D  +     +    + DP +LTD DKA  RI +AI
Sbjct: 49  ALAAQQKENA--LLAGVLTARGIT-DPTEALTLLAGEEELSDPSLLTDMDKACERIWRAI 105

Query: 90  YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEG 149
              E I++FGDYDVDG  + AL+ + L          +P R  DGYG + + +    ++G
Sbjct: 106 DEGETIVVFGDYDVDGVTATALLYQHLKGMGATVKCMLPSREGDGYGLSRNAIRSIHDKG 165

Query: 150 AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGH 208
            +LI+TVD G ++ +   YA   GID+I+ DHH +  E +P A A+V+P R DD S    
Sbjct: 166 CKLIVTVDNGISAVEEADYAAELGIDLIITDHH-LPPETLPKAIAVVDPRREDDTSPFKG 224

Query: 209 LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGL 268
           LC AGV F +   +       +  P    L    DL A+ TV DV+PL G NR  V  GL
Sbjct: 225 LCGAGVAFKLCAAL-------DGCPPEEMLDYCGDLAAVGTVADVMPLTGENRTLVKAGL 277

Query: 269 MVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQ 327
              +    PGL+AL+E V ++  P+TAEN+ Y I P INA GR+  +    +L++ +D  
Sbjct: 278 RQLQNTDRPGLEALLEEVGLAGKPVTAENVSYAIAPRINAAGRMDNAVTALQLVMCEDPD 337

Query: 328 ELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLA 387
               LA KL+ +N  R+  E  + + A+ ++L Q  +  +  V+++ G  WHPG++G++A
Sbjct: 338 RAAELAHKLNEINTKRQETELQIFKAAQ-ELLEQEPERLEDRVMLLWGRDWHPGVIGIVA 396

Query: 388 ARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLT 447
           +RL E+ GRP   ++ +E G+  GSGRS++GF++   +    +  +L++ GGHAMAAGL+
Sbjct: 397 SRLVERTGRPVIVVTIDEHGECKGSGRSVQGFNLHACIGACAD--LLIRYGGHAMAAGLS 454

Query: 448 VERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNP 507
           V   N   L      +A    P L TTP  + D  ++   V +  +  L+   PYGA NP
Sbjct: 455 VREENLPALRRRLNDWAARECPVLHTTP-LECDLPIHLDRVTVESVRKLDQLAPYGAENP 513

Query: 508 NPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAF 546
            PVF   N  L  +  V+          Q + ++ A+ F
Sbjct: 514 TPVFLLQNAVLDGVYPVSEGRHSRLRLRQGNASVYAVWF 552


>gi|71083701|ref|YP_266421.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062814|gb|AAZ21817.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 564

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 178/590 (30%), Positives = 302/590 (51%), Gaps = 44/590 (7%)

Query: 12  SISGFRWVSLLGQEGINRALA--ITQKHAIPDIVARVLVNR----------NVSIDYAKD 59
           S+SG +W     Q+ IN+ +   + Q+H   +I++R++++R          N  +D    
Sbjct: 3   SVSGKKW----EQKKINQNIVDKLKQEHDFSEILSRLIISRKFDNDEIATINTDLDLNNV 58

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FLN              D  ++   +V +I N+EKI I GDYDVDG+A+ +L ++F    
Sbjct: 59  FLNNK------------DFSQSINLVVNSINNNEKICILGDYDVDGSAATSLFVKFFEDI 106

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
           +     YIPDR  DGYG    L +K I E  +LII VDCGSTS +A+ +     I  ++I
Sbjct: 107 NHPFFYYIPDREKDGYGATKKLFQKLILEKPKLIIMVDCGSTSNEAIDFLNENEIKSLII 166

Query: 180 DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           DHH++      A +++NP + +      +LCA  + +  L L+ + ++    +       
Sbjct: 167 DHHEINKPFPNANSIINPKKDNSYKEYDYLCATTLTYFFLDLLIKKIKTKINIS------ 220

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             L  V LATVCDV+PL  LNR   +  L       N  L  L +     + I   +LGY
Sbjct: 221 DYLIYVLLATVCDVMPLRKLNRLIALNALKNFDITKNLPLSTLFDLNEKKNKININDLGY 280

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           +IGP +NAGGR+G+S   + LL S++ Q ++  +  L  LN  R+ +E+ +L + + K +
Sbjct: 281 LIGPILNAGGRLGKSQYATELLSSNNDQVIKDRSTYLIKLNNKRKEIENLLLNEIDFKKI 340

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +    +   VI+      + G++G++AARLK+ F +PS  I+   +    GS RS+  +
Sbjct: 341 EK----ENKEVIIYYNPNINEGLIGIIAARLKDYFNKPSIVITASNELLK-GSARSVYNY 395

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPA-LITTPVFK 478
           +IG+++   +++ I++ GGGH MAAG T+ + N   L DF      + + +  +   +F 
Sbjct: 396 NIGRIIKNLLDKDIIINGGGHNMAAGFTLNKAN---LKDFENYILEDFLKSNTVNNNIFS 452

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
            +  ++  A N    D ++   P+G GN  P F   + K+    V+N  H+ +  +S+  
Sbjct: 453 YESEVSPLAFNQDFYDDIKKLEPFGTGNSVPTFMLRDLKIIKPIVLNNKHISVILKSKTG 512

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            ++++I+F    T +GE LM  +   ++V G +  N W   K  QL + D
Sbjct: 513 FSIKSISFNTINTMIGEHLMSYKN-NINVIGQIGENIWNNKKTLQLTIRD 561


>gi|227509463|ref|ZP_03939512.1| single-strand DNA-specific exonuclease RecJ [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227191175|gb|EEI71242.1| single-strand DNA-specific exonuclease RecJ [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 776

 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 192/584 (32%), Positives = 297/584 (50%), Gaps = 30/584 (5%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           S F+W  +       +  A+++   I  ++A +L+ R VS + A +DFL PS +    DP
Sbjct: 4   SKFKW-QIRQNTDPQQVQALSEALKIDPLIASILLQRGVSTEEAAQDFLTPSSKDFH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D  K   RI  A+ N E+I ++GDYD DG  S  +M   L+    N + YIP+R  
Sbjct: 62  YLMHDMKKGIARIQHAVENEEQITVYGDYDADGITSTTIMYEVLNDLGANVDYYIPNRFS 121

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           DGYGPN    EK IN G  LIITVD G    +A+  A +   DV+V DHH +      AY
Sbjct: 122 DGYGPNVDAFEKIINNGTTLIITVDNGVAGNEAIDVANSLHCDVLVTDHHSLPEVLPNAY 181

Query: 193 ALVNPNRLDDLSGQ----GHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALA 248
           A+++P R+ +  G+    G L  AGV   V     + L +D  +P++F     +D+ A+ 
Sbjct: 182 AIIHP-RVKNQEGRAYPFGDLSGAGVALKVA----QALMED--LPIDF-----IDVAAIG 229

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINA 307
           TV D+V L   NRA V  GL   R    PGL ALI+  +I  S    +++G+ I P +N+
Sbjct: 230 TVADIVSLKDENRAIVKFGLNAIRNTQRPGLLALIKAADIDLSKFDEQDIGFGIAPRLNS 289

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRI ++N+G  LL + D Q+   LA   D  N +R+ +     +QA  +++    D + 
Sbjct: 290 LGRIDDANIGVELLSTFDDQKATELAKFADHQNDSRKSLVDEFYQQA-VQMVESSGDAEN 348

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI-GSGRSIEGFDIGKMVS 426
            S +VV GD WH G++G++A++L EK+GRP+  ++ ++    + GSGRS+E FD+   + 
Sbjct: 349 RSTLVVVGDDWHQGVLGIVASKLVEKYGRPTIVLTSQDGNDQVKGSGRSVESFDLFSAID 408

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
              ++ I    GGH  A GLT+ +     L D  +K A +    L   P   I   ++A 
Sbjct: 409 PIRDQTIGF--GGHHSAVGLTINKDKISVLKDQLEKAAEDQELDLSQKPTLDIAAKISAD 466

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAI 544
            ++   I  L    P+G  NP PVF     +L  ++ +     HL+ +     S  L A+
Sbjct: 467 QIDNQFIKNLNVLAPFGQDNPKPVFEIEYDQLIDVKTMGKTGDHLRFSLVKNKSR-LTAV 525

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AF   G   G+  + +    + V+G +  N W      QL V D
Sbjct: 526 AFG-QGAAAGQ--LSNGSASIKVSGEINENTWNNHTTIQLMVSD 566


>gi|294794005|ref|ZP_06759142.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella sp.
           3_1_44]
 gi|294455575|gb|EFG23947.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella sp.
           3_1_44]
          Length = 660

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 188/554 (33%), Positives = 291/554 (52%), Gaps = 22/554 (3%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           IVA+++VNR++ +D  + FL  ++  L+ DP  L D D A   +++ I + + I+I+GDY
Sbjct: 29  IVAKLMVNRHIDVDEGRQFLQGTLSDLL-DPFTLKDMDVAVSLVLETIESHKPIVIYGDY 87

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDG  + +++ RFL     +   YIP+R  +GYG N   +E  I  G  L+ITVDCG +
Sbjct: 88  DVDGITATSVLYRFLKKLGADVTYYIPERQSEGYGLNLEALEHLIERGTALVITVDCGIS 147

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
           SYD ++ A    ID+I+ DHH        A A++N  + D      +L   GV F +   
Sbjct: 148 SYDIVE-AVRDRIDMIITDHHTAPDMIPRAKAVINHKQKDCPYKDKNLSGVGVAFKLCQA 206

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           ++   R +         L  LD+VAL TV DVVPL+G NR  V  GL    R+ N G+K 
Sbjct: 207 LWLTKRGEW-------YLDDLDIVALGTVADVVPLVGENRIIVKSGLDKMNREPNLGIKK 259

Query: 282 LIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           LI+   +    IT+ ++G+ + P +NA GR+  +     LL++DD   +E +A +L+  N
Sbjct: 260 LIDVAGLHERTITSGHIGFTLAPRLNAAGRVTHATRAVELLVTDDEDIVEAIADELNETN 319

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
           + R+ +E  + E A   V  Q    +   V +V G+ WHPG++G++A+RL E+F +P+  
Sbjct: 320 RERQELERNIHELARVDVANQGH--KADYVTIVAGEEWHPGVIGIVASRLVEEFYKPTLV 377

Query: 401 ISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF 460
           IS   DG G GS RSI+GF+I   +     E IL++ GGHA AAG +++      L +  
Sbjct: 378 ISI-HDGVGKGSCRSIDGFNIYDALKSC--EDILLQFGGHAAAAGFSIDANRIDELRERL 434

Query: 461 QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQS 520
            K+   ++      PV  ID  L    +++ +ID +    PYG  N  PVFA     +Q 
Sbjct: 435 TKYCKAVITEEEYIPVVAIDAELPVDDIDVDIIDRVSDLEPYGMANSTPVFAIMEATVQD 494

Query: 521 IRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG 578
           I ++     H ++ FE+  S TL AIA+         F+    G  + V   L  N W+G
Sbjct: 495 IMLMGQLKNHCKIIFETS-SGTLDAIAWNRPDLFKSIFV----GTVVKVAFSLQKNEWQG 549

Query: 579 SKRCQLRVLDASPV 592
               QL +    P+
Sbjct: 550 LVSPQLMIQAIEPL 563


>gi|239617855|ref|YP_002941177.1| single-stranded-DNA-specific exonuclease RecJ [Kosmotoga olearia
           TBF 19.5.1]
 gi|239506686|gb|ACR80173.1| single-stranded-DNA-specific exonuclease RecJ [Kosmotoga olearia
           TBF 19.5.1]
          Length = 1047

 Score =  284 bits (726), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 178/537 (33%), Positives = 297/537 (55%), Gaps = 18/537 (3%)

Query: 18  WVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILT 76
           WV LL  +G  +   + +   I   +A++LVNR ++ +  A  +LNP  R L+ DP ++ 
Sbjct: 5   WV-LLNADG-TQVNHLVEYLGIEAFLAKLLVNRGITDVTEALKYLNPD-RTLLHDPFLMK 61

Query: 77  DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYG 136
           D  KA + I++A    + I++FGDYDVDG  S AL+   +     N + YIP R+ +GYG
Sbjct: 62  DMKKAVKTIIEAGERGDSIVVFGDYDVDGVTSTALLYLAMKKMGFNVSYYIPLRLEEGYG 121

Query: 137 PNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVN 196
            + + +E+  ++G +L+ITVDCG TS+D +++A   G+ V+V DHH+VK +   A A+VN
Sbjct: 122 LSRAAIEELYSQGHRLLITVDCGVTSFDEIEFAKKLGLKVVVTDHHEVKDKLPLAEAIVN 181

Query: 197 PNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPL 256
           P R DD      L   GV F +L  +   LR    +PLN +    LD+VAL T+ D+VPL
Sbjct: 182 PKRPDDNYPFKGLAGVGVAFKLLSALNETLR----MPLNPE--DYLDIVALGTIADIVPL 235

Query: 257 IGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESN 315
              NR  V +G    +++   GLK L+  + I+   +TA+++ + I P +NA GR+  + 
Sbjct: 236 RDENRFIVREGTKKIQKEPLLGLKILLSYLRINPDNLTAQDIAFKIAPKLNAAGRMDSAV 295

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
           +   LLIS+D  +    A +L   NQNR+++E+ + EQA  ++ +    ++   V+V+ G
Sbjct: 296 VALELLISEDKAQAMRTASRLLQHNQNRQMIEAKIFEQATKEIESNV-SMKDNFVVVLSG 354

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL  ++ RP F IS   DG+G GS RS  G  I  +++   +  IL 
Sbjct: 355 ENWHLGVLGIVASRLVAQYNRPVFLIS-TSDGEGKGSARSPSGISIISLLNKTAD--ILD 411

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH MAAG ++++           +   +I    + T   ++D VL   +++   +  
Sbjct: 412 EYGGHEMAAGFSIKKEKIPEFRKRLNEAYMDIYGEELPTYKIEVDDVLTLESISPETLKK 471

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRVYG 550
           ++   P+G  NP P F F    ++  +       H++M   S + +TL A+ F + G
Sbjct: 472 IDMLRPFGHSNPEPKFLFKGLNIERTKSFGSGGGHIKMILRSGERKTL-AVGFGMNG 527


>gi|295101009|emb|CBK98554.1| exonuclease RecJ [Faecalibacterium prausnitzii L2-6]
          Length = 709

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 178/528 (33%), Positives = 285/528 (53%), Gaps = 17/528 (3%)

Query: 24  QEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAAR 83
           +E     LA  QK A   ++A +L  R ++ D A+     +    + DP++LTD DKA  
Sbjct: 42  EEKYRSVLAAQQKEA--GLLAGILAARGIT-DPAEALTLLAGEEELSDPMLLTDMDKACE 98

Query: 84  RIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLME 143
           RI++AI   E I++FGDYDVDG  + AL+ + L          +P R  DGYG + + ++
Sbjct: 99  RILRAIDEGEMIVVFGDYDVDGVTATALLYQHLKGMGAAVKCMLPSREGDGYGLSKNAIQ 158

Query: 144 KFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDL 203
              ++G +LI+TVD G ++ +   +A + GID+I+ DHH        A A+V+P R DD 
Sbjct: 159 SIYDKGCRLIVTVDNGISAVEEAAFAASLGIDLIITDHHLPHDTLPQAAAIVDPRRADDH 218

Query: 204 SGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAY 263
           S    LC AGV F +   +       +  P    L    DL A+ TV DV+PL G NR  
Sbjct: 219 SPFKGLCGAGVAFKLCAAL-------DGCPPEEMLEYCGDLAAVGTVADVMPLTGENRTI 271

Query: 264 VVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLI 322
           V  GL   +    PG  AL+E V ++  P+TAEN+ Y I P INA GR+  +    +L++
Sbjct: 272 VKAGLRQLQNTDRPGFCALLEEVGLAGKPVTAENISYAIAPRINAAGRMDSAVTALQLVL 331

Query: 323 SDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGI 382
            +D      LA KL  +N  R+  E  +++ A+  +  + + ++   VI++ G  WHPG+
Sbjct: 332 CEDEDRAVELAHKLSDINIQRQETEMEIVKAAQELLDAEPERLED-RVILLWGRDWHPGV 390

Query: 383 VGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAM 442
           +G++A+RL EK GRP   +S +E G+G GSGRS++GF++ + ++   +  IL++ GGHAM
Sbjct: 391 IGIVASRLVEKTGRPVIVVSVDEHGEGKGSGRSVQGFNLHECIASCAD--ILLRFGGHAM 448

Query: 443 AAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPY 502
           AAGL+V   +   L      +A    P L  TP  + D  ++   + +  +  L+   PY
Sbjct: 449 AAGLSVREEDLQTLRQRLNDWAARECPVL-RTPPLECDLSVHLDRLTVESVRRLDQLAPY 507

Query: 503 GAGNPNPVFAFPNHKLQSIRVVNLA-HLQMTFESQDSETLQAIAFRVY 549
           GA NP+PVF      ++ +  V+   H ++    Q + ++ A+ F ++
Sbjct: 508 GADNPSPVFVLEMAVVEGVYAVSEGKHCRLRLR-QGNSSIYAVWFGMH 554


>gi|297529256|ref|YP_003670531.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           C56-T3]
 gi|297252508|gb|ADI25954.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           C56-T3]
          Length = 788

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 190/579 (32%), Positives = 299/579 (51%), Gaps = 31/579 (5%)

Query: 17  RW-VSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           RW V  L ++ + R   + ++  +  ++AR+LV R V +   A  FLNP +R    DP +
Sbjct: 7   RWEVERLDEQTVRR---LAEEAGVTPLLARLLVRRGVRTASEAAAFLNP-LRQPFHDPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L   ++A +R+ +AI   E+++++GDYD DG  S ++M+  L     +   YIP+R  +G
Sbjct: 63  LDGMERAIQRLKRAIDAGERVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YGPN +        G  +I+TVD G  +   +  A   G+DVIV DHH+       A+A+
Sbjct: 123 YGPNMAAFRSAKERGVSVIVTVDNGIAAVKEIAAANEWGLDVIVTDHHEPGPVLPEAHAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVL-VLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++P +         L   GV F V   L+ R+ R             LLDLVA+ T+ D+
Sbjct: 183 IHPKQPGSTYPFRDLAGVGVAFKVAHALLGRVPRH------------LLDLVAIGTIADL 230

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIG 312
           VPL+G NR +V  GL   R     GL+AL  +  I ++ I  + +G++I P +NA GR+G
Sbjct: 231 VPLVGENRLFVAHGLEALRATERIGLRALFRQCRINAAAINEQTVGFVIAPRLNAAGRLG 290

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            ++    LL++DD  E   LA ++D LN+ R+ + + + E+A   V  Q    ++  V+V
Sbjct: 291 GADPAVALLMTDDENEAVQLAAEMDELNRERQQLVAQIAEEAADMVRRQFPP-EEHRVLV 349

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V G+ W+ G+VG++A++L E+F RP+  +S  +E G   GS RSI GFD+    S +   
Sbjct: 350 VAGEGWNAGVVGIVASKLVEQFYRPAVVLSIDQEKGIAKGSARSIHGFDL--FASLSQCR 407

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L   GGH MAAG+T+   +   L       A   +     TP   ID   + + + + 
Sbjct: 408 DLLPHFGGHPMAAGMTLALDDVEELRQRLNAIAAETLSEDDFTPPTFIDASCSIAELTLD 467

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVY 549
               LE   P+G GNP P+       ++++R V  N AH++  F SQD   + AI F + 
Sbjct: 468 AARGLERFAPFGVGNPRPLVLIEGASVETMRRVGANGAHMKAVF-SQDGAAIDAIGFGL- 525

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
             PL E +      R+   G L VN W G  + QL + D
Sbjct: 526 -GPLCEEIAPD--ARISAVGELSVNEWNGFAKPQLSLCD 561


>gi|15613803|ref|NP_242106.1| single-strand DNA-specific exonuclease [Bacillus halodurans C-125]
 gi|10173856|dbj|BAB04959.1| single-strand DNA-specific exonuclease [Bacillus halodurans C-125]
          Length = 784

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 193/566 (34%), Positives = 297/566 (52%), Gaps = 29/566 (5%)

Query: 39  IPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           I  IVA++LV R + +++ AK FL     LL  DP  L   ++   R+ QAI   EKI+I
Sbjct: 27  IEPIVAKLLVIRGIDTVEEAKTFLQVDESLLH-DPYELDGMEQVVARVRQAIKAEEKILI 85

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYD DG +S ++M+  L       + YIP+R  +GYGPN + +     EG QL+ITVD
Sbjct: 86  YGDYDADGVSSTSVMVYTLRELGAQFDYYIPNRFTEGYGPNENALRWAKEEGYQLVITVD 145

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G  +    + A   G+D IV DHH+       A A++NP +        HL   GV F 
Sbjct: 146 TGIAAVHEAEVAKEIGLDFIVTDHHEPPPVLPDAVAIINPKKPGCSYPCKHLAGVGVAF- 204

Query: 218 VLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
              L + +L    +VP +     LLDLVA+ T+ D+VPL   NR    +GL        P
Sbjct: 205 --KLAHALL---ERVPYD-----LLDLVAIGTIADLVPLTDENRWLAKEGLKAIETTTKP 254

Query: 278 GLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           G++AL +        + AE++G+ IGP INA GR+  +     LLI+D  +  + LA ++
Sbjct: 255 GIQALKKVCGFHEDNVQAEHVGFGIGPRINAAGRLDSAKPAVELLITDQVETGQQLAEQI 314

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           D+LN+ R+ + S +  +A   ++ +    +   V+VV G  W+PG++G++A+RL E F R
Sbjct: 315 DLLNKERQAIVSEIAAEA-INLVKELYPPEDNHVLVVGGHGWNPGVIGIVASRLVETFYR 373

Query: 397 PSFAISFEEDGKGI--GSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
           P+  +S++E+ KGI  GS RSIEGFD+   +S   E  +L   GGH MAAGLT+   +  
Sbjct: 374 PTIVLSYDEE-KGIAKGSARSIEGFDMFHELSKNRE--LLPHFGGHPMAAGLTMSLQDVD 430

Query: 455 RLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFP 514
            L       A   +      P+ +ID   +   ++++ I+ + +  PYG GNP P     
Sbjct: 431 ELRKRMNAQAREALRPEDFIPITRIDVQASVDEISVSTIEKMNALAPYGVGNPEPKVMLT 490

Query: 515 NHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTGHL 571
           + K++ +R +  A  HL++TF+ Q+  TL  + F      LG    + S   R+   G L
Sbjct: 491 DVKIEGMRKIGAASNHLKVTFQ-QNGTTLDGVGFH-----LGHLSDEISPTARVSAVGVL 544

Query: 572 CVNYWRGSKRCQLRVLDASPVEGHHF 597
            +N W G  + QL + D +  E   F
Sbjct: 545 SINEWNGHVKPQLMIEDLAVNEWQLF 570


>gi|312898882|ref|ZP_07758270.1| single-stranded-DNA-specific exonuclease RecJ [Megasphaera
           micronuciformis F0359]
 gi|310620044|gb|EFQ03616.1| single-stranded-DNA-specific exonuclease RecJ [Megasphaera
           micronuciformis F0359]
          Length = 660

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 190/537 (35%), Positives = 285/537 (53%), Gaps = 24/537 (4%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV--SIDYAKDFLNPSIRLLMPDPL 73
            RW+     +   R L   Q H I  ++AR LVNR +  S D AK FL  S+  L  DP 
Sbjct: 3   MRWIYAEPSQKTVRQLQ-EQLH-ISSLLARTLVNRGITDSTD-AKHFLYDSMSSLY-DPF 58

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D  K A RI+ AI   E+I+++GDYDVDG  S AL+ R L     +   YIP+R  +
Sbjct: 59  LMKDVRKGAERILTAIERGERIVVYGDYDVDGITSTALVYRSLCDLGADPAFYIPERQSE 118

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AY 192
           GYG N   +E+ + +  ++IITVDCG +S   ++    Q  D+I+ DHH+  SE IP  Y
Sbjct: 119 GYGLNRDALEELVRDKTEVIITVDCGISSAKLVKEFNTQ-TDIIITDHHE-PSEHIPEGY 176

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A++NP + D +     L   GV + +     R LR    +    D      LVAL TV D
Sbjct: 177 AVINPKQKDCMYPYKELAGVGVAYTLC----RALRM---LAGKTDGEKYTSLVALGTVAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRI 311
           +VPL G NR  V  GL       N G++ALI+   + ++ I+A N+ + + P +NA GRI
Sbjct: 230 LVPLTGENRILVADGLSRIAEGDNCGIQALIKTAGLDATKISAGNIAFSVAPRLNAAGRI 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             +  G  LL+  DS + +  A +L  LN  R+ +E A+   A  +V  + +  +   V+
Sbjct: 290 SHAEKGVFLLLEKDSDKAKETAEELHDLNTQRQEIEWAITTAAIDEV--ENEGYEDDHVL 347

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           VV GD WH G++G+ A+RL EK+ +PS  IS  +DG G GS RSI GF++ + ++   E 
Sbjct: 348 VVAGDGWHSGVIGIAASRLIEKYYKPSLVISL-KDGVGKGSCRSITGFNMYEALNSCKE- 405

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L++ GGHAMAAG +V + N   L +   ++A   +      PV  +D V+    + + 
Sbjct: 406 -LLIQFGGHAMAAGFSVAQENIDALREQLNEYALRHLTEKDYIPVLNVDSVVAGEDITVD 464

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAF 546
            +  L    PYG GN  P+F   N  L  I+ +     HL++  ES+D   L  + +
Sbjct: 465 TVHELSLLEPYGMGNTRPLFVLKNALLYDIKEIGRQKTHLRIVAESEDGCRLSGVGW 521


>gi|81428888|ref|YP_395888.1| single-strand DNA-specific exonuclease RecJ [Lactobacillus sakei
           subsp. sakei 23K]
 gi|78610530|emb|CAI55581.1| Single-strand DNA-specific exonuclease RecJ [Lactobacillus sakei
           subsp. sakei 23K]
          Length = 770

 Score =  283 bits (724), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 180/562 (32%), Positives = 283/562 (50%), Gaps = 26/562 (4%)

Query: 32  AITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
            IT+ + +P   A++L  R +   +   DF+NP++  L  DP  L D  KA  RI +AI 
Sbjct: 20  TITKDNPLPKAAAQLLWQRGLRDAEQINDFMNPNVGQLH-DPYALHDMQKAIDRIQEAIV 78

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
           N EKI I+GDYD DG  S  LM   L     +  +Y+P+R  DGYGPN    ++ I  G 
Sbjct: 79  NGEKITIYGDYDADGITSTTLMKETLDDLGADVEVYVPNRFKDGYGPNLEAYKRLIENGT 138

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
           QLI+TVD G +  + + YA   G+DV+V DHH++ SE   A A+V+P   +     G LC
Sbjct: 139 QLIVTVDNGVSGLEPIAYAQEHGVDVVVTDHHELPSELPNAVAIVHPRHPEGQYPFGELC 198

Query: 211 AAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
             GV F V   +   +  D            LDL A+ TVCD+VPL+  NR  V  GL  
Sbjct: 199 GVGVAFKVATALLEEIPYDK-----------LDLAAIGTVCDIVPLVDENRTLVSLGLQQ 247

Query: 271 ARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQEL 329
            +    PGL AL +   +  + + A N+G+ IGP +NA GR+G++ LG +LL + D +E 
Sbjct: 248 LQNTDRPGLVALCQSAGLEQATLDATNIGFGIGPRLNAIGRLGDATLGVQLLTTLDDEEA 307

Query: 330 EMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAAR 389
              A  ++  N+ R+ +   +   A A  + +  + Q ++ +V+  + WH G++G++A+ 
Sbjct: 308 VEQAQFIEQQNKKRQGLVQEIT--ATAMTIAETPENQASATLVIAHEGWHEGVLGIVASH 365

Query: 390 LKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTV 448
           + E+ G+P+  ++ + E G   GSGRS+  F + K +    E  +LV  GGH MA GLT 
Sbjct: 366 VVEQTGKPTLVLTIDPETGLAKGSGRSVTAFHLFKALDAHRE--LLVHFGGHHMAVGLTA 423

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
           +      +     ++A      L       +D  L  + +   L   L+   P+G+ NP 
Sbjct: 424 KVDQLALIQTAMNEYAQVNQLDLTGRQPLPVDLALTLADITPDLYQALQQLAPFGSDNPE 483

Query: 509 PVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMH 566
           P+      +L  ++ +  +  HL+M    Q  + L  +AF   G  + +    +  + + 
Sbjct: 484 PLIELSAPQLADVKQIGADQKHLKMMAVDQQQQ-LAVLAFN-KGALMPDL---TAAEDVK 538

Query: 567 VTGHLCVNYWRGSKRCQLRVLD 588
           + G L  N WRG    QL V D
Sbjct: 539 LVGSLSENTWRGQTTLQLMVKD 560


>gi|227524131|ref|ZP_03954180.1| exonuclease RecJ [Lactobacillus hilgardii ATCC 8290]
 gi|227088709|gb|EEI24021.1| exonuclease RecJ [Lactobacillus hilgardii ATCC 8290]
          Length = 776

 Score =  283 bits (723), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 193/584 (33%), Positives = 296/584 (50%), Gaps = 30/584 (5%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           S F+W  +       +  A+++   I  ++A +L+ R VS + A +DFL PS +    DP
Sbjct: 4   SKFKW-QIKQNTDPQQVQALSEALKIDPLIASILLQRGVSTEEAAQDFLTPSSKDFH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D  K   RI  A+ N E+I ++GDYD DG  S  +M   L+    N + YIP+R  
Sbjct: 62  YLMHDMKKGIARIQHAVENEEQITVYGDYDADGITSTTIMYEVLNDLGANVDYYIPNRFS 121

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           DGYGPN    +K IN G  LIITVD G    +A+  A +   DV+V DHH +      AY
Sbjct: 122 DGYGPNVDAFKKIINNGTTLIITVDNGVAGNEAIDVANSLHCDVLVTDHHSLPEVLPNAY 181

Query: 193 ALVNPNRLDDLSGQ----GHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALA 248
           A+++P R+ +  GQ    G L  AGV   V     + L +D  +P++     L+D+ A+ 
Sbjct: 182 AIIHP-RVKNQEGQAYPFGDLSGAGVALKVA----QALMED--LPID-----LIDVAAIG 229

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINA 307
           TV D+V L   NRA V  GL   R    PGL ALI+  +I  S    +++G+ I P +N+
Sbjct: 230 TVADIVSLKDENRAIVKFGLNAIRNTQRPGLLALIKAADIDLSKFDEQDIGFGIAPRLNS 289

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRI ++N+G  LL + D Q+   LA   D  N +R+ +     +QA  +++    D + 
Sbjct: 290 LGRIDDANIGVELLSTFDDQKATELAEFADHQNDSRKSLVDEFYQQA-VQMVESSGDAEN 348

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI-GSGRSIEGFDIGKMVS 426
            S +VV GD WH G++G++A++L EK+GRP+  ++ +     + GSGRS+E FD+   + 
Sbjct: 349 RSTLVVVGDDWHQGVLGIVASKLVEKYGRPTIVLTSQHGNDQVKGSGRSVESFDLFSAID 408

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
              ++ I    GGH  A GLT+ +     L D  +K A N    L   P   I   ++A 
Sbjct: 409 PIRDQTIGF--GGHHSAIGLTINKDKISVLKDQLEKAAGNQELDLSQKPTLDIAAKISAD 466

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAI 544
            ++   I  L    P+G  NP PVF     +L  ++ +     HL+ +     S  L A+
Sbjct: 467 QIDNQFIKNLNVLAPFGQDNPKPVFEIEYDQLIDVKTMGKTGDHLRFSLVKNKSR-LTAV 525

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AF   G   G+  + +    + V+G +  N W      QL V D
Sbjct: 526 AFG-RGAAAGQ--LSNGSASIKVSGEINENTWNNHTTIQLMVSD 566


>gi|167462059|ref|ZP_02327148.1| YrvE [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 813

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 193/581 (33%), Positives = 299/581 (51%), Gaps = 26/581 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPL 73
           S  RW +   +  + + LA  + H +  + AR+L  R ++   A +    S +    DP 
Sbjct: 4   SKARWQTGCAESSVVQKLA--EAHHLDTLTARLLALRGITTPEAAESFLHSRQDGFHDPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D  KA  RI  A+ + E I I+GDYD DG  S +L+M  L       + YIP R+ +
Sbjct: 62  LMKDMKKAVDRIRLAVEHKEFIRIYGDYDADGVTSTSLVMFLLRKIKARFDYYIPHRVRE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG N   +EK   +G  LIITVD G ++ + + Y    G+DVIV DHH+         A
Sbjct: 122 GYGLNRQAVEKAAEDGVDLIITVDTGVSAVEQVTYIQELGMDVIVTDHHEPPDISPQPLA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           LVNP + D      HL   GV F    L + +L   ++VP       LL+LVA+ TV D+
Sbjct: 182 LVNPKQADCPYPFKHLAGVGVAF---KLAHALL---DRVPEE-----LLELVAIGTVADL 230

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIG 312
           +P  G NR  V  GL   ++   PG++AL++   I S  +T+ +LG+ +GP +NA GR+G
Sbjct: 231 MPFHGENRTIVKMGLKRMQQSAFPGIRALLKIAGIESQQVTSTHLGFAVGPRLNASGRLG 290

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA-SVI 371
            +N    LLI+ DS     LA  LD LNQ R+ +   + E+A A    Q   +Q+  + +
Sbjct: 291 SANNSVELLITGDSGRANELAQLLDELNQERQRIVREINEEALAIAAEQ---VQKGNTFL 347

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           VV    W+ G++G++A+++ E + RP+   S  +E G   GS RSIE FD+ + ++   E
Sbjct: 348 VVAKPDWNEGVIGIVASKIVETYYRPTIVFSMNDESGLAKGSARSIESFDMYENLTACRE 407

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             +L   GGH  AAG+T+++ +   L       A  ++      PV + D   +   V +
Sbjct: 408 --LLEHFGGHRSAAGMTIKQEHIDALHRQLDHQAKALLGPDDLVPVIRADAACHLKDVPL 465

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTF-ESQDSETLQAIAFR 547
             I+ L+   P+GA NP+P F   N +L  +R++  +  H+++   ESQ   T+Q  A  
Sbjct: 466 GWIEQLQKLEPFGASNPSPQFIVENLRLTDLRLLGRDKKHMKLVLSESQGESTVQIEALG 525

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
                L E +  S   R+ V G L +N W G +R QL + D
Sbjct: 526 FGKAHLSELI--SPTARLDVLGELGINEWNGIRRPQLTLKD 564


>gi|261418404|ref|YP_003252086.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y412MC61]
 gi|319767637|ref|YP_004133138.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y412MC52]
 gi|261374861|gb|ACX77604.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y412MC61]
 gi|317112503|gb|ADU94995.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y412MC52]
          Length = 788

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 189/579 (32%), Positives = 299/579 (51%), Gaps = 31/579 (5%)

Query: 17  RW-VSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           RW V  L ++ + R   + ++  +  ++AR+LV R V +   A  FLNP +     DP +
Sbjct: 7   RWEVERLDEQAVRR---LAEEAGVTPLLARLLVRRGVRTASEAVAFLNP-LEQPFHDPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L   ++A +R+ +AI   E+++++GDYD DG  S ++M+  L     +   YIP+R  +G
Sbjct: 63  LDGMERAIQRLKRAIDAGERVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YGPN +        G  +I+TVD G  +   +  A   G+DVIV DHH+       A+A+
Sbjct: 123 YGPNMAAFRSAKERGVSVIVTVDNGIAAVKEIAAANEWGMDVIVTDHHEPGPVLPEAHAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVL-VLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++P +         L   GV F V   L+ R+ R             LLDLVA+ T+ D+
Sbjct: 183 IHPKQPGSTYPFRDLAGVGVAFKVAHALLGRVPRH------------LLDLVAIGTIADL 230

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIG 312
           VPL+G NR +V  GL   R     GL+AL  +  I ++ I  + +G++I P +NA GR+G
Sbjct: 231 VPLVGENRLFVAHGLEALRATERIGLRALFRQCRIDAAAINEQTVGFVIAPRLNAAGRLG 290

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            ++    LL++DD  E   LA ++D LN+ R+ + + + E+A   V  Q    ++  V+V
Sbjct: 291 GADPAVALLMTDDENEAVQLAAEMDELNRERQQLVAQIAEEAADMVRRQFPP-EEHRVLV 349

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V G+ W+ G+VG++A++L E+F RP+  +S + E G   GS RSI GFD+    S +   
Sbjct: 350 VAGEGWNAGVVGIVASKLVEQFYRPAVVLSIDREKGIAKGSARSIHGFDL--FASLSQCR 407

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L   GGH MAAG+T+   +   L       A   +     TP   ID   + + + ++
Sbjct: 408 DLLPHFGGHPMAAGMTLALDDVEELRQRLNAIAAETLSEDDFTPPTFIDASCSIAELTLS 467

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVY 549
               LE   P+G GNP P+       ++++R V  N AH++  F SQD   + AI F + 
Sbjct: 468 AARGLERFAPFGVGNPRPLVLIEGASVETMRRVGANGAHMKAVF-SQDGAAIDAIGFGL- 525

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
             PL E +      R+   G L VN W G  + QL + D
Sbjct: 526 -GPLCEEIAPD--ARISAVGELSVNEWNGFAKPQLSLCD 561


>gi|227512140|ref|ZP_03942189.1| single-strand DNA-specific exonuclease RecJ [Lactobacillus buchneri
           ATCC 11577]
 gi|227084534|gb|EEI19846.1| single-strand DNA-specific exonuclease RecJ [Lactobacillus buchneri
           ATCC 11577]
          Length = 776

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 192/584 (32%), Positives = 297/584 (50%), Gaps = 30/584 (5%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDP 72
           S F+W  +       +  A+++   I  ++A +L+ R VS + A +DFL PS +    DP
Sbjct: 4   SKFKW-QIKQNTDPQQVQALSEALKIDPLIASILLQRGVSTEEAAQDFLTPSSKDFH-DP 61

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D  K   RI  A+ N E+I ++GDYD DG  S  +M   L+    N + YIP+R  
Sbjct: 62  YLMHDMKKGIARIQHAVENEEQITVYGDYDADGITSTTIMYEVLNDLGANVDYYIPNRFS 121

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           DGYGPN    +K IN G  LIITVD G    +A+  A +   DV+V DHH +      AY
Sbjct: 122 DGYGPNVDAFKKIINNGTTLIITVDNGVAGNEAIDVANSLHCDVLVTDHHSLPEVLPNAY 181

Query: 193 ALVNPNRLDDLSGQ----GHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALA 248
           A+++P R+ +  GQ    G L  AGV   V     + L +D  +P++     L+D+ A+ 
Sbjct: 182 AIIHP-RVKNQEGQAYPFGDLSGAGVALKVA----QALMED--LPID-----LIDVAAIG 229

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINA 307
           TV D+V L   NRA V  GL   R    PGL ALI+  +I  S    +++G+ I P +N+
Sbjct: 230 TVADIVSLKDENRAIVKFGLNAIRNTQRPGLLALIKAADIDLSKFDEQDIGFGIAPRLNS 289

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRI ++N+G  LL + D Q+   LA   D  N +R+ +     +QA  +++    D + 
Sbjct: 290 LGRIDDANIGVELLSTFDDQKATELAEFADHQNDSRKSLVDEFYQQA-VQMVESSGDAEN 348

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI-GSGRSIEGFDIGKMVS 426
            S +VV GD WH G +G++A++L EK+GRP+  ++ ++    + GSGRS+E FD+   + 
Sbjct: 349 RSTLVVVGDDWHQGALGIVASKLVEKYGRPTIVLTSQDGNDQVKGSGRSVESFDLFSAID 408

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
              ++ I    GGH  A GLT+ +     L D  +K A +    L   P   I   ++A 
Sbjct: 409 PIRDQTIGF--GGHHSAIGLTINKDKISVLKDQLEKAAGDQELDLSQKPTLDIAAKISAD 466

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAI 544
            ++   I  L +  P+G  NP PVF     +L  ++ +     HL+ +     S  L A+
Sbjct: 467 QIDNHFIKNLNALAPFGQDNPKPVFEIEYDQLIDVKTMGKTGDHLRFSLVKNKSR-LTAV 525

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AF   G   G+  + +    + V+G +  N W      QL V D
Sbjct: 526 AFG-QGAAAGQ--LSNGSASIKVSGEINENTWNNHTTIQLMVSD 566


>gi|194017157|ref|ZP_03055769.1| recombination protein J [Bacillus pumilus ATCC 7061]
 gi|194011025|gb|EDW20595.1| recombination protein J [Bacillus pumilus ATCC 7061]
          Length = 774

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 190/591 (32%), Positives = 300/591 (50%), Gaps = 31/591 (5%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPD 71
           +S  RW      E   +  ++++   I  + A +LV R +  ++ A+ FL    +    D
Sbjct: 3   LSKMRWEYEHPSE--EKVKSLSENLNISALTASLLVKRGLEEVEEARSFLFDQ-KAEFHD 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L    +A  RI +AI   E I+IFGDYD DG  S ++++  L   S   + YIPDR 
Sbjct: 60  PFLLKGMKEAVERINKAIEEQESIVIFGDYDADGVTSTSVLLHTLKELSAKVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP- 190
            +GYGPN         +GA L+ITVD G  + +  + A   G+D+I+ DHH+  SEE+P 
Sbjct: 120 KEGYGPNEQAFRYIKEQGASLVITVDTGIAAVNEARIAKEIGLDLIITDHHE-PSEELPE 178

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
           A A+V+P +         L   GV F V   +        K+P       LLDL A+ T+
Sbjct: 179 ALAIVHPKQPGCEYPFKELAGVGVAFKVAHALL------GKLPTQ-----LLDLAAIGTI 227

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGG 309
            D+VPL   NR    KGLM  R+   PGLKAL++    +      E +G+ I P +NA G
Sbjct: 228 ADLVPLHDENRWLAKKGLMQLRQSNRPGLKALLKEAGATLEEANEETVGFQIAPRLNAVG 287

Query: 310 RIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQAS 369
           RI +++    LL+++D  E E LA  +  LN+ R+ + S + E+A   V    DD    S
Sbjct: 288 RIEQADPAVHLLMTEDKDEAEELARFVQELNKERQKIVSTITEEAIQMVEETGDD---QS 344

Query: 370 VIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFA 428
            IVV    W+PG+VG++A++L + F RP+  +  +E+ +   GS RSI GFD+   +S  
Sbjct: 345 AIVVAKAGWNPGVVGIVASKLTDTFSRPAIVLGIDEETQMAKGSARSIPGFDLFFHLSKC 404

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
            +  IL   GGH MAAG+T+   +   L +   ++A+  +      P+ ++D V     +
Sbjct: 405 RD--ILPHFGGHPMAAGMTLRADDVPLLRERLNQYANETLTEEDFIPIQRVDAVCKVDEL 462

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAF 546
            +  I+ +    P+G  NP P     + +L+ IR +  N  H++M+ + +D + L  + F
Sbjct: 463 TVEAIEEVGMLSPFGMQNPKPFIMIEDVRLEEIRTIGANQNHIKMSLKDED-QLLDCVGF 521

Query: 547 RVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
             +   L E ++   G R+ V G + +N W   K+ QL + DA   E   F
Sbjct: 522 --HQGQLKEEVVT--GSRISVIGEMSINEWNNRKKPQLMLKDARVDEWQLF 568


>gi|91763259|ref|ZP_01265223.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91717672|gb|EAS84323.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 564

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 180/594 (30%), Positives = 305/594 (51%), Gaps = 52/594 (8%)

Query: 12  SISGFRWVSLLGQEGINRALA--ITQKHAIPDIVARVLVNR----------NVSIDYAKD 59
           S+SG +W     Q+ IN+ +   + Q++   + ++R++++R          N  +D    
Sbjct: 3   SVSGKKW----EQKKINQNIVDKLKQEYNFNEFLSRLIISRKFDNDEIATINADLDLNNV 58

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FLN              D  ++   +V +I N+EKI I GDYDVDG+A+ +L ++F    
Sbjct: 59  FLNNK------------DFSQSINLVVNSINNNEKICIVGDYDVDGSAATSLFVKFFEGI 106

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
           +     YIPDR  DGYG    L +K I +  +LII VDCGSTS DA+ +     I  ++I
Sbjct: 107 NHPFFYYIPDREKDGYGATKKLFKKLILKNPKLIIMVDCGSTSNDAIDFLNENEIKSLII 166

Query: 180 DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           DHH++      A +++NP + +      +LCA  + +  L L+ +      K+    ++ 
Sbjct: 167 DHHEINKPFPNANSIINPKKDNGYREYDYLCATTLTYFFLDLLIK------KIKSEINIS 220

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             L  V LATVCDV+PL  LNR   +K L       N  +  L +     + I   +LGY
Sbjct: 221 DYLIYVLLATVCDVMPLRKLNRLIALKTLKNFDITKNLPIGTLFDLNEKKNRININDLGY 280

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           +IGP +NAGGR+G+S   + LL S++   +   +  L  LN  R+ +E+ +LE+ + K +
Sbjct: 281 LIGPILNAGGRLGKSQYATELLSSNNDLVINDRSKSLIKLNDKRKKIENLILEEIDFKKI 340

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +    +   VI+      + G++G++AARLK+ F +PS  I+   +    GS RS+  +
Sbjct: 341 EK----ENKDVIIYYNPNINEGLIGIIAARLKDYFNKPSIVITASNELLK-GSVRSVYNY 395

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL-----ITT 474
           +IG+++  ++++ +++ GGGH MAAG T+ R       D  + F + I+        +T 
Sbjct: 396 NIGRVIKNSLDQKLILNGGGHNMAAGFTLNR-------DSLKAFENYILEDFVKSNTVTN 448

Query: 475 PVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE 534
            +F  +  +++ A N    D ++   P+G GNP P F     K+    V+N  H+ +  +
Sbjct: 449 NIFSYESEISSLAFNEDFYDNIKKLEPFGTGNPVPTFLLRRLKIIKPMVLNKKHISLNLK 508

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           S+   ++++I+F    T LGE+LM  + K + V G +  N W   K  QL + D
Sbjct: 509 SKTGFSIKSISFNSINTKLGEYLMNYKNK-IDVIGQINENIWNNKKSNQLTIKD 561


>gi|332977810|gb|EGK14567.1| single-stranded-DNA-specific exonuclease RecJ [Desmospora sp. 8437]
          Length = 791

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 186/581 (32%), Positives = 303/581 (52%), Gaps = 31/581 (5%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDP 72
           S  RW  +  +E   R LA   +  I  + AR+L++R VS  + A+ FL  S+  L   P
Sbjct: 14  SKTRWQLVEAEESQVRELA--GELGIHPLTARLLIHRGVSDPEQARRFLQVSLSELY-SP 70

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++   ++A  RI  A+   EKI+I+GDYD DG +S +L+M+       + + YIP+R  
Sbjct: 71  FLMDGIEEAVDRIRTALDRREKILIYGDYDADGVSSTSLLMKVFRGLDADVDYYIPNRFT 130

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG N + + K    G QL+I+VD G ++    ++A   G+D+I+ DHH+  +      
Sbjct: 131 EGYGLNENALRKAKEAGVQLMISVDTGISAVKEAKFARELGLDLIITDHHEPPAVLPEGV 190

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVF-LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           A++NP + D       L   GV F L   L+ R+  +            LLDLVAL T+ 
Sbjct: 191 AVINPKKPDCSYPCKLLAGVGVAFKLAHALLGRVPEE------------LLDLVALGTIA 238

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRI 311
           D+VPL+  NR     GL    R+ NPGL AL++   I   +TA ++G+ +GP INAGGR+
Sbjct: 239 DLVPLMDENRVIAALGLKEINRRRNPGLSALMDVAGIQGEVTAGHVGFSLGPRINAGGRL 298

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             +     LL+++D ++  +LA +LD +N+ R+ +   +  +A A+V +  +  +    I
Sbjct: 299 DTAATAVELLLTEDPEQARVLAEELDGMNRERQKLVEEIAAEACAQVESAPE--KHRRFI 356

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           VV    W+ G++G++A+RL EK+ RP+  +   EE G   GS RSI G D+ + ++   +
Sbjct: 357 VVAAPGWNVGVIGIVASRLVEKYYRPTIVLGIDEETGMAKGSARSIAGLDLYRALTTCGD 416

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             +L + GGH MAAG+++ R N         + A   +      P+ +++  L+   VN+
Sbjct: 417 --LLPQFGGHEMAAGMSLPRENIEEFHRRLDQIAGEWLREEDYIPLSRVEADLSIGEVNL 474

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRV 548
            LI  LE   P G GNP P F      L  ++V+     HL+M  E +  ++L+A+ FR 
Sbjct: 475 DLIKELERLEPCGMGNPTPRFQLRGAGLSRLQVMGREKNHLKMVLEVE-GDSLEAVGFR- 532

Query: 549 YGTPLGEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
               +GE   + +   R  + G L +N W   +  Q  + D
Sbjct: 533 ----MGELAAEIAPSARPELLGELSINEWNHRRSPQFLIRD 569


>gi|218960658|ref|YP_001740433.1| putative ssDNA exonuclease, 5'--> 3'-specific [Candidatus
           Cloacamonas acidaminovorans]
 gi|167729315|emb|CAO80226.1| putative ssDNA exonuclease, 5'--> 3'-specific [Candidatus
           Cloacamonas acidaminovorans]
          Length = 574

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 180/554 (32%), Positives = 288/554 (51%), Gaps = 21/554 (3%)

Query: 17  RWV--SLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPL 73
           +W+  S  G+E       ++ +  +P +VA +L  + + +++ A++F  PS+  L  DP 
Sbjct: 5   KWLIPSPPGKEINPEIEKLSAEFKLPRLVAELLYRKGIKTVNSAQEFFKPSMDNLY-DPY 63

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +  D +KA +RI++AI + EKI I+GDYDVDG  + AL+   L     N + YIP R++D
Sbjct: 64  LFPDMEKAVQRILRAIDSKEKITIYGDYDVDGTTATALLYLGLKRIGANIDFYIPHRMID 123

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G+ LII+VDCG  + + +    + G+++I+ DHH  K E  PA+A
Sbjct: 124 GYGLSLGSLDALRENGSSLIISVDCGVNAIEEINAINSMGMEIIITDHHNPKDELPPAFA 183

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP          HL   GV + +L+ IY  L  D+      + L  +DLVA+ T+ D+
Sbjct: 184 IINPKLPGTKYPYEHLAGVGVAYKLLMAIYNNLGIDSAE----NKLKYMDLVAVGTIADI 239

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIG 312
           VPL   NR +   GL     + N GL AL++   ++   +   ++ + I P INA GR+G
Sbjct: 240 VPLTSENRIFASIGLQHLIEKKNLGLNALVQISGLNQKNLDTTDIVFGIAPRINAAGRMG 299

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            +++   LLIS D  +   LA  ++  N  R+  +    ++A   +  +  D+QQ S +V
Sbjct: 300 SASVSVELLISTDEAKSMELAEIIEHQNSLRQQEDQKTFQEACDIIEKKYKDLQQTSCMV 359

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           V  D WHPG++G++A++L EK+ RP   ISF +DG G GSGRS+  FD+    +    E 
Sbjct: 360 VSSDDWHPGVIGIVASKLVEKYYRPVIMISF-KDGFGSGSGRSVADFDL--FEALKQTEH 416

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
            L   GGH  A GLT+ +    R  +   +F    +      P  +ID  +    +N  L
Sbjct: 417 NLHSFGGHKYAVGLTIYQEYLDRFENELTRFVSENLRLEQIQPPLQIDAEIELYNINNTL 476

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRV-VNLAHLQMTFESQDSETLQAIAFRVYGT 551
           +D LE   P+G  N  PVF   N  + S    V   HL++            I F + G 
Sbjct: 477 LDALEHFAPFGPDNTRPVFMTRNVTIASYPYNVGRNHLKLKV------VKDGIYFNLIGY 530

Query: 552 PLGEF--LMQSRGK 563
            LG++  L++  GK
Sbjct: 531 NLGDYLPLLKKNGK 544


>gi|85859325|ref|YP_461527.1| single-stranded DNA-specific exonuclease [Syntrophus aciditrophicus
           SB]
 gi|85722416|gb|ABC77359.1| single-stranded DNA-specific exonuclease [Syntrophus aciditrophicus
           SB]
          Length = 586

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 176/557 (31%), Positives = 296/557 (53%), Gaps = 23/557 (4%)

Query: 42  IVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           I++ +L +R++   D A+ +L PS+  L  +P ++ D      R++QA+Y  EKI+++GD
Sbjct: 41  IMSSILASRDIQTPDDARKYLYPSLHDLH-NPFLMKDMQLGVNRLIQAVYQGEKIVVYGD 99

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YD DG  SVA++++FL     + + YIPDRI +GYG N   +++   + A LIITVDCG 
Sbjct: 100 YDADGITSVAVLVKFLRDIQADVSYYIPDRIDEGYGLNRKAIDRIKEKSASLIITVDCGI 159

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLV 220
           +  D + YA + G+D I++DHH+V      A A +NP R D      HL A G+VF  L+
Sbjct: 160 SDCDEILYARSLGLDTIILDHHEVSDSLPTAVASINPKRPDCPFPLKHLAAVGIVFNFLI 219

Query: 221 LIYRILRQD-----NKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQG 275
            +   LR++        P   +L   LDLVAL T+ D+ P++  NR +V  GL +     
Sbjct: 220 ALRGNLRKEGFWHGKPYP---NLKEYLDLVALGTIGDICPMVDENRIFVRVGLELLTEGK 276

Query: 276 NPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAM 334
             G++AL E   + +  +  E   + + P INA GR+G  +    LL++DD  +   LA+
Sbjct: 277 RVGIRALKEICGVDTQAVDTEKASFSLIPRINAAGRVGLPDDAVELLLADDMGKARDLAV 336

Query: 335 KLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKF 394
           KLD  N+ RR +E  +LE+    +     D +  + +V+  ++WHPG++G++A+++ +++
Sbjct: 337 KLDSYNRRRRALEKNILEEIIEDLEKTISD-RNRTALVMASEKWHPGVIGIVASKIADRY 395

Query: 395 GRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
            RP+  IS  +DG G GSGRSI  F+I + +     E  L+  GGH  AAG+++   +  
Sbjct: 396 DRPAILISL-KDGIGKGSGRSIANFNIYQGLREC--EDYLISYGGHRYAAGISIMEEDIE 452

Query: 455 RLCDFFQKFA-HNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAF 513
           +  +   +    N++ +   +  F I+   + + +   L+  +E   P+G+ NP PV   
Sbjct: 453 QFAETLDEIVRENVLQSDFISATF-IEAQCHLNDITHELLAQMELLAPFGSKNPEPVLCV 511

Query: 514 PNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCV 573
            N    S  VV   HL+M   S+   +   I F       G F+ +     + +     +
Sbjct: 512 RNVNAFSPAVVGNNHLRMRV-SEAGVSRNTIWF-----SQGHFIRELNDSCLDIAFTPQI 565

Query: 574 NYWRGSKRCQLRVLDAS 590
           N W G+   QL++ D +
Sbjct: 566 NTWNGASDIQLKMKDIT 582


>gi|138896148|ref|YP_001126601.1| single-strand DNA-specific exonuclease [Geobacillus
           thermodenitrificans NG80-2]
 gi|134267661|gb|ABO67856.1| Single-strand DNA-specific exonuclease [Geobacillus
           thermodenitrificans NG80-2]
          Length = 785

 Score =  280 bits (716), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 192/582 (32%), Positives = 295/582 (50%), Gaps = 33/582 (5%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMP--DPL 73
           RW      E   R LA  ++  I  ++A++LV R V +   A  FL+P   L  P  DP 
Sbjct: 7   RWEVDCPDEQTVRRLA--EEADIAPLLAKLLVRRGVRTAAEAAAFLDP---LGQPFHDPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +L   ++A RR+ +AI   E ++++GDYD DG  S ++M+  L     +   YIP+R  +
Sbjct: 62  LLDGMERAVRRLERAINTGELVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYGPN +        G  +I+TVD G  + D +  A   G+DVIV DHH+       AYA
Sbjct: 122 GYGPNLAAFRAAKERGVSVIVTVDNGIAAVDEIAAANEWGLDVIVTDHHEPGPVLPEAYA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVL-VLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           +++P +         L   GV F V   L+ R+ R             LLDLVA+ T+ D
Sbjct: 182 IIHPKKPGSTYPFRDLAGVGVAFKVAHALLGRVPRH------------LLDLVAIGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRI 311
           +VPL+G NR    +GL   R     GL+AL  +  I +  +  + +G+ I P +NA GR+
Sbjct: 230 LVPLVGENRLLAAQGLEALRETNRVGLRALWRQCRIDAMTVNEQTVGFAIAPRLNAAGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
           G ++    LL++DD  E   LA ++D LN+ R+ + + M E+A   V  Q    ++  V+
Sbjct: 290 GGADPAVALLMTDDEGEAARLAQEMDELNRERQQLVAQMAEEAAEMVRRQFPP-EEHRVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVE 430
           VV G+ W+PG+VG++A++L E+F RP+  +S + E G   GS RSI GFD+    S +  
Sbjct: 349 VVAGEGWNPGVVGIVASKLVEQFYRPAVVLSMDREKGIAKGSARSIHGFDL--FASLSQC 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T+   +   L +     A   +     TP   ID   +   + +
Sbjct: 407 RDILPHFGGHPMAAGMTLALDDVEELRERLNAIAARTLSDDDFTPPTFIDAACSVDELTL 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRV 548
           +     E   P+G  NP P+       ++++R V  N AH++  F SQ+   + AI F +
Sbjct: 467 SAARSFERLAPFGVSNPRPLLLIEEVAVETMRRVGANGAHMKAVF-SQNGAAIDAIGFGL 525

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              PL E +  + G  +   G L VN W G  + QL + D +
Sbjct: 526 --GPLCEEI--APGACVSAVGELSVNEWNGLAKPQLSLCDVA 563


>gi|282850511|ref|ZP_06259890.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella parvula
           ATCC 17745]
 gi|282580004|gb|EFB85408.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella parvula
           ATCC 17745]
          Length = 660

 Score =  280 bits (716), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 187/554 (33%), Positives = 292/554 (52%), Gaps = 22/554 (3%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           IVA+++VNR++ +D  + FL  ++  L+ DP  L D D A   +++ I + + I+I+GDY
Sbjct: 29  IVAKLMVNRHIDVDEGRQFLQGTLSDLL-DPFTLKDMDVAVSLVLETIESHKPIVIYGDY 87

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDG  + +++ RFL     +   YIP+R  +GYG N   +E  I  G  L+ITVDCG +
Sbjct: 88  DVDGITATSVLYRFLKKLGADVTYYIPERQSEGYGLNLEALEHLIERGTALVITVDCGIS 147

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
           SYD ++ A    ID+I+ DHH        A A++N  + D      +L   GV F +   
Sbjct: 148 SYDIVE-AVRDRIDMIITDHHTAPDMIPRAKAVINHKQKDCPYKDKNLSGVGVAFKLCQA 206

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           ++  L +  +  L+      LD+VAL TV DVVPL+G NR  V  GL    R+ N G+K 
Sbjct: 207 LW--LTKHGEWYLDD-----LDIVALGTVADVVPLVGENRIIVKSGLEKMNREPNLGIKK 259

Query: 282 LIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           LI    +    IT+ ++G+ + P +NA GR+  +     LL++DD   +E +A +L+  N
Sbjct: 260 LIGVAGLHERTITSGHIGFTLAPRLNAAGRVTHATRAVELLVTDDEDIVEAIADELNETN 319

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
           + R+ +E  + E A   V  Q    +   V +V G+ WHPG++G++A+RL E+F +P+  
Sbjct: 320 RERQELERNIHELARVDVANQGH--KADYVTIVAGEEWHPGVIGIVASRLVEEFYKPTLV 377

Query: 401 ISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF 460
           IS   DG G GS RSI+GF+I   +     E IL++ GGHA AAG +++      L +  
Sbjct: 378 ISI-HDGIGKGSCRSIDGFNIYDALKSC--EDILLQFGGHAAAAGFSIDANRIDELRERL 434

Query: 461 QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQS 520
            K+   ++      PV  ID  L    +++ +ID +    PYG  N  PVFA     +Q 
Sbjct: 435 TKYCKAVITDEEYIPVVAIDAELPVDDIDVDIIDRVSDLEPYGMANSTPVFAIMEATVQD 494

Query: 521 IRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG 578
           I ++     H ++ FE+ +  TL AIA+         F+    G  + V   L  N W+G
Sbjct: 495 IMLMGQLKNHCKIIFETSNG-TLDAIAWNRPDLFKSIFV----GTVVKVAFSLQKNEWQG 549

Query: 579 SKRCQLRVLDASPV 592
               QL +    P+
Sbjct: 550 MVSPQLMIQAIEPL 563


>gi|303257508|ref|ZP_07343520.1| single-stranded-DNA-specific exonuclease RecJ [Burkholderiales
           bacterium 1_1_47]
 gi|331000228|ref|ZP_08323912.1| single-stranded-DNA-specific exonuclease RecJ [Parasutterella
           excrementihominis YIT 11859]
 gi|302859478|gb|EFL82557.1| single-stranded-DNA-specific exonuclease RecJ [Burkholderiales
           bacterium 1_1_47]
 gi|329572394|gb|EGG54047.1| single-stranded-DNA-specific exonuclease RecJ [Parasutterella
           excrementihominis YIT 11859]
          Length = 572

 Score =  280 bits (715), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 194/526 (36%), Positives = 287/526 (54%), Gaps = 21/526 (3%)

Query: 32  AITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           A+T +   P+ +AR L  R+V+     D+        M  P  L +C +A   I  AI+ 
Sbjct: 16  ALTNR-GFPEPLARALAARHVTSPSDLDYEFKE----MLSPWDLKNCREAGEAIADAIWK 70

Query: 92  SEKIMIFGDYDVDGAASVAL-MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
            +KI+I GDYD DGA +V++ ++   +  + N +  IPDR  DGYG +P L+++    GA
Sbjct: 71  QKKIVIIGDYDCDGATAVSVGILGLQALGAFNVSYLIPDRDKDGYGLSPQLVDRAAAAGA 130

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
           +LIITVD G +S  A+++A   GI+ +V DHH +  +EIP   +VNPN+  D      L 
Sbjct: 131 ELIITVDNGISSVAAVEHAKTLGIEAVVTDHH-LPGDEIPDTLVVNPNQRGDTFPSKSLA 189

Query: 211 AAGVVFLVLVLIYRILRQDNKVP--LNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGL 268
             GV+F VL+ +   LR     P     +L  L+DLVAL TV DVVPL   NR  V KGL
Sbjct: 190 GVGVIFYVLIAVRSALRAKGAYPNGKQPNLQHLIDLVALGTVADVVPLDRNNRILVSKGL 249

Query: 269 MVARR-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDS 326
              R  +  PG+ AL+     ++  I+A +LGY++GP INA GR+   N G   L S D 
Sbjct: 250 DSIRAGKMQPGVSALLSVAGKNAHRISANDLGYILGPRINAAGRLDSINKGVECLTSYDY 309

Query: 327 QELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLL 386
                 A +LD +N  RR  E +M  Q++A +  Q   +  ++ IV++GD WH GI+GL+
Sbjct: 310 NTALFYAKELDQINAERRNREVSM--QSDAILSLQTISVDDSNSIVLKGDDWHAGIIGLV 367

Query: 387 AARLKEKFGRPSFAIS-FEEDGKGI--GSGRSIEGFDIGKMVS--FAVEEGILVKGGGHA 441
           A+R+KE+  RP  A +  EE+G+ +  GSGRSI G  +   +     +  G+++K GGHA
Sbjct: 368 ASRIKEQTYRPVIAFAPSEENGEHVLKGSGRSIPGIHLRDALDRVSKLSPGLILKFGGHA 427

Query: 442 MAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGP 501
           MAAGLT+ +  F    + F +    +    +       DG L AS  NI L++ +     
Sbjct: 428 MAAGLTIRKDAFDEFKELFARAVKELSDPEMFERNIVTDGELRASDFNIELVEAIRKH-V 486

Query: 502 YGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
           +G   P P+FA    K+ S RV+   HL+++ E  D   +QAI FR
Sbjct: 487 WGQAFPEPLFA-NQFKVLSQRVLKDQHLKLSLEV-DGREIQAIWFR 530


>gi|310829083|ref|YP_003961440.1| single-stranded-DNA-specific exonuclease RecJ [Eubacterium limosum
           KIST612]
 gi|308740817|gb|ADO38477.1| single-stranded-DNA-specific exonuclease RecJ [Eubacterium limosum
           KIST612]
          Length = 690

 Score =  280 bits (715), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 182/568 (32%), Positives = 288/568 (50%), Gaps = 26/568 (4%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           +T++  +  + AR+LV R   + D A  +L P       DP  L D  KA  R+++A   
Sbjct: 23  LTEECGLTPLSARLLVKRGYDTADKAMAYLEPDFSDFY-DPFGLPDMQKAVDRLLKAREQ 81

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            EK+ I+GDYD DG  +V+++MR+     + A   IP+R+ +GYG N   +E  I  GA 
Sbjct: 82  GEKVCIYGDYDADGTTAVSILMRYFKGIGIEAFYRIPNRLEEGYGMNIPALEAVIKMGAT 141

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LI++VD G  +++ + Y   QG+DVIV DHH+ + E   A A+V+  R D       LC 
Sbjct: 142 LIVSVDNGIAAHEQVDYCNEQGVDVIVTDHHECQGEVPRALAVVDAKREDSDYPFSELCG 201

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
           AG+   +++ + R+L  D+      DL   ++  A+ATV D+VPL   NR  ++  L + 
Sbjct: 202 AGIALKMVMALDRVLELDS------DLQEYIECAAIATVADIVPLKSENR--IIASLGID 253

Query: 272 RRQGNP---GLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQE 328
               +P   G++ALIE V+    + A N+G++I P INA GR+GE+     L ++ D  +
Sbjct: 254 YLNTSPVNLGIRALIE-VSELKRVNAGNIGFVIAPKINAAGRLGEAGKVVELYMTQDEAQ 312

Query: 329 LEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
              +A  L + N+ R+ +E  +LE A+A+V  Q  D Q   ++VV GD WHPG++G++A+
Sbjct: 313 AAEIAAYLSMENRKRQDIEQEILELAKAQVEQQHLDEQ--GIMVVAGDGWHPGVIGIVAS 370

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTV 448
           +L+E +  P   I  +E G G GS RS+EGF+I + +    E  +    GGH  AAGL++
Sbjct: 371 KLQETWYHPVVVIGIDEKGMGKGSCRSVEGFNIFEALQSCSE--LFTTFGGHEQAAGLSI 428

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
              +  +  +    +A       + T     D V+    V+ AL + L+   PYG GNP 
Sbjct: 429 PAEDIPQFAEKVNDYASEKGIDRLLTKTMYYDSVMGIGDVSEALAEELDQFEPYGVGNPG 488

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           PVF     K Q  R +      + F            +R  G  +G  L      +  + 
Sbjct: 489 PVFLMEGLKPQDARKMGSDKTHLMF--------SLPPYRCVGFGMGAALDDGTDGQFSIL 540

Query: 569 GHLCVNYWRGSKRCQLRVLDASPVEGHH 596
               +N +R  K  QL + D      +H
Sbjct: 541 CKPEINCFRDKKSVQLLLKDIKRSPFYH 568


>gi|196250102|ref|ZP_03148796.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           G11MC16]
 gi|196210286|gb|EDY05051.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           G11MC16]
          Length = 785

 Score =  280 bits (715), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 192/582 (32%), Positives = 295/582 (50%), Gaps = 33/582 (5%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMP--DPL 73
           RW      E   R LA  ++  I  ++A++LV R V +   A  FL+P   L  P  DP 
Sbjct: 7   RWEVDCPDEQTVRRLA--EEADIAPLLAKLLVRRGVRTAAEAAAFLDP---LGQPFHDPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +L   ++A RR+ +AI   E ++++GDYD DG  S ++M+  L     +   YIP+R  +
Sbjct: 62  LLDGMERAVRRLERAINTGELVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYGPN +        G  +I+TVD G  + D +  A   G+DVIV DHH+       AYA
Sbjct: 122 GYGPNLAAFRAAKERGVSVIVTVDNGIAAVDEIAAANEWGLDVIVTDHHEPGPVLPEAYA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVL-VLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           +++P +         L   GV F V   L+ R+ R             LLDLVA+ T+ D
Sbjct: 182 IIHPKKPGSTYPFRDLAGVGVAFKVAHALLGRVPRH------------LLDLVAIGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRI 311
           +VPL+G NR    +GL   R     GL+AL  +  I +  +  + +G+ I P +NA GR+
Sbjct: 230 LVPLVGENRLLAAQGLEALRETNRVGLRALWRQCRIDAMTVNEQTVGFAIAPRLNAAGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
           G ++    LL++DD  E   LA ++D LN+ R+ + + M E+A   V  Q    ++  V+
Sbjct: 290 GGADPAVALLMTDDEGEAARLAQEMDELNRERQQLVAQMAEEAAEMVRRQFPP-EEHRVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVE 430
           VV G+ W+PG+VG++A++L E+F RP+  +S + E G   GS RSI GFD+    S +  
Sbjct: 349 VVAGEGWNPGVVGIVASKLVEQFYRPAVVLSMDREKGIAKGSARSIHGFDL--FASLSQC 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T+   +   L +     A   +     TP   ID   +   + +
Sbjct: 407 RDILPHFGGHPMAAGMTLALDDVEELRERLNAIAARTLSDDDFTPPTFIDAACSVDELTL 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRV 548
           +     E   P+G  NP P+       ++++R V  N AH++  F SQ+   + AI F +
Sbjct: 467 SAARSFERLAPFGVSNPRPLLLIEEVAVETMRRVGANGAHMKAVF-SQNGAAIDAIGFGL 525

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              PL E +  + G  +   G L VN W G  + QL + D +
Sbjct: 526 --GPLCEEI--APGACVSAVGELSVNEWNGLAKPQLSLCDVA 563


>gi|116333979|ref|YP_795506.1| single-stranded DNA-specific exonuclease [Lactobacillus brevis ATCC
           367]
 gi|116099326|gb|ABJ64475.1| exonuclease RecJ [Lactobacillus brevis ATCC 367]
          Length = 773

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 187/560 (33%), Positives = 278/560 (49%), Gaps = 37/560 (6%)

Query: 39  IPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           I  IVA++L NR   +   A DFLNP    L  DP +L D DK   RI  AI   ++I I
Sbjct: 29  ISPIVAQILWNRGYQTAPAAHDFLNPGPEQLH-DPSLLNDMDKGIERIETAIGEEQQITI 87

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYD DG  S A++   L+      N YIP+R  DGYGPN +  EK I  G QL +TVD
Sbjct: 88  YGDYDADGVTSTAILYETLNEMGAKVNYYIPNRFSDGYGPNVAAFEKLIAAGTQLFVTVD 147

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G    +A+  A   G+DV+V DHH++  E   AYA+++P         G L  AGV F 
Sbjct: 148 NGVAGNEAIAAAKKAGVDVVVTDHHELPEELPDAYAIIHPRYPGAEYPFGGLSGAGVAFK 207

Query: 218 VLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
           V   +   + QD           LLDL A+ TV D+VPL+  NR  V  GL + ++   P
Sbjct: 208 VAQALREEIPQD-----------LLDLAAIGTVADLVPLVDENRVLVYFGLQLLKQDERP 256

Query: 278 GLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           GL AL++   I S  +T +++G+ I P +NA GR+ +++    LL + D  + E LA   
Sbjct: 257 GLLALMQTAGIKSDDLTEQSIGFGIAPRLNALGRLDDASPAVELLTTVDEAKAEELAKMT 316

Query: 337 DVLNQNRRLM----ESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           +  N+ R+ +     +A L+QA         D Q  + +V+ G  WH G++G++A+++ E
Sbjct: 317 EQKNRQRQELVQSISTAALQQAVDA------DHQDRATLVISGHDWHEGVLGIVASKVVE 370

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG---ILVKGGGHAMAAGLTVE 449
             G+P+  ++ +  G+  GSGRS+E F++     FA  +G   ++   GGH MA GLTV 
Sbjct: 371 ATGKPTLVLNIQA-GRAKGSGRSVEAFNL-----FAALDGHRDLMTAFGGHHMAVGLTVP 424

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
                 L D     A     A        +   L  +AV  +L   L    P+G  N  P
Sbjct: 425 EDQLTALADALDDEAQTQALAQSGPSELPVAATLPVAAVTPSLYQELAQLAPFGTDNLQP 484

Query: 510 VFAFPNHKLQSIRVVNLAHLQMTFESQDSE-TLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           +FAF +  +  ++V+   H  + F+ Q+ +  L AI F   G       + +      V 
Sbjct: 485 LFAFESATVTQVKVIGKDHSHLKFQLQEGQHQLNAIQF---GAAKYVDDLTAAPDDAAVL 541

Query: 569 GHLCVNYWRGSKRCQLRVLD 588
           G +  N W+G    Q+ V D
Sbjct: 542 GTIEDNVWQGRHSLQVMVKD 561


>gi|332289943|ref|YP_004420795.1| ssDNA exonuclease RecJ [Gallibacterium anatis UMN179]
 gi|330432839|gb|AEC17898.1| ssDNA exonuclease RecJ [Gallibacterium anatis UMN179]
          Length = 576

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 186/540 (34%), Positives = 294/540 (54%), Gaps = 25/540 (4%)

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           LN +++ ++P P +LT  ++A   +++A +  ++I+I GD+D DGA S+A+ +  L    
Sbjct: 41  LNYALKYMLP-PSLLTHLEQATALLIEAYHQQKRIVIVGDFDADGATSIAVAVFALRQLG 99

Query: 121 VNA-NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
             + +  +PDR   GYG + S+ +  +++ AQL+ITVD G +S + + Y     + VIV 
Sbjct: 100 FQSVDFLVPDRFEQGYGLSVSVAQDALDKQAQLVITVDNGVSSLEGVDYLKQHQVQVIVT 159

Query: 180 DHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQ-----DNKVP 233
           DHH +  E++P A  +VNPN         +L   GV F ++V +    RQ     D K P
Sbjct: 160 DHH-LPGEKLPNADVIVNPNLAHCGFPSKYLAGVGVTFYLMVALRAAFRQQGLFADKKEP 218

Query: 234 LNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQG-NPGLKALIERVNIS-SP 291
            NF    LLD VAL TV DVVPL   NR  V +GL   R Q  + G++ALIE  N+  + 
Sbjct: 219 -NF--AELLDFVALGTVADVVPLDHNNRILVSQGLARIRAQHCHCGIRALIEVANLDITQ 275

Query: 292 ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAML 351
           I + +LG+ I P +NA GRI   ++G  LL+S+  ++   LA++LD LN+ R+ +E+ M 
Sbjct: 276 IVSSHLGFSIAPRLNAAGRIDNMSIGVELLLSETMEQARALALELDTLNKTRKEIETGMK 335

Query: 352 EQAEAKVLTQCDDIQQASVIVVEGDR--WHPGIVGLLAARLKEKFGRPSFAISFEEDGKG 409
           ++A    L +   + Q +   +   R  WH G++G+LAAR+K++F RP+   + E++G  
Sbjct: 336 QEA-LHYLRELKPVYQENTFAIALYRPDWHQGVLGILAARMKDQFHRPTAIFTQEDEGIL 394

Query: 410 IGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNI 467
            GS RSIEG  I  ++    +    I++K GGHAMAAGL++ +  F      F ++A + 
Sbjct: 395 RGSARSIEGLHIRDLLDHIHSQHPEIIIKFGGHAMAAGLSIHQQYFPEFQRLFNQYAKSW 454

Query: 468 VPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA 527
           +       V   DG L +  +N++  +ML+ AGP+G   P P F      LQ  R+V   
Sbjct: 455 LDEKSLQGVIYTDGELGSQQMNVSTAEMLQFAGPWGQHFPEPQFDGEFRILQQ-RLVGEK 513

Query: 528 HLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRV 586
           HL+M  E  Q      AI F V      +  +    K   +  HL +N +RG+++ QL V
Sbjct: 514 HLKMLLEPIQGGGLFDAIQFNVDTRRFPDLSI----KTARMVYHLSINEYRGNRQVQLLV 569


>gi|222056528|ref|YP_002538890.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter sp.
           FRC-32]
 gi|221565817|gb|ACM21789.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter sp.
           FRC-32]
          Length = 574

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 185/553 (33%), Positives = 280/553 (50%), Gaps = 22/553 (3%)

Query: 42  IVARVLVNR-NVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           ++AR+L+NR       A  F   S+  L  DP +L   + A  R+++A    EKI I GD
Sbjct: 31  LLARLLLNRVPCDCKAAASFFTSSLAELH-DPYMLLGMESAVERLLRAAVGKEKICIHGD 89

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           YDVDG  SV L++ F     ++A   IPDR+VDGYG +   ++K       +++TVDCG 
Sbjct: 90  YDVDGITSVVLLLTFFQTIGIDACYIIPDRLVDGYGLSADAVDKAARLKTDVMVTVDCGI 149

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVL 219
           T+    +     GID+I+ DHH    E +P A A++NPN+         L   GV F ++
Sbjct: 150 TALAEAKLCAEAGIDLIITDHH-TPGEALPDACAVINPNQKGCNYPFKALAGVGVAFNLV 208

Query: 220 VLIYRILRQDNKVP--LNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
           + +   LR +         +L   LDLVAL T+ DVVPLI  NR     GLM   +   P
Sbjct: 209 IALRSRLRAEGFFSGRAEPNLREYLDLVALGTIADVVPLIDQNRILAKYGLMELSQSHRP 268

Query: 278 GLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLD 337
           G++AL     I+  +    +G+ + P +NA GR+  + +   LL+  D +  E LA  LD
Sbjct: 269 GIQALKRVAGITGDVGCGAVGFRLAPRLNAAGRLENAAMAVELLLCKDLKSAEPLAAALD 328

Query: 338 VLNQNRRLMESAMLEQAEAKVLTQCDD--IQQASVIVVEGDRWHPGIVGLLAARLKEKFG 395
             N  R+ +E  +L  A   V    DD   +    IV+  + WH G++G++A+RL + + 
Sbjct: 329 ASNAERQAVEREILNDALQMVR---DDAAFKGRKSIVLASEEWHSGVIGIVASRLVDLYH 385

Query: 396 RPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           RP+  I+  +DG G GSGRSI GF + + ++   E   LVK GGH  AAGL +       
Sbjct: 386 RPTILIAL-KDGNGKGSGRSIAGFHLHEALTACAEH--LVKFGGHKHAAGLAIAEETLQA 442

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
             + F + A  ++      PV  ID  L A  + + L+  LE   P+G GNP PVF   +
Sbjct: 443 FVERFNEIADGLLTPEDLIPVLLIDAELKAEDLTLDLVSELERMKPFGMGNPEPVFLLQD 502

Query: 516 HKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNY 575
            ++   R+V   HL++  + + ++  +AIAF + G         S G+R+ +     +N 
Sbjct: 503 AEVLESRIVKDTHLKLRLQVE-AKKFEAIAFSMAGR-------VSVGERIDLAFSPAINN 554

Query: 576 WRGSKRCQLRVLD 588
           W G    QL V D
Sbjct: 555 WNGRSSLQLTVKD 567


>gi|323340873|ref|ZP_08081124.1| single-stranded-DNA-specific exonuclease RecJ [Lactobacillus
           ruminis ATCC 25644]
 gi|323091724|gb|EFZ34345.1| single-stranded-DNA-specific exonuclease RecJ [Lactobacillus
           ruminis ATCC 25644]
          Length = 772

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 182/558 (32%), Positives = 287/558 (51%), Gaps = 29/558 (5%)

Query: 39  IPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           + ++VA +L+NR     + A++FL P    L  DP ++ D  K   RI  AI   +KI +
Sbjct: 28  LSELVAEILINRGYDTKEKAENFLKPGPENLY-DPYLMHDMKKGTDRIRTAIVEGQKITV 86

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYD DG  S ++M   L+      + YIP+R  DGYGPN  + ++ I+ G QLI+TVD
Sbjct: 87  YGDYDADGLTSTSIMYEALTQLGAECDYYIPNRFDDGYGPNKDVYKRLIDNGTQLIVTVD 146

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQ--GHLCAAGVV 215
            G   ++A+++A  QG+DV++ DHH++  E   AYA+++P   +D      G L  AGV 
Sbjct: 147 NGVAGHEAIEFAKEQGVDVVITDHHELPQELPDAYAIIHPKIPNDDGDYPFGGLSGAGVA 206

Query: 216 FLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQG 275
           F     +   + Q+            LDL A+ TV D+VPL+  NR  V  GL   R   
Sbjct: 207 FKAATALLEEIPQE-----------ALDLCAIGTVADLVPLVDENRVLVKYGLEALRSTE 255

Query: 276 NPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAM 334
             GL AL E   +    +  E +G+ I P++NA GRI ++ +G  LL + D Q    +A 
Sbjct: 256 RIGLLALYEECGLKQDEVDEETIGFGIAPNLNALGRISDATVGVELLTTMDEQRASEIAK 315

Query: 335 KLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKF 394
             +VL QN           A+A+ L   ++ +   V +V G++WH G++G++A+RL E  
Sbjct: 316 --NVLQQNIERQNLVKDITAQAQDLLN-EESKNHLVNLVWGEKWHEGVLGIVASRLVEST 372

Query: 395 GRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF 453
           G+P+  +    D G   GSGRS+E F++    +      +L K GGH MA GLTV     
Sbjct: 373 GKPTIILGINRDSGLAKGSGRSVEAFNL--FDALDGHRDLLEKFGGHHMACGLTVSADEL 430

Query: 454 GRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAF 513
            +L +   + A N         V  +DG ++ S +N  +I  L   GP+G  NP PVF++
Sbjct: 431 PKLQEILDQEAKNQNLESAAKQVKILDGDIDLSEINPEMIQELSVIGPFGTNNPKPVFSY 490

Query: 514 PNHKLQSIRVV-NLAHLQMTFESQDSETLQ--AIAFRVYGTPLGEFLMQSRGKRMHVTGH 570
             + ++  + + N  HL++   + D  T++  A+ F V G  + EFL       +   G 
Sbjct: 491 RGYVVEDAKPMGNGNHLRLNLLN-DERTVKVAAVCFGV-GNKIAEFLANPEA--IKFIGS 546

Query: 571 LCVNYWRGSKRCQLRVLD 588
           L +N W+  +  Q+ + D
Sbjct: 547 LSINVWQNQRYPQIMIED 564


>gi|259046822|ref|ZP_05737223.1| single-stranded-DNA-specific exonuclease RecJ [Granulicatella
           adiacens ATCC 49175]
 gi|259036445|gb|EEW37700.1| single-stranded-DNA-specific exonuclease RecJ [Granulicatella
           adiacens ATCC 49175]
          Length = 771

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 177/577 (30%), Positives = 304/577 (52%), Gaps = 42/577 (7%)

Query: 19  VSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTD 77
            SL  + G++R L             R+ V R + + +  ++FL+P+  L+  DP +L D
Sbjct: 20  TSLSSESGVSRNLV------------RLCVERGIQTAEELQEFLSPTPHLIH-DPFLLHD 66

Query: 78  CDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGP 137
            DKA  RI +AI N E I I+GDYD DG  S  ++   L       + Y+P+R  DGYGP
Sbjct: 67  MDKAVGRIQEAIENGELIHIYGDYDADGITSTTILYETLEMLGAQVSYYLPNRFTDGYGP 126

Query: 138 NPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNP 197
           N    ++ I EG  LIITVDCG  +++ ++YA   G DVI+ DHH++ SE   AYA+V+P
Sbjct: 127 NTPAFQRVIEEGHTLIITVDCGIAAHEPIRYAMENGCDVILTDHHEIPSEIPEAYAVVHP 186

Query: 198 NRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLI 257
              +     G L  AGV F    L + +L +  +         +++L A+ T+ D+V L 
Sbjct: 187 RHPEANYPCGDLSGAGVAF---KLAHALLGEFPE--------EMVELAAIGTIADLVSLT 235

Query: 258 GLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNL 316
             NR     G+   ++    GL +L+E++++    +  + +G+ IGP +NA GR+G++  
Sbjct: 236 DENRTIAKLGIAQMKQTQRIGLVSLLEKLSVKMDKLDEKTIGFQIGPRLNALGRLGDATP 295

Query: 317 GSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGD 376
           G +LL + D +E + +   +   N+ R+ + + ++E+A   +  Q +      ++V+   
Sbjct: 296 GVQLLTTFDDEEAQSIVDFMQSENERRQAIVNQIVEEATPIIQEQMNQ----PILVLAQP 351

Query: 377 RWHPGIVGLLAARLKEKFGRPSFAISFEEDG-KGIGSGRSIEGFDIGKMVSFAVEEGILV 435
            WH G++G++A+R+ E+ G+P+  +   +DG    GSGRS   F++   ++   +   L+
Sbjct: 352 GWHEGVLGIVASRIVEQTGKPTLVLGISDDGLTAKGSGRSFGEFNLYDALTSVKDH--LL 409

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           K GGH MAAGLTVE +    + D  +++A +    L       ID VL    + +  I+ 
Sbjct: 410 KFGGHHMAAGLTVETIMLPTIIDGLEQYAKDHQDLLDAKATLTIDEVLPLKDITVEWIES 469

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSE-TLQAIAFRVYGTP 552
           L S  P+G  NP P+ +    ++ S +++  +  HL++  +  +S  TLQA+AF      
Sbjct: 470 LASLKPFGTDNPEPIVSLEGIQVASTQLLGADKKHLKLHLKEDNSTYTLQAMAFSK---- 525

Query: 553 LGEFLMQSR-GKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            GE+    +   ++ + G L +N W+ ++  QL V D
Sbjct: 526 -GEWAASLQPDTKISIAGTLEINEWQNNRLPQLMVKD 561


>gi|157693166|ref|YP_001487628.1| recombination protein J [Bacillus pumilus SAFR-032]
 gi|157681924|gb|ABV63068.1| recombination protein J [Bacillus pumilus SAFR-032]
          Length = 774

 Score =  278 bits (711), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 189/591 (31%), Positives = 299/591 (50%), Gaps = 31/591 (5%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPD 71
           +S  RW      E   +  ++++   I  + A +LV R +  ++ A+ FL    +    D
Sbjct: 3   LSKMRWEYEHPSE--EKVKSLSENLNISALTASLLVKRGLEEVEEARSFLFDQ-KAEFHD 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L    +A  RI +AI   E I+IFGDYD DG  S ++++  L   S   + YIPDR 
Sbjct: 60  PFLLKGMKEAVERINKAIEEQESIVIFGDYDADGVTSTSVLLHTLKELSAKVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP- 190
            +GYGPN         +GA L+ITVD G  + +  + A   G+D+I+ DHH+  SEE+P 
Sbjct: 120 KEGYGPNEQAFRYIKEQGASLVITVDTGIAAVNEARIAKEIGLDLIITDHHE-PSEELPE 178

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
           A A+V+P +         L   GV F V   +        K+P       LLDL A+ T+
Sbjct: 179 ALAIVHPKQPGCEYPFKELAGVGVAFKVAHALL------GKLPTQ-----LLDLAAIGTI 227

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGG 309
            D+VPL   NR    KGLM  R+    GLKAL++    +      E +G+ I P +NA G
Sbjct: 228 ADLVPLHDENRWLAKKGLMQLRQSNRLGLKALLKEAGATLEEANEETVGFQIAPRLNAVG 287

Query: 310 RIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQAS 369
           RI +++    LL+++D  E E LA  +  LN+ R+ + S + E+A   V    DD    S
Sbjct: 288 RIEQADPAVHLLMTEDKDEAEELARFVQELNKERQKIVSTITEEAIQMVEETGDD---QS 344

Query: 370 VIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFA 428
            IVV    W+PG+VG++A++L + F RP+  +  +E+ +   GS RSI GFD+   +S  
Sbjct: 345 AIVVAKAGWNPGVVGIVASKLTDTFSRPAIVLGIDEETQMAKGSARSIPGFDLFFHLSKC 404

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
            +  IL   GGH MAAG+T+   +   L +   ++A+  +      P+ ++D V     +
Sbjct: 405 RD--ILPHFGGHPMAAGMTLRADDVPLLRERLNQYANETLTEEDFIPIQRVDAVCKVDEL 462

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAF 546
            +  I+ +    P+G  NP P     + +L+ IR +  N  H++M+ + +D + L  + F
Sbjct: 463 TVEAIEEMGMLSPFGMQNPKPFIMIEDARLEEIRTIGANQNHIKMSLKDED-KLLDCVGF 521

Query: 547 RVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
             +   L E ++   G R+ V G + +N W   K+ QL + DA   E   F
Sbjct: 522 --HQGQLKEEVVT--GSRISVIGEMSINEWNNRKKPQLMLKDARVDEWQLF 568


>gi|308070367|ref|YP_003871972.1| Single-stranded-DNA-specific exonuclease recJ [Paenibacillus
           polymyxa E681]
 gi|305859646|gb|ADM71434.1| Single-stranded-DNA-specific exonuclease recJ [Paenibacillus
           polymyxa E681]
          Length = 798

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 188/584 (32%), Positives = 313/584 (53%), Gaps = 34/584 (5%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDP 72
           S +RW +   +  +  A  +T++  I  +++R+LVNR V+    A  FL  S+  +  DP
Sbjct: 4   SQYRWKT--PEANLEAAQLLTEELGISPLLSRLLVNRGVTTAGEANRFLYGSVDDVH-DP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L    +A  RI QA+   E I+I+GDYD DG +S +LM++ +     + ++YIP R  
Sbjct: 61  FLLLGMKEAVPRIRQALERGEHILIYGDYDADGVSSTSLMIQLMRFLKASYDIYIPHRSN 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++    +G  L+ITVD G ++ + + YAT+ GIDVIV DHH+  +    AY
Sbjct: 121 EGYGLHNHALDWAHQQGVTLVITVDTGISAVEQIAYATSLGIDVIVTDHHEPPAVLPEAY 180

Query: 193 ALVNPNRLDDLSGQGH----LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALA 248
            L+NP     L G  +    L   GV    L L   +L    +VP  +      ++ A+ 
Sbjct: 181 TLINPK----LPGCPYPFKGLAGVGV---ALKLAQALL---GEVPEEW-----FEIAAIG 225

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINA 307
           TV D++PL G NR  V KG+   R    PG++AL+    +  S +T+ N+ + + P INA
Sbjct: 226 TVADLMPLHGENRTMVRKGIQSMRNSAFPGIRALLHVAGVDISTVTSVNIAFALAPRINA 285

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GR+  +     LL ++  +E + LA  LD+LN+ R+ +   ++EQAE ++ ++ +  + 
Sbjct: 286 SGRLDHAGRAVSLLTTEKEEEADQLAHALDLLNRERQQVVERIVEQAEQQLASKLNGGKL 345

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVS 426
            SVIV+ G+ W+ G+VG++A++L +++ RP+  +  + E G   GS RSI   DI   ++
Sbjct: 346 PSVIVLAGEGWNVGVVGIVASKLLDRYYRPTIILGIDAETGTCKGSARSIPALDIYSALT 405

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            + E  ++   GGH  AAG+T+ R N     +   ++A +I+      PV + D V    
Sbjct: 406 DSHE--LMEHFGGHPSAAGMTLSRDNLELFEEQLNRYAGSILTPEDLIPVAEADMVCRMD 463

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAI 544
            V++ +++ LE   P+G GNP+P F     +L+  R +     H+++  E Q+   L AI
Sbjct: 464 EVSLQVVEELELLQPFGMGNPSPRFVLQGLQLREARKMGREKNHVKLLLE-QNGLPLDAI 522

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           AFR     L +FL Q     + + G L +N W G +  QL + D
Sbjct: 523 AFR--RGDLADFLQQQ--TEIDLLGELSINEWNGKRSLQLMMQD 562


>gi|227529069|ref|ZP_03959118.1| single-strand DNA-specific exonuclease RecJ [Lactobacillus
           vaginalis ATCC 49540]
 gi|227351081|gb|EEJ41372.1| single-strand DNA-specific exonuclease RecJ [Lactobacillus
           vaginalis ATCC 49540]
          Length = 774

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 185/567 (32%), Positives = 292/567 (51%), Gaps = 33/567 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           ++Q+  I  ++AR+L  R ++  + A  F+ PS++ +  DP  L D DKA  RI +A+  
Sbjct: 22  LSQELGINPVIARLLAERGITTPEEAHSFIQPSMQAVH-DPHQLHDMDKALERIQEAVAA 80

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E+I ++GDYD DG  S ALM   L     N N Y+P+R  DGYGPN    +K I++G +
Sbjct: 81  GEQITVYGDYDADGITSTALMYEVLQDVGANVNYYVPNRFRDGYGPNAEAYQKIIDQGTK 140

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LIITVD G +    +     QGIDVIV DHH++  +   AYA+V+P           L  
Sbjct: 141 LIITVDNGVSGKAVIDPVVKQGIDVIVTDHHEMPEDLPDAYAIVHPRYPGSNYPFADLSG 200

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F V   +     ++           LLDLVA+  + DVV +   NR  ++ G+   
Sbjct: 201 VGVAFKVAWALLDEFPEE-----------LLDLVAIGEIADVVSVSDENRPLIMMGIQEL 249

Query: 272 RRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           R+   PGL AL++   IS   +T +++G++I P +NA GRI ++N G  LL + D     
Sbjct: 250 RQGMRPGLHALVKEAGISEQSLTDQDIGFVIAPRLNALGRIADANEGVELLTTLDEDRAT 309

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI-QQASVIVVEGDRWHPGIVGLLAAR 389
            LA  ++  N  R+ + + ++ +A+     Q D + Q   V++V G  WH G++G++A+R
Sbjct: 310 KLAKAVEQANSKRQELVNEIMGEAQ----QQVDRLPQDQPVLLVVGHDWHQGVLGIVASR 365

Query: 390 LKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFAVEEG---ILVKGGGHAMAAG 445
           L ++ G+P+   S  +D K   GSGRS++GF++     FA  +G   ++   GGH  A G
Sbjct: 366 LMDQTGKPTIVASTNDDQKIAKGSGRSVDGFNL-----FAALDGHRDLMTSFGGHPAACG 420

Query: 446 LTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAG 505
           L+ E  N  +L +     A N           KI   ++ + V++ L D L S  P+G G
Sbjct: 421 LSFETENSEKLRNVLLHEAENQHFDGQKKQPLKIAASISPAEVSMQLYDQLVSLSPFGPG 480

Query: 506 NPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGK 563
           N  PVF     ++ SI  +  + +HL+     Q S+ +  IAF      L   L  +   
Sbjct: 481 NEQPVFELQPDQINSIVTMGKDNSHLKFMVGDQQSQ-VTVIAFG--KGKLAAVLRAAMAN 537

Query: 564 RMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           ++ +   + +N WRG +  QL + D S
Sbjct: 538 QIKLAVKISINEWRGKRTVQLMLEDIS 564


>gi|170077601|ref|YP_001734239.1| single-stranded-DNA-specific exonuclease RecJ [Synechococcus sp.
           PCC 7002]
 gi|169885270|gb|ACA98983.1| single-stranded-DNA-specific exonuclease RecJ [Synechococcus sp.
           PCC 7002]
          Length = 666

 Score =  277 bits (709), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 179/586 (30%), Positives = 302/586 (51%), Gaps = 25/586 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI- 74
           RW     Q  I ++L   +   +  +VA+VLVNRN+ + + AK ++ P  + L P PL+ 
Sbjct: 9   RWHIADRQPDITQSL--VEAMGLNPLVAQVLVNRNIRTPEQAKIYIQPESQRL-PAPLVE 65

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
             D   +   + +AI     I I GDYD DG  S AL++R L H        IP R+ DG
Sbjct: 66  FEDLALSVELLQEAIAEETLIAICGDYDADGMTSTALLLRALGHVGTKVTYAIPSRMKDG 125

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N  ++ +   EG  LI+TVD G ++Y+ +  A + G+DVI+ DHH +  +  PA A+
Sbjct: 126 YGINERIVTELAEEGVGLILTVDNGISAYEPINLARDLGLDVIITDHHDLPDQLPPANAI 185

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP  L  +S    L   GV +++ V + + + +     L      +L+L  L T+ D+ 
Sbjct: 186 LNPKLLPTMSPYAGLAGVGVAYVLAVSLAQAVDK-----LEGLTSQILELFTLGTIADLA 240

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI---SSPITAENLGYMIGPSINAGGRI 311
           PL G+NR ++ +GL +  +    G++AL++   +      +  +++G+ +GP INA GRI
Sbjct: 241 PLTGVNRRWLKRGLKLLPQSELAGVQALMQIAGVDDQKKQLKPDDIGFRLGPRINAVGRI 300

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
            +      LL +D+       AM+ + +N+ R+ M + +  +A A V     D Q   V+
Sbjct: 301 DDPQKVIELLTTDEPGLALERAMQCEQINKQRQEMCTQIEAEAIALVEETPIDYQGQRVL 360

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           VV  + WH G++G++A+RL E++G P F  + EEDGK  GS R IE F++ + +++   +
Sbjct: 361 VVCKEEWHHGVIGIVASRLVERYGVPVFICTAEEDGKIRGSARGIEEFNVFEALNYC--Q 418

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L K GGH  A G ++ R N     +   +FAH ++      P+ KIDG +N + +   
Sbjct: 419 DLLGKFGGHKAAGGFSLARDNLAAFTEKLSEFAHQLLKPEHLKPLVKIDGAVNFTDLTPE 478

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ---DSETLQAIAFRV 548
               ++   P+G GNP P+F   N ++   R +   HL+ +        + T++AIA++ 
Sbjct: 479 FYQQIDQLHPWGIGNPEPIFWTKNVQILEQRTIGKNHLKFSLGQTIAGQTFTIKAIAWQ- 537

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
                G++L       + +   L  N W G    +L ++ A P E 
Sbjct: 538 ----WGDYL--PLPPTLDIAYKLKENRWNGEVNLELELVGARPSEA 577


>gi|229918414|ref|YP_002887060.1| single-stranded-DNA-specific exonuclease RecJ [Exiguobacterium sp.
           AT1b]
 gi|229469843|gb|ACQ71615.1| single-stranded-DNA-specific exonuclease RecJ [Exiguobacterium sp.
           AT1b]
          Length = 764

 Score =  277 bits (709), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 185/551 (33%), Positives = 291/551 (52%), Gaps = 28/551 (5%)

Query: 43  VARVLVNR-NVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           +A +LV R +  ++ AK FL     L+  DP +    +K   RI QA  + E ++I+GDY
Sbjct: 31  LATLLVQRGHQDVEAAKAFLYAEEELIFHDPYLFEQMEKVVTRIKQAADDGEMVLIYGDY 90

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDG ++ ++M   L+   V A  YIP+R  +GYGPN    +   NEG  L+ITVDCG +
Sbjct: 91  DVDGVSASSVMWHALTEIGVMAECYIPNRFTEGYGPNKEAFQWAANEGFTLVITVDCGIS 150

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
             +      + G+D+I+ DHH+ K     AYA+++P+ +D       L  AGV   V   
Sbjct: 151 GIEEATLLKDLGVDLIITDHHEPKETLPDAYAIIHPH-IDPGYPYDKLAGAGVALKVAHA 209

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           +   + ++           LLDL  L T+ D+VPL G NR    KG+        PG+ A
Sbjct: 210 VLGRMPEE-----------LLDLAVLGTIADLVPLDGENRLLAKKGIAALEASKRPGILA 258

Query: 282 LIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           L E   +  S +  E++G+  GP INA GR+  +    ++L+++  +E   LA +LD  N
Sbjct: 259 LREVCGLGDSVLNEESVGFAFGPRINAAGRLDSAMPALQMLLAEHVEEALELAKQLDKQN 318

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
           + R+ +   +   AEAK L +   + +  V+VV  ++W+PG+VG++A+RL E + RP   
Sbjct: 319 KERQDIVKTI--AAEAKELVEA-SMTEDRVLVVASEKWNPGVVGIVASRLVEAYYRPVIL 375

Query: 401 ISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDF 459
           +  + E GK  GSGRSI+GFD+ K +S    E IL   GGH  AAG+T++  +   L + 
Sbjct: 376 LCHDPETGKAKGSGRSIDGFDLFKELS--KNEDILPHFGGHPAAAGMTLQSEHVAELRER 433

Query: 460 FQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQ 519
             + A +I P  +  P   +D  L+ + V++ LI  +    P+G GNP+P     + KL+
Sbjct: 434 LNRQAESI-PDDVFVPRVNVDLKLSVNDVSLDLISEIGKLAPFGMGNPSPRVVVADAKLR 492

Query: 520 SIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWR 577
            IR +  +  HL++   + D   L  I F  +G  + E    S+   + V G L VN W 
Sbjct: 493 DIRQIGRDATHLKVQL-AGDKRELDGIGFG-FGHVVSEI---SKMAHISVMGSLQVNEWN 547

Query: 578 GSKRCQLRVLD 588
           G ++ QL + D
Sbjct: 548 GMRKPQLMIQD 558


>gi|115374731|ref|ZP_01462008.1| single-stranded-DNA-specific exonuclease RecJ [Stigmatella
           aurantiaca DW4/3-1]
 gi|115368302|gb|EAU67260.1| single-stranded-DNA-specific exonuclease RecJ [Stigmatella
           aurantiaca DW4/3-1]
          Length = 510

 Score =  277 bits (709), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 176/519 (33%), Positives = 277/519 (53%), Gaps = 28/519 (5%)

Query: 81  AARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPS 140
           A  R+ +A+   EKI ++GDYDVDG  S +L+  FL         YIP R+ +GYG N  
Sbjct: 4   AVERLARALRLGEKITLYGDYDVDGVCSTSLLTLFLRQLGAQPATYIPHRLGEGYGLNLQ 63

Query: 141 LMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRL 200
            M++   EG +L++T+DCG TS   +  A   G+DV+++DHH V +    A A++NP++ 
Sbjct: 64  AMDRIAQEGTRLLVTLDCGITSVAEVARARELGMDVVIVDHHTVPTTLPAAVAVLNPHQP 123

Query: 201 DDLSGQGHLCAAGVVFLVLVLIYRILRQD-----NKVPLNFDLLSLLDLVALATVCDVVP 255
                   LCAAGV F + + + + LR +      K PL   L  L+DLVALATV DVVP
Sbjct: 124 GCDYPTKTLCAAGVAFNLCMGLRKHLRDEGFFATRKEPL---LKGLMDLVALATVADVVP 180

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNI--SSPITAENLGYMIGPSINAGGRIGE 313
           L G NR  V  GL        PG++AL E   +   +P+TA  +G+ +GP INA GR+ +
Sbjct: 181 LTGANRILVAHGLQELTAARRPGVRALKEVAGVEPEAPVTAGQVGFRLGPRINAAGRLHD 240

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           ++LG +LL ++  ++   LA  LD  N  R+ +ES++L +A    L Q + +  A  +V+
Sbjct: 241 ASLGLQLLTAESLEDARRLAGVLDRANAERQGIESSILTEA----LKQAESLPHARGLVL 296

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WHPG++G++A+R+ E+F RP+  +   E G G GS RSIEGF +   +    +  +
Sbjct: 297 YAEGWHPGVIGIVASRVVERFHRPTVMVGVNE-GIGKGSARSIEGFHLYDALHGCAD--M 353

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L + GGH  AAGLT+E        + F++ A   +      P  K+D V+    ++   +
Sbjct: 354 LSRFGGHKYAAGLTIEAGRLPAFREAFERIALERLTPEDLIPRCKVDAVVTPHELDERAV 413

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV----NLAHLQMTFESQDSETLQAIAFRVY 549
           + L+  GP+G GNP PV      ++   RV+       H  +     D+  + AI F   
Sbjct: 414 ESLQRLGPFGQGNPEPVLVL-RKQMARPRVLPPKTGHGHAHLKLALVDAPGVDAIGF--- 469

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              + + L    G  + +   + ++ +RG +R  LR+ D
Sbjct: 470 --GMADRLSLVEGP-VDLAFQVGMDTFRGQRRVSLRLKD 505


>gi|67923725|ref|ZP_00517191.1| RecJ exonuclease [Crocosphaera watsonii WH 8501]
 gi|67854433|gb|EAM49726.1| RecJ exonuclease [Crocosphaera watsonii WH 8501]
          Length = 654

 Score =  277 bits (709), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 176/553 (31%), Positives = 293/553 (52%), Gaps = 22/553 (3%)

Query: 42  IVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI-LTDCDKAARRIVQAIYNSEKIMIFG 99
           ++A+V++NR + S   A+ ++NP    L PDPL    D   +   + +AI   EKI I G
Sbjct: 30  LLAQVILNRGIDSPQLAQVYINPETENL-PDPLTEFPDLFPSIELLKEAIETGEKIAICG 88

Query: 100 DYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG 159
           DYD DG  S +L++R  +H   +A   IP R+ DGYG N  ++EKF  EG  +++TVD G
Sbjct: 89  DYDADGMTSTSLLLRAFNHFGGDAYYEIPSRMKDGYGINERIVEKFAEEGVGVVLTVDNG 148

Query: 160 STSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVL 219
            ++Y+ ++ A   G+ VI+ DHH +  +  PA A++NP  L   S    L   GV +++ 
Sbjct: 149 ISAYNPIKLAVELGLTVIITDHHDLPEKLPPADAILNPKLLPIQSPYRGLAGVGVAYILA 208

Query: 220 VLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGL 279
           V +   L++ + +     + SLL+L  L T+ D+ PL+G+NR ++ KGL         G+
Sbjct: 209 VTLAEALQKSDGI-----IDSLLELFTLGTIADLAPLVGVNRRWLKKGLKQLPNSQLVGI 263

Query: 280 KALIERVNISSP---ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           +AL++   +S     +  +++G+ +GP INA GRIG+      LLI+DD       AM+ 
Sbjct: 264 QALMQVAGVSEEQKQLKPDDIGFKLGPRINAVGRIGDPETAIELLITDDPAIALERAMQC 323

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           + +N  R+ +   + ++A   + T   D ++  V+VV   +WH G++G++A+RL E++G 
Sbjct: 324 EQINSQRKSLCEEIEQEAIHLIRTTPIDYKRDRVLVVVHPQWHHGVIGIVASRLVERYGV 383

Query: 397 PSFAISFEED--GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
           P F  ++EE    K  GS R IE F+I + + +  +  +L K GGH  A G  +   N  
Sbjct: 384 PVFIGTYEEADYSKIRGSARGIEEFNIFESLVYCYD--LLGKYGGHKAAGGFGLGSDNLI 441

Query: 455 RLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFP 514
              +   +FAH ++      P+ KIDG  +   +   L + ++S  P+G  N  PVF  P
Sbjct: 442 AFQERLSQFAHQLLEPHHLKPLVKIDGQADFKQLKTQLYENIDSLQPWGIQNAFPVFWTP 501

Query: 515 NHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVN 574
           N K+   R V   HL++     D + ++AIA+R      G +      K + +   L  N
Sbjct: 502 NVKILEQRTVGKNHLKLVLGQDDGQEIKAIAWR-----FGSYF--PLPKCLDIAYKLTEN 554

Query: 575 YWRGSKRCQLRVL 587
            W G+   +L ++
Sbjct: 555 NWNGAVNIELEIV 567


>gi|225164350|ref|ZP_03726615.1| single-stranded-DNA-specific exonuclease RecJ [Opitutaceae
           bacterium TAV2]
 gi|224801030|gb|EEG19361.1| single-stranded-DNA-specific exonuclease RecJ [Opitutaceae
           bacterium TAV2]
          Length = 607

 Score =  277 bits (708), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 177/569 (31%), Positives = 291/569 (51%), Gaps = 28/569 (4%)

Query: 32  AITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           A+T+   +P ++A +LV   V    A + FLNP++  +  DP  L +   A  R+ QAI 
Sbjct: 50  ALTEATHVPPVIAELLVRAGVGTPAAAERFLNPALASIS-DPFQLQNLQAAVVRLHQAIL 108

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEG- 149
             E I + GDYDVDG  S AL++  L     +    +P R+ DGYG + S +++ +  G 
Sbjct: 109 QREDITVLGDYDVDGVTSTALLVSILRRFGTSPRFVVPRRMEDGYGLSRSAIDRALEPGH 168

Query: 150 AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPN--RLDDLSGQG 207
            +L I +DCG+ S+D + Y    GIDVIVIDHHQ K+  +    L+NP+    ++     
Sbjct: 169 PRLFIALDCGTNSHDEIAYLRGLGIDVIVIDHHQTKTGLLNDAILINPHVYPTENDDDWR 228

Query: 208 HLCAAGVVFLVLVLIYRILRQDNKVPLN-FDLLSLLDLVALATVCDVVPLIGLNRAYVVK 266
           HLC  G+VF +   + + LR +N    +   +   LDL A+ TV D+VPL G NR     
Sbjct: 229 HLCTVGLVFKLAHGLVKHLRSENHPGAHEVKMRDYLDLAAMGTVADLVPLTGENRVIARN 288

Query: 267 GLMVARRQGNPGLKALIERVNI--SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISD 324
           GL + +     G++ L+E   +     +   ++ + +GP INA GR+ +++L   LL+S+
Sbjct: 289 GLRILKTTTRSGVRTLMEVAGVRPGQELMPVDISFRLGPRINASGRLADASLSVELLLSN 348

Query: 325 DSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVG 384
           D +  +  A +LD  N+ R+ +E  + E+AE  + +Q  D   +  IV+ G+ WHPG+VG
Sbjct: 349 DEKFCKETATQLDAFNRERQDIERQITEEAERMIESQHLD---SPGIVLFGENWHPGVVG 405

Query: 385 LLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAA 444
           ++A R+  K+ RP   +  E DG   GSGRSI+G ++ ++++       L   GGH MA 
Sbjct: 406 IVAGRVCRKYNRPCVVLGTETDGSAKGSGRSIDGVNLVEVLAACAAH--LTSWGGHPMAV 463

Query: 445 GLTVERVNFGRLCDFFQKFAHNIVP---ALITTPVFKIDGVLNASAVNIALIDMLESAGP 501
           G+ +E+ +   L  F  +FA +++      +T P   I   L    ++   +  LE   P
Sbjct: 464 GVALEKEH---LAAFRVQFAQSVLRQAGGALTAPTLNISAWLRPEEIHETFMGELERMYP 520

Query: 502 YGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSETLQAIAFR-VYGTPLGEFLMQ 559
           +G  NP P+F   N   +    V    H +  FE      L  +A++  +  P       
Sbjct: 521 FGQANPEPIFGVRNVVFRYRPEVFREQHFRFQFEDSHGRRLFGVAWKQAHNVPPA----- 575

Query: 560 SRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
             G+ +++   L  N++   K  QL ++D
Sbjct: 576 --GEPINLAVRLAWNFFNDRKLLQLELVD 602


>gi|302389923|ref|YP_003825744.1| single-stranded-DNA-specific exonuclease RecJ [Thermosediminibacter
           oceani DSM 16646]
 gi|302200551|gb|ADL08121.1| single-stranded-DNA-specific exonuclease RecJ [Thermosediminibacter
           oceani DSM 16646]
          Length = 854

 Score =  276 bits (707), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 184/555 (33%), Positives = 289/555 (52%), Gaps = 31/555 (5%)

Query: 42  IVARVLVNRNVSIDYAKD---FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           ++ ++L +R   ID  +D   FL  S+   M +P++L D DKA +R+ + +   EKI ++
Sbjct: 26  VILKLLKSR--GIDRKEDVVRFLRASLED-MYNPMLLKDMDKAVQRVKKGLAAGEKITVY 82

Query: 99  GDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDC 158
           GDYDVDG     LM+R L     N + YIP R+ +GYG N   +EK   EG  LIITVD 
Sbjct: 83  GDYDVDGITGCCLMVRALREMGGNVDFYIPSRLDEGYGLNKEALEKIAREGTTLIITVDN 142

Query: 159 GSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFL 217
           G  S+D ++YA   G+DVI+ DHH+   E +P A A++NP + D      +L   GV F 
Sbjct: 143 GIASHDEVRYAKELGVDVIITDHHE-PHEVVPDAAAVINPKQKDCPYPFKNLAGVGVAF- 200

Query: 218 VLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
               I  +   D+++     LL  LDL AL T+ D+VPL+  NR     GL   +    P
Sbjct: 201 --KFIQALAGSDDEI-----LLKYLDLAALGTIADMVPLVDENRIIAKHGLNALKNTDKP 253

Query: 278 GLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           GL AL+ +  +  + + AE + Y++ P +NA GR+ ++    +LL++DD++E   LAM L
Sbjct: 254 GLSALMSQSRLDDAELNAEKISYILAPRLNAAGRLSDATTAVQLLLTDDTEEARELAMAL 313

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           + LN+ R+ +E+ +  +    V     D++   VIV    RWHPG++G++A++L + +  
Sbjct: 314 EDLNRERQALENKIYNEVREYVEKNI-DLENVRVIVASSSRWHPGVIGIVASKLVQCYCM 372

Query: 397 PSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRL 456
           P   I+ EE  +G GS RSI GF+I + +       +L K GGH  AAG T++    G  
Sbjct: 373 PCILIA-EEGEEGKGSARSIPGFNIFEALDKL--SYMLDKFGGHDQAAGFTIKVREIGTF 429

Query: 457 CDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNH 516
                + A  I        +  ID  L +  +N+ L + L+   P+G GNP P+F   N 
Sbjct: 430 RSKINELAREISREKWDIRL-NIDLELKSEDINMELAEQLKILEPFGFGNPKPLFICKNL 488

Query: 517 KLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTGHLCV 573
            ++ +R V     HL++  + +  E      F   G  LG +  +      +    +L +
Sbjct: 489 SVERVRAVGEGEKHLKIFLKKRRKE------FSAIGFNLGAYKDKLEMAPFIDAAFYLEL 542

Query: 574 NYWRGSKRCQLRVLD 588
           N W G +  QL + D
Sbjct: 543 NEWEGVREPQLNLKD 557


>gi|295706718|ref|YP_003599793.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus megaterium
           DSM 319]
 gi|294804377|gb|ADF41443.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus megaterium
           DSM 319]
          Length = 780

 Score =  276 bits (707), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 180/565 (31%), Positives = 298/565 (52%), Gaps = 27/565 (4%)

Query: 39  IPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           I  +VA +L+NR ++ ++ A++FL+   +    DP +L D DKA  RI QAI ++EKIMI
Sbjct: 27  ITPLVASLLLNRGMTTVEAAREFLHVDAQTFH-DPFLLHDMDKAVARIQQAIDHNEKIMI 85

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYD DG +S ++M+  L     + + YIP+R  +GYGPN +  +K    G QL+ITVD
Sbjct: 86  YGDYDADGVSSTSVMLSALQQLGADVDFYIPNRFTEGYGPNKAAFDKISAGGYQLVITVD 145

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G ++ +   YA     D+I+ DHH+       AYA+++P           L   GV F 
Sbjct: 146 TGISAVEETAYARELNFDLIITDHHEPGPVLPDAYAIIHPKLPGSTYPFKELAGVGVAF- 204

Query: 218 VLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
              L + +L    ++P +     LL+L  + T+ D+VPL+  NR    KGL   +     
Sbjct: 205 --KLAHALL---GELPEH-----LLELAVIGTIADLVPLVDENRLIARKGLDYLKLTKRT 254

Query: 278 GLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           G++AL+    +    I  + +G+ + P INA GR+ +++    LL++ +++E + LA ++
Sbjct: 255 GIEALLSVCGVKREEINEDTIGFAMAPRINAVGRLQDADPAVHLLMTTNAEEAKGLAKEI 314

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           D LN+ R+ + + + E+A  + +       + SV++VEG+ W+ G+VG++A+RL EKF R
Sbjct: 315 DALNKVRQQIVNDITEEA-VEFVENMYPPDENSVLIVEGEGWNAGVVGIVASRLVEKFYR 373

Query: 397 PSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           P+  +S + + +   GS RSIEGFD+   +S      IL   GGH MAAG+T+   +   
Sbjct: 374 PTIVLSIDSENRIAKGSARSIEGFDLFANLSKC--RDILPHFGGHPMAAGMTLNSDDVEE 431

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
           L     + A N++      P+  +D V     + +  I+ + +  P+G  NP P     +
Sbjct: 432 LRTRLNEQASNVLTEQDFIPITSVDTVCTTEEITLENIEQMSALAPFGMHNPKPKVLIKD 491

Query: 516 HKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTGHLC 572
               S+R +  N  HL++ FE  D      ++    G  LG  L + S   ++ + G L 
Sbjct: 492 VHTTSMRKIGANKNHLKLVFEDSD------VSVDAVGFGLGYILDEVSPIAKVSLVGELS 545

Query: 573 VNYWRGSKRCQLRVLDASPVEGHHF 597
           +N W   ++ QL V D S  E   F
Sbjct: 546 INEWNNMRKPQLMVEDISVDEWQMF 570


>gi|257869427|ref|ZP_05649080.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           gallinarum EG2]
 gi|257803591|gb|EEV32413.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           gallinarum EG2]
          Length = 744

 Score =  276 bits (707), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 184/560 (32%), Positives = 287/560 (51%), Gaps = 29/560 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + Q   +  ++ ++L  RN+ +    + FL P ++ L  DP +  D +KA  RI  AI N
Sbjct: 1   MIQARGLSPLIGQLLWQRNIRTAADLQSFLEPDLQGLH-DPFLFYDMEKAVDRIQTAIMN 59

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E+I+I+GDYD DG  S  ++   L     +   Y+P+R  DGYGPN S+ +  I  G Q
Sbjct: 60  EERILIYGDYDADGITSTTVLKEALELLGADVEFYLPNRFTDGYGPNLSVYQDKIAAGVQ 119

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LIITVD G + ++AL YA    +DVIV DHH++  E   AYA+++P           L  
Sbjct: 120 LIITVDNGVSGHEALAYAKEAQVDVIVTDHHELPPELPDAYAIIHPRHPLGNYPFSDLAG 179

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            GV F V   +        +VP     + LLDLVA+ T+ D+V L G NR  V  GL + 
Sbjct: 180 VGVAFKVATALLE------EVP-----VELLDLVAIGTIADMVSLTGENRILVTNGLKMI 228

Query: 272 RRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
           ++    GL ALIE   +    I   ++G+ IGP +NA GR+ ++N    L+ + D +E +
Sbjct: 229 QQTERAGLSALIEVSGLKKRAINETDIGFAIGPRLNAIGRLEDANPAVTLMSTFDPEEAQ 288

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
           +LA +LD +N  R+     +L++A+        D  Q  +IV  GD WH G++G++A RL
Sbjct: 289 LLANQLDTINLQRKQYVETILKEAQ----NMLSDSNQVHLIV--GDDWHEGVLGIVAGRL 342

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
            ++ GRP   ++ + +G   GSGRS+   ++  M+S   E  +    GGH  A GL+V  
Sbjct: 343 MQQTGRPVLVLTKKSNGIAKGSGRSVAALNLFDMLSGMRE--MFTSFGGHHAAVGLSVPI 400

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            +   L +   ++  +    L +     ID  L+ + +    I+ L+   P+G  NP P 
Sbjct: 401 DHLSMLQERMNQYVVDNRIDLSSGIPLPIDEELSLAEITTNFIESLKILAPFGTDNPIPK 460

Query: 511 FAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           F   N    + R +     HL+++    ++  L  I F  +G+ L EF  +S G  + V 
Sbjct: 461 FLITNISADNGRQIGTENQHLKVSLTDGENGQLDVIGFG-FGSQLVEF--ESEG--LAVV 515

Query: 569 GHLCVNYWRGSKRCQLRVLD 588
           G L VN W G K+ QL + D
Sbjct: 516 GQLSVNEWNGKKKPQLMLED 535


>gi|224369267|ref|YP_002603431.1| RecJ [Desulfobacterium autotrophicum HRM2]
 gi|223691984|gb|ACN15267.1| RecJ [Desulfobacterium autotrophicum HRM2]
          Length = 572

 Score =  276 bits (706), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 177/519 (34%), Positives = 270/519 (52%), Gaps = 22/519 (4%)

Query: 42  IVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           IVA +L NR V   + A  FL P++  L   P  L D D+A  RI+ AI N+E+I+IFGD
Sbjct: 29  IVATLLANRGVKTPEAALAFLTPTMETLT-SPFSLKDMDRAVERIILAIENNERILIFGD 87

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           +D DG  + A++  FL+H +   + YIP R  +GYG     +     +   LI+TVDCGS
Sbjct: 88  FDADGITATAVLNDFLTHVNGEISWYIPHRSKEGYGLKVEHIAMATEQQIDLIVTVDCGS 147

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLV 220
            S++A+  A  + IDVIV DHH+V      A A+VNP +    SG  HL   GV F  LV
Sbjct: 148 DSFEAVDLARLEDIDVIVTDHHEVPDPAPRALAIVNPKQKCCHSGLDHLAGVGVAFY-LV 206

Query: 221 LIYRILRQDNKVPLNF---DLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
           +  R+  +   +   F   +LL+  DLVAL T+ D+VPL   NR   + G+ V RR   P
Sbjct: 207 IALRMEMRKRGMWQRFTEPNLLASCDLVALGTIADMVPLTAENRVLTIAGIEVMRRGKRP 266

Query: 278 GLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           GL AL +   I  + I ++++ + I P INA GR+  + +   LL S D +  E  A  L
Sbjct: 267 GLSALFDVARIDVALIDSDDIAFRIAPRINAAGRMAHARICIDLLCSRDPRGAEQKADLL 326

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQ----CDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           D LN+ R+  E +++   E ++  Q    C D      +V+    WHPG++G++A+++  
Sbjct: 327 DQLNKKRQQTEQSIVADIERRISRQNGAPCKD-----ALVMWDSSWHPGVLGIVASKISR 381

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVN 452
           K+  P   IS   +    GS RSI   +I   +    +   L + GGHAMAAGLT++  N
Sbjct: 382 KYVCPVVLIS-TANSPATGSCRSINNINIHSALGQCSD--FLERFGGHAMAAGLTIQEKN 438

Query: 453 FGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFA 512
                  F+    +IV       + ++D  L    V   LI+ ++S  P+G GNP P+F 
Sbjct: 439 MAAFSHHFENTIRSIVHGEPRKRILELDCALEIDTVTKELIEAIDSLRPFGMGNPEPLFY 498

Query: 513 FPNHKLQSIRVVNLAHLQMTFESQDSET---LQAIAFRV 548
             + K+    ++ + H +M    Q + +   + A+ F +
Sbjct: 499 CKDIKVTHSTIIGMRHRKMELAKQTNASGPCISAVHFNI 537


>gi|310643546|ref|YP_003948304.1| single-stranded-DNA-specific exonuclease recj [Paenibacillus
           polymyxa SC2]
 gi|309248496|gb|ADO58063.1| Single-stranded-DNA-specific exonuclease RecJ [Paenibacillus
           polymyxa SC2]
          Length = 798

 Score =  276 bits (706), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 183/580 (31%), Positives = 312/580 (53%), Gaps = 26/580 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDP 72
           S +RW +   +  +  A  +T++  I  +++R+LVNR V+    A  FL  S+  +  DP
Sbjct: 4   SQYRWKT--PEVNLEAAQPLTEELGISPLLSRLLVNRGVTTAGEANRFLYGSVDDVH-DP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L    +A  RI QA+   E I+I+GDYD DG +S +LM++ +     + ++YIP R  
Sbjct: 61  FLLLGMKEAVPRIRQALERGEHILIYGDYDADGVSSTSLMIQLMRFLKASYDIYIPHRSN 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++    +G  L+ITVD G ++ + + YAT+ GIDVIV DHH+  +    AY
Sbjct: 121 EGYGLHNHALDWAHQQGVTLVITVDTGISAVEQIAYATSLGIDVIVTDHHEPPAVLPEAY 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
            L+NP   D       L   GV    L L   +L   ++VP  +      ++ A+ TV D
Sbjct: 181 TLINPKLPDCPYPFKGLAGVGV---ALKLAQALL---SEVPEEW-----FEIAAIGTVAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRI 311
           ++PL G NR  V +G+   R    PG++AL+    +  S +T+ N+ + + P INA GR+
Sbjct: 230 LMPLHGENRTIVRRGIQSMRNSAFPGIRALLHVAGVEISTVTSVNIAFALAPRINASGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             +     LL ++  +E + LA  LD+LN+ R+ +   ++EQAE ++ ++ +  +  SVI
Sbjct: 290 DHAGRAVSLLTTEKEEEADQLAHALDLLNRERQQVVERIVEQAEQQLASKLNGDKLPSVI 349

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVE 430
           V+ G+ W+ G+VG++A++L +++ RP+  +  + E G   GS RSI   DI   ++   E
Sbjct: 350 VLAGEGWNVGVVGIVASKLLDRYYRPTIILGIDTETGMCKGSARSIPALDIYSALTDCHE 409

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             ++   GGH  AAG+T+ R +     +   ++A +I+      P+ + D V     +++
Sbjct: 410 --LMEHFGGHPSAAGMTLSRDHLELFEERLNRYAGSILTPEDFIPIAEADMVCRLDEISL 467

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRV 548
            +++ LE   P+G GNP+P F     +L+  R +     H+++  E Q+  +L AIAFR 
Sbjct: 468 QVVEELELLQPFGMGNPSPRFVLQGLQLREARKMGREKNHVKLLLE-QNGLSLDAIAFR- 525

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
               L +FL Q     + + G L +N W G +  QL + D
Sbjct: 526 -RGDLADFLQQQTD--IDLLGELSINEWNGKRSLQLMMQD 562


>gi|152976827|ref|YP_001376344.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152025579|gb|ABS23349.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus cytotoxicus
           NVH 391-98]
          Length = 779

 Score =  276 bits (706), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 189/578 (32%), Positives = 296/578 (51%), Gaps = 29/578 (5%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E + R LA   K  +  +V  + + R +   D   DF N + +    DP +L
Sbjct: 7   RWKEKTYNEELVRELA--SKLQLSPLVVSLFLGRGLDTEDKIMDFFNTAEQEFH-DPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ QAI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDRTVERVKQAIQNGEQILIFGDYDADGVSSTTVLFLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN          G  LIITVD G  +    Q A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHQAGFSLIITVDTGIAAVHEAQVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +        +VP +     LL++  + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALL------GRVPEH-----LLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S S IT E++G+++ P INA GR+ ++
Sbjct: 233 LHGENRLIVQRGLKHMRMTKNIGLKALFKVANVSQSEITEESIGFLLAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD-DIQQASVIVV 373
                LL+S+D +E + LA ++D LN+ R+ +   + E  EA +  +C    ++  V+V+
Sbjct: 293 APAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITE--EAIIEVECKYPPEENKVLVL 350

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFAVEEG 432
             + W+PG++G++A++L E+F RP+  +S + + +   GS RSIEGFD+   +S   +  
Sbjct: 351 AKEGWNPGVIGIVASKLVERFYRPTIVLSIDSEKQIAKGSARSIEGFDLFANLSDCRD-- 408

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L   GGH MAAG+T+   +   L     + A+ ++      P+  ID V     V ++ 
Sbjct: 409 LLPHFGGHPMAAGMTLHMNDVDELRRRLNEQANAVLVEEDFIPITTIDAVCKVEDVTLSA 468

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYG 550
           I+ ++   P+G GNP P  A  +  L+SIR +  + +HL+M      + TL  I F  +G
Sbjct: 469 IEDMQKLAPFGVGNPKPCIAVKDADLESIRAIGSDGSHLKMALRDGQA-TLDTIGFG-FG 526

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
               E    S   ++ V G + +N W   K+ QL V D
Sbjct: 527 AYAKEI---SPVAKVSVVGEVSINEWNNFKKPQLMVQD 561


>gi|255037797|ref|YP_003088418.1| single-stranded-DNA-specific exonuclease RecJ [Dyadobacter
           fermentans DSM 18053]
 gi|254950553|gb|ACT95253.1| single-stranded-DNA-specific exonuclease RecJ [Dyadobacter
           fermentans DSM 18053]
          Length = 570

 Score =  276 bits (705), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 188/584 (32%), Positives = 295/584 (50%), Gaps = 34/584 (5%)

Query: 17  RWVS----LLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           RW+        QE + ++LA + K  +   +A +LV R +   D ++DF  P IR L  D
Sbjct: 5   RWIHHPPFTSEQEQVAQSLAESLK--VSPSLATLLVQRGILDFDQSRDFFRPDIRHLH-D 61

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P ++ D +KA  R+++AI ++EKI+++GDYDVDG  SVAL   FL     N + YIPDR 
Sbjct: 62  PFLMADMEKAVERLIKAIDSNEKILVYGDYDVDGTTSVALFYGFLKRIYPNLDYYIPDRY 121

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYG +   +E     G  LI+T+DCG  S D +  A  +GID I+ DHH+   E  PA
Sbjct: 122 EEGYGVSWQGVEWAHANGYTLIVTLDCGVKSVDKVTAALEKGIDFIICDHHRPGDELPPA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVL--VLIYRILRQDNKVPLNFDLLSLLDLVALAT 249
            A+++P R D L     L   GV F +L    + ++L  +        L   LDL+ ++ 
Sbjct: 182 AAVLDPKREDCLYPYKELTGCGVGFKLLQAFCVKQVLDPET-------LYDYLDLLVVSI 234

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGG 309
             D+VP+ G NR     GL     Q   G+KALI+   ++  +   N+ + +GP INA G
Sbjct: 235 ASDIVPITGENRVLAFYGLQRLNAQPRTGIKALIQISGMTGALDITNVVFGLGPRINAAG 294

Query: 310 RIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD-IQQA 368
           RI  +    RLL+S+  +E    A +++  N  RR  +S++ EQ  A  + + D+    A
Sbjct: 295 RIKHAKEAVRLLLSEIEEEAISFAEEINKHNSERRNFDSSITEQ--ALFMIENDEWFSNA 352

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
              V+  + WH G++G++A+R  EK+ RP+  ++    GK  GS RS+ GFD+ +    A
Sbjct: 353 KSTVLYKEDWHKGVIGIVASRCIEKYHRPTIILT-HSHGKAAGSARSVPGFDVYE----A 407

Query: 429 VEE--GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
           +EE   +L + GGH  AAGLT+   N       F +   + +      P+  +D +L   
Sbjct: 408 IEECADLLEQYGGHTFAAGLTLPLDNVEAFKMRFNEIVSSRIQPDQLVPMINVDMLLELE 467

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKL-QSIRVVNLAHLQMTFESQDSETLQAIA 545
           A+     ++L   GP+G GN  PVF   N  L     ++   H++   +  +S    A+ 
Sbjct: 468 AITPKFYNILRQMGPFGPGNMTPVFESRNMTLVGRPMLMKEKHIKFDVKQNNSAVFTAVG 527

Query: 546 FRVYGTPLGEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           F      +G F      G+   +   L  N++R  K  QL + D
Sbjct: 528 FG-----MGHFYPDIVNGRPFSICYCLEENHFRDKKTLQLSLKD 566


>gi|302871303|ref|YP_003839939.1| single-stranded-DNA-specific exonuclease RecJ [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574162|gb|ADL41953.1| single-stranded-DNA-specific exonuclease RecJ [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 798

 Score =  276 bits (705), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 178/575 (30%), Positives = 304/575 (52%), Gaps = 22/575 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW+        N  + I  K   P I+ +VL NR V   +  + FLNPS++ L  +P +L
Sbjct: 7   RWILKDSSNLENIDIEIDGKKIKPQII-KVLNNRGVQEREEIERFLNPSLKNLH-NPFLL 64

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  +A + I QAI +  +++I+GDYD DG  S  L+   L +  +    YIP+R  DGY
Sbjct: 65  NDMKEAVKIISQAILHKSRVLIYGDYDCDGVTSTYLLYSNLRNF-LPTTYYIPNRFKDGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N  +++K + +   ++ITVD G+++++ ++Y   +G  VI+ DHH+ K     A A+V
Sbjct: 124 GLNLDVLKK-LEDKFDVLITVDTGTSNHNEVKYLKEKGKTVIITDHHEPKEVLPDADAVV 182

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP R D +     L   GV F       ++L       +N  L   LD+VA+ T+ DV+P
Sbjct: 183 NPKRKDSIYPFRDLAGVGVAF-------KLLHALKSSGINLKLSEYLDVVAIGTIADVMP 235

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP--ITAENLGYMIGPSINAGGRIGE 313
           L+  NR     GL + +   N GLK LIE   +SS   +   ++ ++IGP +NA GRI +
Sbjct: 236 LVDENRVLAKFGLKILKNTKNVGLKKLIEVAGLSSKEELKPYDVSFIIGPRLNAAGRISD 295

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +NL   LL+  D+ + E +A KLD  N+ R+ +E   +++A+  ++ +   I +  + V+
Sbjct: 296 ANLAVSLLLEKDAIKAESIAKKLDEENRKRQEIEEKTIKEAQG-LIVKDKSILKKKIFVL 354

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WH G+VG+ ++++ EK+ RPS  ++  ++G   GSGRSI+GF++ + +    E  I
Sbjct: 355 SNSSWHAGVVGIASSKITEKYYRPSLLLTLADEGILKGSGRSIKGFNLFEALKNCAE--I 412

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+K GGH  AAGL++   N  +L +     A +    +I  P  ++D VL+ + ++  LI
Sbjct: 413 LLKFGGHEHAAGLSLPVDNVDKLDEILNSIAQD-YHFMIFKPAIEVDLVLSLNEIDDELI 471

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           D +    P+G GNP P F   N  +++ R +   +    F + +S     + F    + L
Sbjct: 472 DQVYLLEPFGVGNPEPTFLIKNLIVENFRFMGDGNKYYKFFAGNSTKYDVVCF----SNL 527

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            +       K++ +   L  N +  +++ Q  ++D
Sbjct: 528 EDEDELVSMKKVDIVCKLEKNIFNSARKNQFNIID 562


>gi|124009844|ref|ZP_01694512.1| single-stranded-DNA-specific exonuclease RecJ [Microscilla marina
           ATCC 23134]
 gi|123984165|gb|EAY24526.1| single-stranded-DNA-specific exonuclease RecJ [Microscilla marina
           ATCC 23134]
          Length = 569

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 180/559 (32%), Positives = 301/559 (53%), Gaps = 28/559 (5%)

Query: 39  IPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           I + +A +LV R++ + D AKDF  PS++  + DP ++ D +KA  R+ +AI + EK+MI
Sbjct: 25  ISESMATLLVQRDIKTFDAAKDFFRPSLKNHLHDPFLMQDMEKAVIRLEKAIEHKEKMMI 84

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYDVDG  SVAL+  FL +     + YIPDR ++GYG +   ++    +G  L+I +D
Sbjct: 85  YGDYDVDGTTSVALVYGFLQNYHSLLDYYIPDRYLEGYGISKISIDWAKEQGITLVIALD 144

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVF 216
           CG  S + + YA  QG+D I+ DHH +  +EIP A+A+++P R D       L   GV F
Sbjct: 145 CGIKSVELMDYANEQGVDYIICDHH-MPGQEIPRAHAVLDPKRKDCAYPFKELSGCGVGF 203

Query: 217 LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGN 276
            ++      LR  N + L   L   LDL+ ++  CD+VP+IG NR     GL    +   
Sbjct: 204 KLMQAY--CLR--NNIDLE-KLYPFLDLLVISIACDIVPIIGENRVMAFYGLRQLNQTQR 258

Query: 277 PGLKALIERVNIS--SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAM 334
            G+KALI+    S  + +   N+ + +GP INA GRI  +     LL+S++ +E + +A 
Sbjct: 259 TGIKALIDVAKFSDDTVLDISNVVFGLGPRINAAGRIQHAKKAVMLLVSNNKKEADYVAE 318

Query: 335 KLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKF 394
            ++  N  RR ++S++ E  EA  + + + ++++   V+  + WH G++G++A+R  E +
Sbjct: 319 LINKDNLQRRDLDSSITE--EALSMIEQNRLEKSKTTVLFKENWHKGVIGIVASRCIETY 376

Query: 395 GRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
            RP+  ++ + +GK  GS RS+ GFD+ + +    +  +L + GGH  AAGLT   +   
Sbjct: 377 HRPTVILT-QHNGKATGSARSVPGFDLYEAIDACAD--LLEQFGGHTHAAGLT---LTLD 430

Query: 455 RLCDFFQKFAHNIVPALIT----TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
           ++  F QKF  NIV   I     TP+ +ID  +    +      +L+   P+G  N  PV
Sbjct: 431 KIEPFRQKF-ENIVAKQIDEEQLTPLIEIDAKIELKDITGKFYRILQQFAPFGPANMRPV 489

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQDSET-LQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F   +      +++   H++     + S+    AI F   G P   +   + G+R  +  
Sbjct: 490 FVSEHLYADYPKLLKEKHVKFRTRQEGSDAFFDAIGF---GMP-EHYERIASGERFALCY 545

Query: 570 HLCVNYWRGSKRCQLRVLD 588
           ++  N +RG    QL++ D
Sbjct: 546 NIDENRYRGQTSLQLKIKD 564


>gi|238018953|ref|ZP_04599379.1| hypothetical protein VEIDISOL_00813 [Veillonella dispar ATCC 17748]
 gi|237864437|gb|EEP65727.1| hypothetical protein VEIDISOL_00813 [Veillonella dispar ATCC 17748]
          Length = 660

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 188/554 (33%), Positives = 286/554 (51%), Gaps = 22/554 (3%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           IVA+++VNR++ +D  + FL  S+  L+ DP  L D D A   + + I N + I+I+GDY
Sbjct: 29  IVAKLMVNRHIDVDEGRKFLQGSLSDLL-DPFALKDMDVAVSLVQETIENHKPIVIYGDY 87

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDG  + +++ RFL     +   YIP+R  +GYG N   +E  I +G  L+ITVDCG +
Sbjct: 88  DVDGITATSVLYRFLKKLGADVTYYIPERQSEGYGLNFEALEHLIEQGTSLVITVDCGIS 147

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
           SYD ++ A    ID+I+ DHH        A A++N  + D      +L   GV F +   
Sbjct: 148 SYDIVE-AVRDRIDMIITDHHTAPDLIPRAKAVINHKQKDCPYKDKNLSGVGVAFKLCQA 206

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           ++     +         L  LD+VAL TV DVVPL+G NR  V  GL       N G+K 
Sbjct: 207 LWLTKYGEW-------YLDDLDIVALGTVADVVPLVGENRIIVKAGLEKMNSHPNLGIKK 259

Query: 282 LIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           LI+   +    IT+ ++G+ + P +NA GR+  +     LL++DD+   E +A +L+  N
Sbjct: 260 LIDVAGLHDRTITSGHIGFTLAPRLNAAGRVTHATRAVELLVTDDADMAEAIAEELNETN 319

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
           + R+ +E  + E A   V  Q    +   V VV G+ WHPG++G++A+RL E+F +P+  
Sbjct: 320 RERQELEWNIHELARIDVANQGH--KADYVTVVAGEEWHPGVIGIVASRLVEEFYKPTLV 377

Query: 401 ISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF 460
           IS   DG G GS RSI+GF+I   +     E +L++ GGHA AAG +++      L D  
Sbjct: 378 ISI-HDGVGKGSCRSIDGFNIYDALKSC--EDVLLQFGGHAAAAGFSIDANRIDELRDRL 434

Query: 461 QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQS 520
             +    V      PV  ID  L    +++ +ID + +  PYG  N  PVFA     +Q 
Sbjct: 435 TAYCKEHVTPEEYIPVVAIDAELPVDDIDVDIIDRVSALEPYGMANSTPVFAVMEATVQD 494

Query: 521 IRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG 578
           I ++     H ++  E+  S TL AIA+         F+    G  + V   L  N W+G
Sbjct: 495 IMLMGQLKNHCKVILETS-SGTLDAIAWNRPDLFKTIFV----GTVVKVAFSLQKNEWQG 549

Query: 579 SKRCQLRVLDASPV 592
               QL +    P+
Sbjct: 550 MVSPQLMIQAIEPL 563


>gi|299144023|ref|ZP_07037103.1| single-stranded-DNA-specific exonuclease RecJ [Peptoniphilus sp.
           oral taxon 386 str. F0131]
 gi|298518508|gb|EFI42247.1| single-stranded-DNA-specific exonuclease RecJ [Peptoniphilus sp.
           oral taxon 386 str. F0131]
          Length = 589

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 172/488 (35%), Positives = 280/488 (57%), Gaps = 23/488 (4%)

Query: 35  QKHAIPDIVARVLVNRNVSIDYA-KDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSE 93
           +K  I   +  +L NR++  +   + FLNP++  L   PL+L D  KAA  ++ ++  ++
Sbjct: 17  EKLNINKYICNILFNRDIDTEEKLEKFLNPNLEDLHT-PLLLPDLIKAANILINSVATNK 75

Query: 94  KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLI 153
           KI I GDYDVDG  S  ++ + LS+   N +  IP+R+ DGYG N  L+++   +G  LI
Sbjct: 76  KIRIIGDYDVDGVMSTYILYKGLSYLKANVDYRIPNRVSDGYGINLRLIDEARTDGIDLI 135

Query: 154 ITVDCGSTSYDALQYATNQGIDVIVIDHHQV-----KSEEIP-AYALVNPNRLDDLSGQG 207
           IT D G  + D +QYA   GI VIV DHH+V     K E +P A A+V+P R        
Sbjct: 136 ITCDNGIAARDEIQYAVENGIGVIVTDHHEVPVDTEKKELLPNALAIVDPKRESSKYPFR 195

Query: 208 HLCAAGVVFLVLVLIYRILR-QDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVK 266
            +C A V + ++  +Y+I   +D K+  +F     L+ VA+AT+CDV+PLI  NR  V K
Sbjct: 196 EICGATVAYKLITYLYKINGIEDEKLYSDF-----LEFVAIATICDVMPLIDENRVLVFK 250

Query: 267 GLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDD 325
           GL    +  N G+KA+I   ++S+  I+A ++G++IGP+IN+ GR+  +++  +LL+ +D
Sbjct: 251 GLEYLNKTKNSGIKAIINAADLSNNLISAYHIGFIIGPTINSSGRLESADIAVKLLLEED 310

Query: 326 SQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGL 385
                  A  L  LN  R+ +     E+ + K++ + + +++  V+++        ++G+
Sbjct: 311 YNVALKYATYLRELNSKRQKLTDDGFEKID-KIVNEFNLLEKFPVLILRDKEIDESVIGI 369

Query: 386 LAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAG 445
           +A R+KEK+ RP+  ++  +D    GSGRSIEGF++ + VS + E  +L + GGHAMA G
Sbjct: 370 IAGRIKEKYNRPAIILTTSKDELK-GSGRSIEGFNLFEHVSASKE--LLSRFGGHAMACG 426

Query: 446 LTVERVNFGRLC-DFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGA 504
           L++E  NF +   D   K   N+    +   V+ ID  +N S V+I+L   +E   P+G 
Sbjct: 427 LSLEEENFKKFVIDVNNK--SNLTKEDLIKKVY-IDTQINLSDVDISLATDIEKLNPFGN 483

Query: 505 GNPNPVFA 512
           GN  P+FA
Sbjct: 484 GNSKPLFA 491


>gi|295697199|ref|YP_003590437.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus tusciae DSM
           2912]
 gi|295412801|gb|ADG07293.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus tusciae DSM
           2912]
          Length = 575

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 185/580 (31%), Positives = 299/580 (51%), Gaps = 27/580 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW++     G   A+A  Q+      +AR+L  RN+   + A  FLNP +  L  DP  +
Sbjct: 3   RWIAAPADPG---AVATLQREGFSSFMARILAARNIRTGEEAGRFLNPRLEDLE-DPAKM 58

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
                A  RI +A+ N E I ++GDYD DG  + +++   L         YIPDR  +GY
Sbjct: 59  KGMLPALARIREALANRESIAVYGDYDCDGVCATSILYLALRELGARVQAYIPDRFQEGY 118

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   + +    G +LIITVD G T+    + A + G+D+I+ DHHQ  +E   A A+V
Sbjct: 119 GLHEEAIRELYARGVRLIITVDTGITALRQAETARSLGVDLIITDHHQPPAELPRALAVV 178

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP +        +LC AG+ F ++  +        +VP  F     LDLVA+ATV D+VP
Sbjct: 179 NPKQPGCPYSDTNLCGAGIAFKMVQGLL------GRVPEEF-----LDLVAIATVADLVP 227

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L+G NR  V  GL   +    PGL ALI+   +   P+T+ +LG+ +GP +NA GR+  +
Sbjct: 228 LLGENRILVHFGLKQLQNPQRPGLAALIKSAGLDGRPLTSGHLGFQLGPRLNAAGRMETA 287

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           N   RLL + D +E +    +L+ LN+ R+ +   +   A  ++    +   Q S +V+ 
Sbjct: 288 NAAFRLLTTADPEEAQKWTEQLETLNRERQRLCDEIAAVASEEIDRHPEWRAQPS-LVLA 346

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
           G+ W+PG++G++A+R+ E++ RP+  I+ + D    GS RSI GFD+   +    +  + 
Sbjct: 347 GEGWNPGVIGIVASRMVEQYYRPTLVIALDGD-TAKGSARSIPGFDLYSGLKEIAD--LF 403

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
            + GGH MAAG ++       L   F + A + + A    P    D  +N   +++ L +
Sbjct: 404 DRFGGHTMAAGFSLPAKRVEDLRRRFAEVAASRLTAEDLRPRILCDAEINLEKIDLPLAE 463

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTP 552
            L +  P+G GNP P     +  L   R V  + AHL++   + +   + A+A+R  G  
Sbjct: 464 SLATLEPHGLGNPAPKLFVRSAPLLESRTVGASAAHLRLRIGNPE-HPVTALAWR-RGDD 521

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           +  FL Q   + +H+ G + +N W G+K+ QL + D  P 
Sbjct: 522 I-RFLAQGV-RAVHLVGRVQINEWNGTKKVQLELDDWRPA 559


>gi|56963333|ref|YP_175064.1| single-strand DNA-specific exonuclease [Bacillus clausii KSM-K16]
 gi|56909576|dbj|BAD64103.1| single-strand DNA-specific exonuclease [Bacillus clausii KSM-K16]
          Length = 785

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 190/595 (31%), Positives = 302/595 (50%), Gaps = 39/595 (6%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLN---PSIRLLM 69
           S  RW  L   E + + LA   + ++  + AR+LV R + ++  AK FL+   P+     
Sbjct: 4   SKTRWRILEQNELLAQELADELRVSM--LTARLLVRRGIQTVQAAKRFLHYEEPTFY--- 58

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
            DP +L   ++   RI  A+   E+I++FGDYD DG +S ++M+  L     + + YIP+
Sbjct: 59  -DPFLLKGMEETIERIALAVKRKERILVFGDYDADGVSSTSVMLTALQTYGADCDYYIPN 117

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R  +GYGPN   ++    +G  L+ITVD G ++ +   +A + G+D I+ DHH+      
Sbjct: 118 RFTEGYGPNCPALDFAKRQGYHLVITVDTGISALNEAAHAKDIGLDFIITDHHEPPPVLP 177

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVL-VLIYRILRQDNKVPLNFDLLSLLDLVALA 248
            A A++NP +         L   GV F V   L+ R+  +            LLD   + 
Sbjct: 178 EALAIINPKQPGCPYPFKELAGVGVAFKVAHALLGRLPEE------------LLDYAVIG 225

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINA 307
           T+ D+VPLI  NR    KGL      G PG++AL E   +    + A+++G+ IGP +NA
Sbjct: 226 TIADLVPLIDENRLLAKKGLRAIESSGRPGIRALKEVCGMKQEAMDADHIGFAIGPRLNA 285

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV-LTQCDDIQ 366
            GR+  +N    LL++DD +E + LA ++D LN+ R+ + S M E+A   V  T    I 
Sbjct: 286 AGRLDSANPAVELLLADDEEEAKALATEIDSLNKERQAIVSKMTEEAIRLVETTYGTKIP 345

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE-DGKGIGSGRSIEGFDIGKMV 425
            A V+  EG  W+PG++G++A+RL E+F RP+  +S +E  G   GS RSIEGFD+ +  
Sbjct: 346 HAIVVAKEG--WNPGVIGIVASRLVEQFYRPTIVMSIDESSGLAKGSARSIEGFDMYQ-- 401

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             A    IL   GGH MAAG+T++  +   L     K A   +   + TP   ID V   
Sbjct: 402 ELANNRDILPHFGGHPMAAGMTLKTEDIDDLRSRLIKQAKETLTDDMLTPATDIDLVAEV 461

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQA 543
             V + +I  L++  P+G  N  P+       +  +R +  N  HL++ F +   + L  
Sbjct: 462 EDVTVQVIGELQALAPFGVANRKPIVLVEGAHISDMRRIGSNQNHLKIQF-TGAQKPLDG 520

Query: 544 IAFRVYGTPLGEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
           IAFR     +G    + +   ++   G + +N W G  + QL + D + +E   F
Sbjct: 521 IAFR-----MGHLFEEITPHAKLSAIGTVSLNEWNGKVKPQLIIDDLAVLEWQLF 570


>gi|312128185|ref|YP_003993059.1| single-stranded-DNA-specific exonuclease recj [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778204|gb|ADQ07690.1| single-stranded-DNA-specific exonuclease RecJ [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 798

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 181/576 (31%), Positives = 302/576 (52%), Gaps = 24/576 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW+        N  + I  +   P I+ +VL NR V   +  + FLNPS++ L  +P +L
Sbjct: 7   RWILKDNNNIENMDIEIDGRKIKPQII-KVLNNRGVQEKEEIERFLNPSLKNLH-NPFLL 64

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  +A + I QAI +  +++I+GDYD DG  S  L+   L +  +    YIP+R  DGY
Sbjct: 65  PDMKEAVKIINQAILHKNRVLIYGDYDCDGVTSTYLLYSALRNF-LPTTYYIPNRFKDGY 123

Query: 136 GPNPSLMEKFINEGA-QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           G N  +++K   EG   L+ITVD G +S++ ++Y   +G +VI+ DHH+ K     A A+
Sbjct: 124 GLNLDVLKKL--EGKFDLLITVDTGISSHNEVKYLKEKGKEVIITDHHEPKEVLPDADAV 181

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP R D       L   GV F       ++L       +N  L   LD+VA+ T+ DV+
Sbjct: 182 INPKRKDSTYPFRDLAGVGVAF-------KLLHALKNSGVNLKLSEYLDVVAIGTIADVM 234

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP--ITAENLGYMIGPSINAGGRIG 312
           PL+  NR +   GL V +   N GLK LIE   +SS   +   ++ ++IGP +NA GRI 
Sbjct: 235 PLVDENRIFAKFGLKVLKNTKNVGLKKLIEVAGLSSKEELKPYDVSFIIGPRLNAAGRIS 294

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           ++NL   LL+  D  + E +A KLD  N+ R+ +E   +++A+  ++ +   I +  + V
Sbjct: 295 DANLAVSLLLEQDVIKAESIAKKLDEENRKRQEIEEKTIKEAQG-LIAKNKSILKKKIFV 353

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +    WH G+VG+ ++++ EK+ RPS  ++  ++G   GSGRSI+GF++ + +    E  
Sbjct: 354 LSNSSWHAGVVGIASSKITEKYYRPSLLLTLADEGVLKGSGRSIKGFNLFEALRNCAE-- 411

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           IL+K GGH  AAGL++   N  +L +     A +    +I  P  ++D VL+ + ++  L
Sbjct: 412 ILLKFGGHEHAAGLSLPVDNVDKLDEILNSIAQD-YHFMIFKPAIEVDLVLSLNEIDDEL 470

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
           ID +    P+G GNP P F   N  +++ R +   +    F + +S     + F    + 
Sbjct: 471 IDQVYLLEPFGVGNPEPTFLIKNLVVENFRFMGDGNKYYKFFAGNSTKYDVVCF----SN 526

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           L +       K++ +   L  N +   ++ Q  ++D
Sbjct: 527 LEDEDELISMKKVDIVCKLEKNLFNSVRKNQFNIID 562


>gi|255658297|ref|ZP_05403706.1| single-stranded-DNA-specific exonuclease RecJ [Mitsuokella
           multacida DSM 20544]
 gi|260849614|gb|EEX69621.1| single-stranded-DNA-specific exonuclease RecJ [Mitsuokella
           multacida DSM 20544]
          Length = 668

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 191/585 (32%), Positives = 292/585 (49%), Gaps = 25/585 (4%)

Query: 25  EGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILTDCDKAAR 83
           E +    A  Q+      VA +L +R +   D A+ FL+P  RL   DP  + D DKA  
Sbjct: 9   EPVPELAAFAQEIGRDTTVAALLWHRGIRTRDAAELFLHPE-RLPFADPFAMRDMDKAVA 67

Query: 84  RIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLME 143
           RI +A+   E I ++GDYDVDG  + +L+ R L       + YIPDR+ +GYG N   +E
Sbjct: 68  RIQKALAQGEHITVYGDYDVDGMTATSLLTRTLRKFGAKVDFYIPDRMTEGYGLNRRALE 127

Query: 144 KFINEGAQLIITVDCGSTSYDALQYATNQG-IDVIVIDHHQVKSEEIPAYALVNPNRLDD 202
           + I E + L++TVDCG  S   +      G +D+I+ DHH   SE  PA A++NP+R D 
Sbjct: 128 E-IAEQSDLLVTVDCGIASVADVAAIQGAGKLDIIITDHHLPGSELPPACAVLNPHRADC 186

Query: 203 LSGQGHLCAAGVVFLV---LVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGL 259
                 L   GV F +   L         D +     D    L+LVAL TV D+VPL G 
Sbjct: 187 PYPDKDLAGVGVAFKLCQALAAARSGKLWDGQSAFTDD----LELVALGTVADIVPLRGE 242

Query: 260 NRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGS 318
           NR  V +G+        PG+ AL+E   +    ITA +LG+++ P +NA GRI  +  G 
Sbjct: 243 NRRIVKQGMARMEATALPGVAALVEVAGLKDKKITAGHLGFLLAPRLNAAGRIESARTGV 302

Query: 319 RLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRW 378
            LL ++D  + + LA++LD LN  RR +ES + + AE ++  +  D+ +   IVV G  W
Sbjct: 303 ALLTAEDRAQADKLALELDALNTERREIESTICQTAEQEL--ESLDMAETKAIVVAGKGW 360

Query: 379 HPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGG 438
           +PG++G+ A+RL +KF +P+  +S +EDG   GS RSIEG ++ + +S   E   L++ G
Sbjct: 361 NPGVIGIAASRLVDKFYKPTIVLSVQEDGICRGSCRSIEGLNMYEALSACKEH--LLQFG 418

Query: 439 GHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLES 498
           GHAMAAGL++           F  +A   +      P   ++  +    + + L++ L  
Sbjct: 419 GHAMAAGLSLREEELPAFRAAFAAYAGAHLSEEDYEPKVSVEFEMMPEELTLDLVEELSL 478

Query: 499 AGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEF 556
             PYG GNP P F   N + +    +     HL+    ++D+     +  R       + 
Sbjct: 479 LEPYGMGNPKPYFGCRNVRGREAMAIGREQNHLRFKLGTEDAPVTSLMWNR------ADL 532

Query: 557 LMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHH-FAKK 600
                 + + V     +N W G +  Q  V D SP +    F +K
Sbjct: 533 AAAVNRETLDVVYAPAINEWNGRRSLQCMVEDLSPAQSERVFPEK 577


>gi|319644792|ref|ZP_07999025.1| YrvE protein [Bacillus sp. BT1B_CT2]
 gi|317392601|gb|EFV73395.1| YrvE protein [Bacillus sp. BT1B_CT2]
          Length = 782

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 198/596 (33%), Positives = 300/596 (50%), Gaps = 43/596 (7%)

Query: 14  SGFRW-VSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           S  RW V    +E + +   +  +  I  + A +LV R   + D A  FL  +      D
Sbjct: 4   SKMRWDVQTPDKEKVEQ---LAGRLGITPLAASLLVMRGYDTADKASSFLYGN-DARFHD 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L D +KA RRI QAI + EKIMI+GDYD DG  S  ++++ L  CS  A+ YIPDR 
Sbjct: 60  PYLLKDMEKAVRRIKQAISDQEKIMIYGDYDADGVTSTTVLLQMLKKCSAQADFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN +        G  LIITVD G       + A   GID+I+ DHH+       A
Sbjct: 120 KEGYGPNEAAFRGIKESGYSLIITVDTGIAGVHEAEVAKELGIDLIITDHHEPGPVLPDA 179

Query: 192 YALVNPNRLDDLSGQGH----LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVAL 247
           YA+++P +     G G+    L   GV F +   +   L +D           LLDL A+
Sbjct: 180 YAIIHPKQ----PGCGYPFKELAGVGVAFKLAHALNGELPED-----------LLDLCAI 224

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKAL--IERVNISSPITAENLGYMIGPSI 305
            T+ D+VPL   NR    +G+   R+   PGLKAL  I    I +    E +G+ I P +
Sbjct: 225 GTIADLVPLHDENRQIAKRGMEQFRKTKRPGLKALAKIAGAEIHNA-DEETIGFQIAPRL 283

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NA GRI +++    LL ++D +E E LA  ++ LN+ R+ + + M E+A   +  +  D 
Sbjct: 284 NAVGRIEQADPAVNLLNTEDEREAEELAEDINALNKERQKIVNQMTEEAVQMIEEEGLD- 342

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGFDIGK 423
               VIVV    W+PG+VG++A++L E+F RP+  +  +E+ KGI  GS RSI+GFD+ +
Sbjct: 343 --QPVIVVARPGWNPGVVGIVASKLVERFYRPAIVLGIDEE-KGIAKGSARSIKGFDLFQ 399

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +S   +  IL   GGH MAAG+T+   +   L +   + A  ++      PV  +D   
Sbjct: 400 NLSECRD--ILPHFGGHPMAAGMTLNLEDVSALRERINRQAEAVLTEADFIPVQDVDLCC 457

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETL 541
               +++  I  +    P+G GNP P     + K+   R +  N  HL++   + D   L
Sbjct: 458 RLEDISVDSIAEMNLLAPFGTGNPKPFVLVSDVKIDDARKIGANKNHLKLVL-ADDGNKL 516

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
             I F  Y   + E ++   G ++ + G L +N W   K+ QL + DA+  E   F
Sbjct: 517 DCIGF--YKGDIEEGIVP--GAKISIVGELSINEWNNRKKPQLMIKDAAVNEWQLF 568


>gi|331701141|ref|YP_004398100.1| single-stranded-DNA-specific exonuclease RecJ [Lactobacillus
           buchneri NRRL B-30929]
 gi|329128484|gb|AEB73037.1| single-stranded-DNA-specific exonuclease RecJ [Lactobacillus
           buchneri NRRL B-30929]
          Length = 776

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 188/583 (32%), Positives = 285/583 (48%), Gaps = 28/583 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHA-IPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           S ++W   L Q   +  +    K A I   +A++L+ R + S D  +DFLNPS+     D
Sbjct: 4   SKYKW--QLDQPADSSVVDKLAKDANIDPFIAKMLIQRGITSADVVEDFLNPSVSAFH-D 60

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P ++ D  K   RI QA+ N E I ++GDYD DG  S  +M   LS    + + YIP+R 
Sbjct: 61  PFLMHDMHKGIERIQQAVENGEHITVYGDYDADGITSTTVMYETLSDLGADVDYYIPNRF 120

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN    +K I +G  LI+TVD G     A+  A     DV+V DHH +  +   A
Sbjct: 121 TEGYGPNVEAFQKIIQKGTSLIVTVDNGVAGNQAIAAANELHCDVVVTDHHSLPEKLPDA 180

Query: 192 YALVNP---NRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALA 248
           YA+++P   N   D    G LC AGV F V   +       ++VP +     L+D+ A+ 
Sbjct: 181 YAIIHPRVKNENGDAYPFGDLCGAGVAFKVAQALM------DEVPSD-----LIDITAIG 229

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINA 307
           TV DVV L   NRA V  G+        PGL ALI+   I     + E++G+ I P +N+
Sbjct: 230 TVADVVSLRDENRAIVKFGVQAISNSQRPGLLALIKEAGIDLGRFSEEDIGFGIAPRLNS 289

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRI ++ +G  LL + D      LA   +  N  R+ +      +A  + +    DI Q
Sbjct: 290 LGRIKDATVGVELLSTFDEDRAGELAKFANQQNDLRKSLVDQFFTEA-VQSVEDSGDISQ 348

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI-GSGRSIEGFDIGKMVS 426
              +VV G  WH G++G++A+RL +K+ RP+  ++  +  + + GSGRS++ FD+ K + 
Sbjct: 349 RHTLVVVGHNWHQGVLGIVASRLVDKYQRPTIVMTDTDGSEEVKGSGRSVDNFDLFKAID 408

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
              ++ I    GGH  A GLT+++     L D  +K A      L   P   I GV+  S
Sbjct: 409 PIRDQTIGF--GGHHSAVGLTIKKDKVPVLKDQLEKAAEEQQLDLSVKPKLAIAGVIPVS 466

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE-SQDSETLQAIA 545
            V   L D +++  P+G  NP P+F     +L +++ +      + F   Q +  L AIA
Sbjct: 467 QVTAVLCDQIKTLAPFGQDNPKPIFQVQFDQLANVKAMGKTSDHLKFSLVQGNNRLTAIA 526

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           F   G       +Q+    + V G +  N W      QL V D
Sbjct: 527 F---GRGSAAVELQNSQAAVQVVGEIGENTWNNRTTLQLMVDD 566


>gi|294501371|ref|YP_003565071.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus megaterium
           QM B1551]
 gi|294351308|gb|ADE71637.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus megaterium
           QM B1551]
          Length = 780

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 179/565 (31%), Positives = 295/565 (52%), Gaps = 27/565 (4%)

Query: 39  IPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           I  +VA +L+NR ++ ++ A++FL+   +    DP +L D DKA  RI QAI ++EKIMI
Sbjct: 27  ITPLVASLLLNRGMTTVEAAREFLHVDAQTFH-DPFLLHDMDKAVARIQQAIDHNEKIMI 85

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYD DG +S ++M+  L     + + YIP+R  +GYGPN    +K    G QL+ITVD
Sbjct: 86  YGDYDADGVSSTSVMLSALQQLGADVDFYIPNRFTEGYGPNKEAFDKISAGGYQLVITVD 145

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G ++ +   YA     D+I+ DHH+       AYA+++P           L   GV F 
Sbjct: 146 TGISAVEETAYARELNFDLIITDHHEPGPVLPDAYAIIHPKLPGSTYPFKELAGVGVAF- 204

Query: 218 VLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
              L + +L    ++P +     LL+L  + T+ D+VPL+  NR    KGL   +     
Sbjct: 205 --KLAHALL---GELPEH-----LLELAVIGTIADLVPLVDENRLIARKGLDYLKLTKRT 254

Query: 278 GLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           G++AL+    +    I  + +G+ + P INA GR+ +++    LL++ +++E + LA ++
Sbjct: 255 GIEALLSVCGVKREEINEDTIGFAMAPRINAVGRLQDADPAVHLLMTTNAEEAKGLAKEI 314

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           D LN+ R+ + + + E+A  + +       + SV++VEG+ W+ G+VG++A+RL EKF R
Sbjct: 315 DALNKERQQIVNDITEEA-VEFVESMYPPDENSVLIVEGEGWNAGVVGIVASRLVEKFYR 373

Query: 397 PSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           P+  +S + + +   GS RSIEGFD+   +S      IL   GGH MAAG+T+   +   
Sbjct: 374 PTIVLSIDSENRIAKGSARSIEGFDLFANLSKC--RDILPHFGGHPMAAGMTLNSDDVEE 431

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
           L     + A N++      P+  +D V     + +  I+ + +  P+G  NP P     +
Sbjct: 432 LRRRLNEQASNVLTEQDFIPITSVDTVCTTEEITLENIEQMSALAPFGMHNPKPKVLIKD 491

Query: 516 HKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTGHLC 572
               S+R +  N  HL++ FE         ++    G  LG  L + S   ++ + G L 
Sbjct: 492 VHTTSMRKIGANKNHLKLVFED------SGVSVDAVGFGLGYILDEVSPIAKVSLVGELS 545

Query: 573 VNYWRGSKRCQLRVLDASPVEGHHF 597
           +N W    + QL V D S  E   F
Sbjct: 546 INEWNNMHKPQLMVEDISVDEWQMF 570


>gi|146295896|ref|YP_001179667.1| single-stranded-DNA-specific exonuclease RecJ [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409472|gb|ABP66476.1| exonuclease RecJ [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 803

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 181/575 (31%), Positives = 303/575 (52%), Gaps = 22/575 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRN-VSIDYAKDFLNPSIRLLMPDPLIL 75
           RWV    +   +  + I  +   P I+ +VL NR  V  D  + FL P+I+ L  +P +L
Sbjct: 7   RWVLKECENFDDFDIQIDGRKIRPQII-KVLKNRGIVQKDDIEKFLAPAIKNLH-NPFLL 64

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  +A   +  AI + ++++I+GDYD DG  S  L+   L    +  + YIP+R  DGY
Sbjct: 65  NDMKEAINIVHNAILHKKRVLIYGDYDCDGVTSTYLLYSNLKKF-LPTSYYIPNRFKDGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N  ++++ + +   ++ITVD G ++ + ++Y   +G  VIV DHH+ K +   A A++
Sbjct: 124 GLNLDILKR-LEDTFDILITVDTGISAINEIEYLKQKGKIVIVTDHHEPKDKLPIADAII 182

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP R D       L   GV F       ++L       L   L   LD+VA+ T+ DV+P
Sbjct: 183 NPKRRDSTYPFRDLAGVGVAF-------KLLHALKLSGLEIKLSKYLDIVAIGTIADVMP 235

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP--ITAENLGYMIGPSINAGGRIGE 313
           L+  NR +   GL + +   N GLK LIE   +SS   +   ++ ++IGP +NA GRI +
Sbjct: 236 LVDENRIFAKFGLKLLKYTRNIGLKKLIEVAGLSSKEELKPFDVSFIIGPRLNAAGRISD 295

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +NL   LL+SD   E E +A +LD  N+ R+ +E   +++A+ K++T   DI +  + V+
Sbjct: 296 ANLAMSLLLSDSLVEAEKIARRLDEENRKRQEIEEKTIKEAQ-KIITLNKDILRKKIFVL 354

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WHPG+VG+ ++++ EK+ RPS   +F ++G   GSGRSI+GF++ + +    +  I
Sbjct: 355 SSQSWHPGVVGIASSKITEKYYRPSLLFTFTDEGILKGSGRSIKGFNLFEALKNCSD--I 412

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+K GGH  AAGL++   NF +L +     A      +I  P  +ID VL+ + ++  LI
Sbjct: 413 LLKFGGHEHAAGLSLVSDNFDKLDEILNAIAQE-YHFMIFKPAVEIDLVLSLNEIDDELI 471

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           D +    P+G GNP P F   N  +++ R +   +    F + +      + F    + L
Sbjct: 472 DQVYLLEPFGVGNPEPTFLIKNIIVENFRFMGEDNKYYKFFTGNGTKYDVVCF----SNL 527

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            +       K++ +   L  N +  ++R Q  ++D
Sbjct: 528 EDEDELVTMKKVDIVCKLEKNIFNSTRRNQFNLID 562


>gi|322807073|emb|CBZ04647.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum H04402 065]
          Length = 593

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 190/587 (32%), Positives = 305/587 (51%), Gaps = 46/587 (7%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I  K  I + +  VLVNR + +++  KDFL PS+  L  +PL++ D DK    I ++I +
Sbjct: 17  IANKSGISETLCTVLVNREIYNLEDIKDFLEPSLEKLY-NPLLMKDMDKGTEIIKRSIID 75

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            +KI I+GDYD DG  S  ++   L  C  N   YIPDR  +GYG     +E+   EG +
Sbjct: 76  KKKIAIYGDYDADGVTSTVILYIALKECEANVIYYIPDRETEGYGMCTERVERLKAEGVE 135

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQV-----KSEE----IP-AYALVNPNRLD 201
           +IIT D G  + + ++ A   G+ V++ DHH++     + EE    +P A A++NP + D
Sbjct: 136 VIITCDNGIAALEQVERAKELGMTVVITDHHELPFIENEKEEREYVVPKADAIINPKQKD 195

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNR 261
                  LC AG+ F    L+Y  L   N  P  +    LL   A+ T+CDVV L G NR
Sbjct: 196 CYYPFKMLCGAGIAFKFSKLLYEKL---NMNPNKYK--ELLQFAAIGTICDVVDLKGENR 250

Query: 262 AYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRL 320
                GL       N GL+ALI+  +++   IT+ N+G++IGP INA GR+  + L   L
Sbjct: 251 IIAKLGLESINNTNNLGLRALIKETSLNEKNITSYNVGFIIGPCINATGRLDTAALSVEL 310

Query: 321 LISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHP 380
            ++ D +  E LA +L  LN  R+  E  M+   E     +   ++   V+V+  +  H 
Sbjct: 311 FLAKDIKRAEKLAKELRNLNTERQ--EITMVGVEEITYTIENSSLKNDKVLVIYKENIHE 368

Query: 381 GIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGFDIGKMVSFAVEEGILVKGG 438
            I G+++ R+K+ + RP+  ++    GK +  GSGRSI+G+++ + +    E   + K G
Sbjct: 369 SIAGIVSGRIKDAYNRPTIVLT---KGKEMPKGSGRSIDGYNLFEELMKCKE--YIYKFG 423

Query: 439 GHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLES 498
           GH MAAGLT+E  N  +L +   K  +      I  P  +ID  L    VN+ LID L+ 
Sbjct: 424 GHPMAAGLTIEEKNIDKLREELNKNCNLKDEDFI--PTIRIDKRLALKEVNLELIDSLQC 481

Query: 499 AGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDS-ETLQAIAF--------- 546
             P+G GN +P+ A  N K++ IR++  +   L++T   +D+ + + AIAF         
Sbjct: 482 LEPFGKGNSSPILAEKNIKIEGIRILGKDQNTLKLTCRVEDTNKRIHAIAFGKVDEFKRD 541

Query: 547 --RVYGTPLGEFLMQS---RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              +Y     E ++ +    G ++ +  +  +N + G+   QLR++D
Sbjct: 542 LENIYEDENVENIITNPLMAGLKLDLIYYPMINEYNGNVYTQLRIID 588


>gi|293394607|ref|ZP_06638901.1| recombination protein J [Serratia odorifera DSM 4582]
 gi|291422916|gb|EFE96151.1| recombination protein J [Serratia odorifera DSM 4582]
          Length = 577

 Score =  274 bits (700), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 201/570 (35%), Positives = 298/570 (52%), Gaps = 38/570 (6%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           ++ R+   R V     +  L  S++ ++P  L L   D A   + QA+ +  +IMI GD+
Sbjct: 25  LLRRLYAQRGVQ---GEQELERSVKGMLPWQL-LDGIDAAVDILQQALADGRRIMIVGDF 80

Query: 102 DVDGAASVALMMRFLSHCSVNANMY-IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGS 160
           D DGA S AL +  L     N   Y +P+R  DGYG +P ++E+    GAQLI+TVD G 
Sbjct: 81  DADGATSTALTVLALRSMGGNNVQYLVPNRFEDGYGLSPEVVEQAATRGAQLIVTVDNGI 140

Query: 161 TSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVL 219
           +S+  ++ A  +G+ V+V DHH +  E +P A A+VNPN  +       L   GV F ++
Sbjct: 141 SSHAGVEVAHAKGMQVLVTDHH-LPGETLPAAEAIVNPNLRECAFPSKSLAGVGVAFYLM 199

Query: 220 VLIYRILRQ----DNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR-Q 274
           + +   LR     + +     +L  LLDLVAL TV DVVPL   NR  V +GL   R  +
Sbjct: 200 LALRARLRDSGWFEQRAMAMPNLAELLDLVALGTVADVVPLDANNRILVYQGLNRIRAGK 259

Query: 275 GNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLA 333
             PG++AL+E  N  +  + A +LG+ +GP +NA GR+ + ++G  LL+SDD  +  MLA
Sbjct: 260 CRPGVRALLEVANRDARQLAANDLGFALGPRLNAAGRLDDMSIGVALLLSDDIAQARMLA 319

Query: 334 MKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG-----DRWHPGIVGLLAA 388
             LD LNQ RR +E  M  Q EA  L  CD +++ S  +  G       WH G+VG+LA+
Sbjct: 320 NDLDALNQTRREIEQGM--QVEA--LQLCDQLERTSTTLPYGLAMYHPEWHQGVVGILAS 375

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF--AVEEGILVKGGGHAMAAGL 446
           R+KE+F RP  A +   DG   GSGRSI G  +   +     +  G+++K GGHAMAAGL
Sbjct: 376 RIKERFHRPVIAFAPAGDGILKGSGRSIAGLHMRDALERLDTLNPGLMLKFGGHAMAAGL 435

Query: 447 TVERVNFGRLCDFFQKF----AHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPY 502
           ++E   F    +F Q+F       + PA++   ++  DG L    + +   ++L   GP+
Sbjct: 436 SLEEARFD---EFRQRFGELVGEWLDPAMLEGVIWS-DGELAMQELTLETAELLREGGPW 491

Query: 503 GAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSR 561
           G   P P F      LQ  R+V   HL++  E       L  IAF V  T        S 
Sbjct: 492 GQAFPEPTFDGRFRILQQ-RLVGEKHLKLMVEPLGGGPLLDGIAFNVDTT----LWPDSS 546

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + + +   L VN +RG++  QL +    P
Sbjct: 547 VREVELAYKLDVNEFRGNRSVQLLIQHIWP 576


>gi|168333635|ref|ZP_02691895.1| single-stranded-DNA-specific exonuclease RecJ [Epulopiscium sp.
           'N.t. morphotype B']
          Length = 679

 Score =  274 bits (700), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 174/548 (31%), Positives = 281/548 (51%), Gaps = 22/548 (4%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           I+  +L  +N+     + FLNP I  L  DP  L D DKA  RI+ AI   ++I I+GDY
Sbjct: 19  IIDNILAAKNILDSDKESFLNPKIADLH-DPFALLDMDKAVIRILDAISQKQQITIYGDY 77

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           D DG  S +++  FL+      N YIP+R  +GYG N   +    +    LI+TVD G T
Sbjct: 78  DADGITSTSVLYMFLTEVGAKVNYYIPNRFTEGYGMNIDAILYLADNKTDLIVTVDNGIT 137

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
           +   + +A ++GIDVI+ DHHQ   +   A+ +VN  R +      +L   G+VF ++  
Sbjct: 138 AIAEVDFARSKGIDVIITDHHQCLDQIPDAHCIVNYKRPNCTYPSQNLAGVGIVFKLITA 197

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           I   L    K+ L   +   LDLV++ T+ D+VPL+  +R     GL +     NPGL+A
Sbjct: 198 IATTL----KLSLEEYVYKYLDLVSIGTIADMVPLLQESRVIASLGLKLITHTRNPGLRA 253

Query: 282 LIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           L+  +N +S PIT+  + + + P INA  R+ ++NL   L  + D+Q    LA  LD  N
Sbjct: 254 LLNIINKNSQPITSYTIAFQVAPRINAISRMSDANLAIELFTTQDTQRAATLAQLLDNNN 313

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
             R+  E+ ++  A   V     D+ +  V+V+ G  WH G++GL+A+++ + + RP+  
Sbjct: 314 IKRKAKEAEIVTAAFEYVKNNI-DLSKEKVLVITGTDWHHGVLGLVASKISQHYYRPTIV 372

Query: 401 ISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF 460
            + + D K +GS RSI+GF I   ++   ++  L+K GGH  AAGLT+         +  
Sbjct: 373 CTLDGD-KYVGSARSIDGFSIINAIT--EQQQYLIKYGGHTQAAGLTISASKIRNFTEDI 429

Query: 461 QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQS 520
            K  + I+   + TP   ID  +  S V I L + L +  P G  N +P+      K + 
Sbjct: 430 NKANYEILDKQLLTPKIYIDATVPLSEVTIDLYNSLSALEPCGQNNSSPILLV---KGKI 486

Query: 521 IRVVNLA----HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYW 576
            +++++     HL++  E  +++ L  I F      L  FL  ++G+ + + G +  N W
Sbjct: 487 SKIIHMGKRSEHLKIILED-NNKFLDVIIFS--QGQLSNFL--NKGEEVEIAGSISKNEW 541

Query: 577 RGSKRCQL 584
            G    Q 
Sbjct: 542 NGKTTIQF 549


>gi|52081241|ref|YP_080032.1| RecJ exonuclease [Bacillus licheniformis ATCC 14580]
 gi|52786621|ref|YP_092450.1| YrvE [Bacillus licheniformis ATCC 14580]
 gi|52004452|gb|AAU24394.1| RecJ exonuclease [Bacillus licheniformis ATCC 14580]
 gi|52349123|gb|AAU41757.1| YrvE [Bacillus licheniformis ATCC 14580]
          Length = 782

 Score =  274 bits (700), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 198/596 (33%), Positives = 300/596 (50%), Gaps = 43/596 (7%)

Query: 14  SGFRW-VSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           S  RW V    +E + +   +  +  I  + A +LV R   + D A  FL  +      D
Sbjct: 4   SKMRWDVQTPDKEKVEQ---LAGRLGITPLAASLLVMRGYDTADKASSFLYGN-DARFHD 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L D +KA RRI QAI + EKIMI+GDYD DG  S  ++++ L  CS  A+ YIPDR 
Sbjct: 60  PYLLKDMEKAVRRIKQAISDQEKIMIYGDYDADGVTSTTVLLQMLKKCSAQADFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN +        G  LIITVD G       + A   GID+I+ DHH+       A
Sbjct: 120 KEGYGPNEAAFRGIKESGYSLIITVDTGIAGVHEAEVAKELGIDLIITDHHEPGPVLPDA 179

Query: 192 YALVNPNRLDDLSGQGH----LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVAL 247
           YA+++P +     G G+    L   GV F +   +   L +D           LLDL A+
Sbjct: 180 YAIIHPKQ----PGCGYPFKELAGVGVAFKLAHALNGELPED-----------LLDLCAI 224

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKAL--IERVNISSPITAENLGYMIGPSI 305
            T+ D+VPL   NR    +G+   R+   PGLKAL  I    I +    E +G+ I P +
Sbjct: 225 GTIADLVPLHDENRQIAKRGMEQFRKTKRPGLKALAKIAGAEIHNA-DEETIGFQIAPRL 283

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NA GRI +++    LL ++D +E E LA  ++ LN+ R+ + + M E+A   +  +  D 
Sbjct: 284 NAVGRIEQADPAVYLLNTEDEREAEELAEDINALNKERQKIVNQMTEEAVQMIEEEGLD- 342

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGFDIGK 423
               VIVV    W+PG+VG++A++L E+F RP+  +  +E+ KGI  GS RSI+GFD+ +
Sbjct: 343 --QPVIVVARPGWNPGVVGIVASKLVERFYRPAIVLGVDEE-KGIAKGSARSIKGFDLFQ 399

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +S   +  IL   GGH MAAG+T+   +   L +   + A  ++      PV  +D   
Sbjct: 400 NLSECRD--ILPHFGGHPMAAGMTLNLEDVSALRERINRQAEAVLTEADFIPVQDVDLCC 457

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETL 541
               +++  I  +    P+G GNP P     + K+   R +  N  HL++   + D   L
Sbjct: 458 RLEDISVDSIAEMNLLAPFGTGNPKPFVLVSDVKIDDARKIGANKNHLKLVL-ADDGNKL 516

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
             I F  Y   + E ++   G ++ + G L +N W   K+ QL + DA+  E   F
Sbjct: 517 DCIGF--YKGDIEEGIVP--GAKISIVGELSINEWNNRKKPQLMIKDAAVNEWQLF 568


>gi|148380722|ref|YP_001255263.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum A str. ATCC 3502]
 gi|153930815|ref|YP_001385006.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum A str. ATCC 19397]
 gi|153936524|ref|YP_001388476.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum A str. Hall]
 gi|148290206|emb|CAL84325.1| single-stranded-DNA-specific exonuclease [Clostridium botulinum A
           str. ATCC 3502]
 gi|152926859|gb|ABS32359.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum A str. ATCC 19397]
 gi|152932438|gb|ABS37937.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum A str. Hall]
          Length = 593

 Score =  273 bits (699), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 190/587 (32%), Positives = 305/587 (51%), Gaps = 46/587 (7%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I  K  I + +  VLVNR + +++  KDFL PS+  L  +PL++ D DK    I ++I +
Sbjct: 17  IANKSGISETLCTVLVNREIYNLEDIKDFLEPSLEKLY-NPLLMKDMDKGTEIIKRSIID 75

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            +KI I+GDYD DG  S  ++   L  C  N   YIPDR  +GYG     +E+   EG +
Sbjct: 76  KKKIAIYGDYDADGVTSTVILYIALKECEANVIYYIPDRETEGYGMCTERVERLKAEGVE 135

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQV-----KSEE----IP-AYALVNPNRLD 201
           +IIT D G  + + ++ A   G+ V++ DHH++     + EE    +P A A++NP + D
Sbjct: 136 VIITCDNGIAALEQVERAKELGMTVVITDHHELPFIENEKEEREYVVPKADAIINPKQKD 195

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNR 261
                  LC AG+ F    L+Y  L   N  P  +    LL   A+ T+CDVV L G NR
Sbjct: 196 CYYPFKMLCGAGIAFKFSKLLYEKL---NMNPNKYK--ELLQFAAIGTICDVVDLKGENR 250

Query: 262 AYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRL 320
                GL       N GL+ALI+  +++   IT+ N+G++IGP INA GR+  + L   L
Sbjct: 251 IIAKLGLESINNTNNLGLRALIKETSLNEKNITSYNVGFIIGPCINATGRLDTAALSVEL 310

Query: 321 LISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHP 380
            ++ D +  E LA +L  LN  R+  E  M+   E     +   ++   V+V+  +  H 
Sbjct: 311 FLAKDIKRAEKLAKELRNLNTERQ--EITMVGVEEITYAIENSSLKNDKVLVIYKENIHE 368

Query: 381 GIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGFDIGKMVSFAVEEGILVKGG 438
            I G+++ R+K+ + RP+  ++    GK +  GSGRSI+G+++ + +    E   + K G
Sbjct: 369 SIAGIVSGRIKDAYNRPTIVLT---KGKEMPKGSGRSIDGYNLFEELMKCKE--YIYKFG 423

Query: 439 GHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLES 498
           GH MAAGLT+E  N  +L +   K  +      I  P  +ID  L    VN+ LID L+ 
Sbjct: 424 GHPMAAGLTIEEKNINKLREELNKNCNLKDEDFI--PKIRIDKRLALKEVNLELIDSLQC 481

Query: 499 AGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDS-ETLQAIAF--------- 546
             P+G GN +P+ A  N K++ IR++  +   L++T   +D+ + + AIAF         
Sbjct: 482 LEPFGKGNSSPILAEKNIKIEGIRILGKDQNTLKLTCRVEDTNKRIHAIAFGKVDEFKRD 541

Query: 547 --RVYGTPLGEFLMQS---RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              +Y     E ++ +    G ++ +  +  +N + G+   QLR++D
Sbjct: 542 LENIYEDENVENIITNPLMAGLKLDLIYYPMINEYNGNVYTQLRIID 588


>gi|91202780|emb|CAJ72419.1| similar to exonuclease RecJ [Candidatus Kuenenia stuttgartiensis]
          Length = 577

 Score =  273 bits (698), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 190/580 (32%), Positives = 303/580 (52%), Gaps = 20/580 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLIL 75
           RW   +    I     I     I +++A++L+NR ++ +  AK FL P I  L  DP  L
Sbjct: 4   RW--FIAPNNIELQTEIAGNLRISNLLAQILINRGITDVGAAKGFLQPQISTL-SDPSNL 60

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D +KA+ RI +AI N EKI+I+GDYDVDG  + ALM R L       N YIP+R+ +GY
Sbjct: 61  PDIEKASVRINEAIRNGEKIVIYGDYDVDGLTATALMYRCLKMFDARVNYYIPERLEEGY 120

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYAL 194
           G N   + K    G  LI+TVDCG ++    + A + GI++I+ DHHQ  S+EIP A+A+
Sbjct: 121 GLNAEAIAKLKAGGTDLILTVDCGISACREAEIARSYGIELIITDHHQ-PSQEIPDAFAI 179

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLSLLDLVALATVCD 252
           +NP               G+ F++   + +      KV   F   L+S + LVAL T+ D
Sbjct: 180 INPKLKATEKTFRDFSGVGIAFMLAWSVGQHYFPQKKVSNEFKDFLISAMGLVALGTIAD 239

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRI 311
           VVPL+G NR     GL   ++   PGL+AL+E  ++++  +   ++GY +GP INA GR+
Sbjct: 240 VVPLVGENRILTKYGLGALQQTKIPGLQALLEVSSLTNINLDTSHVGYRLGPRINAPGRV 299

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
            ++ +   +L +  +++ + +A+ L+  N  RR M+  +L  A  K++ +  ++ +   I
Sbjct: 300 SDAGVVVEMLTTACNEKAKEIALFLEEENNRRRAMQLDILSAARQKIVDEI-NLDETLAI 358

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V+    WHPGIVG++A+++ E+F RP+  I+   D  G GS RSI  F +  + +    +
Sbjct: 359 VLADQEWHPGIVGIIASKIAEEFNRPAVMIAV-ADEIGHGSARSIPSFHM--LDALECCK 415

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L+  GGHA AAGL +   N G       +     +      P   ID  ++ S +N  
Sbjct: 416 NMLISVGGHAQAAGLKIHPDNIGDFRTLLNRMMAQKLQKEDLVPFLNIDVAVDLSTLNRG 475

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKL--QSIRV-VNLAHLQMTFESQDSETLQAIAFRV 548
           L+  L+   P+G GN  PVFA  + ++  +  R+  N  HL   +  Q + +++AI F +
Sbjct: 476 LLMELQLLSPHGEGNHIPVFAIKDLQIAGKPRRIGSNGQHLSF-YVKQGNVSMKAIGFGM 534

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            G  +   L       + V   L  N W  +   +L V D
Sbjct: 535 -GDEIDRLLKNGSTCSLAVV--LKENNWMNNSSIELEVKD 571


>gi|217076672|ref|YP_002334388.1| single-stranded DNA-specific exonuclease [Thermosipho africanus
           TCF52B]
 gi|217036525|gb|ACJ75047.1| single-stranded DNA-specific exonuclease [Thermosipho africanus
           TCF52B]
          Length = 975

 Score =  273 bits (698), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 163/527 (30%), Positives = 299/527 (56%), Gaps = 23/527 (4%)

Query: 27  INRALA--ITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAAR 83
            N+ LA  I+++ ++P + +++LV R  +  +  + FL PS + L   P +L D DKA R
Sbjct: 8   FNKELAQKISEELSLPFLTSQLLVTRGYTDFEEIEKFLYPSKKHLRS-PFLLKDMDKAVR 66

Query: 84  RIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLME 143
            +++A      + ++GDYDVDG   VA ++ FLS      + YIP+R+ +GYG  P ++E
Sbjct: 67  YLLEAREKKLPVFVYGDYDVDGITGVATLVTFLSKYGWKVDYYIPNRLDEGYGIQPQVVE 126

Query: 144 KFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDL 203
           ++  +G +++++VDCG TS++A++ A   G+ VI+ DHH +K +   A+A+V+P R D+ 
Sbjct: 127 EYFKKGYRVLLSVDCGITSFEAVEKARELGMYVIITDHHTIKDKIPEAHAVVDPKREDET 186

Query: 204 SGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAY 263
                    GV + ++  +     Q+  +P + ++  +LD+VAL T+ D+V L+  NR  
Sbjct: 187 YPFRDFAGVGVAYKLISAV----AQELGIPGD-EVDEVLDIVALGTIADMVDLVDENRYI 241

Query: 264 VVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLIS 323
           V +GL         GL  L++++NI++ I+++++GY + P +NA GR+  +    +L+++
Sbjct: 242 VKEGLKRLNATNRIGLLQLMKKLNITN-ISSQDIGYRLAPKLNAAGRLYSAEDAYKLIMT 300

Query: 324 DDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIV 383
           D+    E LA  L   N  R+ +E+ + ++A  K+  +   I+   +++V GD WH G++
Sbjct: 301 DNISSAEQLAEMLMGYNFTRQEIENKIFKEAIEKI--EHSKIKDLPILIVSGDNWHAGVL 358

Query: 384 GLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS-FAVEEGILVKGGGHAM 442
           G++A +L +K+ +PS  +S  E+G G GSGRS++G +I +++S FA       + GGH M
Sbjct: 359 GIVATKLVQKYNKPSLVVSL-ENGIGRGSGRSVDGVNILEVLSDFA---SYFEEFGGHPM 414

Query: 443 AAGLTVERVNFGRLCD-FFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGP 501
           A G +++      L +   +KF +            +ID +L    +N  +ID L    P
Sbjct: 415 AIGFSIKNEKIPELIEAISEKFGNTFFEV---DSKIEIDSILEVDDINDEIIDSLRYLEP 471

Query: 502 YGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAF 546
           +G GNP PVF   +  +  IR      ++++M  + ++ +T++ I F
Sbjct: 472 FGHGNPEPVFLIKDSIVDRIRFFGNTNSNVRMILKGKNKQTVEGIGF 518


>gi|304436592|ref|ZP_07396561.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
 gi|304370288|gb|EFM23944.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
          Length = 671

 Score =  273 bits (698), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 174/567 (30%), Positives = 294/567 (51%), Gaps = 31/567 (5%)

Query: 32  AITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           A+  +  +  I+ ++L  R + + + A+ FL+P+      DP ++ D ++ A R++ A+ 
Sbjct: 25  ALAAEIGVTSIIGQLLWQRGIRTAEEARAFLHPADTPFH-DPFLMADMERGAERVLCAVR 83

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
             E I+I+GDYDVDG  + AL+MR +     N + YIP+R  +GYG N   +++   EG 
Sbjct: 84  RDEPIVIYGDYDVDGMTATALLMRSIRTLGGNVSYYIPNRFTEGYGLNADALQQIAGEGC 143

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
           +L++TVDCG  S D +  A   G+D+++ DHH       PAYA++NP+R D    + +L 
Sbjct: 144 RLLVTVDCGIASVDTVAEAAG-GMDIVITDHHLPGQMLPPAYAVMNPHRADCAYPEKNLA 202

Query: 211 AAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
             GV F ++  ++++ R+++           LD+ AL TV D+VPL+G NR  V  GL  
Sbjct: 203 GVGVAFKLVQALWQMERKES-------FAEYLDIAALGTVADLVPLVGENRKIVQMGLRQ 255

Query: 271 ARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQEL 329
                  G++ALIE   ++   I    +G+ + P +NA GR+  +  G+ LL+++D+   
Sbjct: 256 MAEHPCVGIRALIEVAGLADKSINTGQVGFQLAPRLNAAGRLETARHGAELLLTEDTACA 315

Query: 330 EMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAAR 389
             +A +L+ LN  RR +E  +L +AE ++     D+     IVV G+ W+ G++G++A+R
Sbjct: 316 SRMAGELNALNTERRDLEQDILAEAERQLADFTPDV---PAIVVAGEEWNAGVIGIVASR 372

Query: 390 LKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
           L EK+ RPS  ++  +D    GS RSI G  + + +S   +   L++ GGHAMAAGLT  
Sbjct: 373 LVEKYYRPSIVLTRLDDVYK-GSCRSIAGLHLYESLSACRD--TLIQFGGHAMAAGLT-- 427

Query: 450 RVNFGRLCDFFQKFAHNIVPALITT---PVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
            ++  RL DF + F+  +   L      P   +  +   +   +  ++ L    PYG GN
Sbjct: 428 -LSCERLSDFRRAFSEVVRTRLTAQDFIPKVAVSALAAPADWTVETVEELALLEPYGMGN 486

Query: 507 PNPVFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKR 564
           P P+F   N + Q    +     HL+M   +++       A       L   L +     
Sbjct: 487 PRPIFGVRNVRPQKASSIGAEGKHLRMDIGTREH---HITALYWNAGDLATVLTEEDSDL 543

Query: 565 MHVTGHLCVNYWRGSKRCQLRVLDASP 591
            +  G   +N W+G +  Q  V   +P
Sbjct: 544 AYTPG---INEWQGERSVQCMVDTVTP 567


>gi|307297759|ref|ZP_07577565.1| single-stranded-DNA-specific exonuclease RecJ [Thermotogales
           bacterium mesG1.Ag.4.2]
 gi|306917019|gb|EFN47401.1| single-stranded-DNA-specific exonuclease RecJ [Thermotogales
           bacterium mesG1.Ag.4.2]
          Length = 1047

 Score =  273 bits (698), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 187/542 (34%), Positives = 291/542 (53%), Gaps = 32/542 (5%)

Query: 25  EGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLILTDCDKAAR 83
           E +NR   + +   I   +AR+LV R +  +  A  FLNP  + ++ DP +L D   A R
Sbjct: 13  EAVNR---LVEFMGIDAFLARLLVTRGIDNEVEAMKFLNPD-KTILHDPFLLEDMPLAVR 68

Query: 84  RIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLME 143
            I++    +E I++FGDYDVDG  S AL+   +     N + YIP R+ +GYG +   ++
Sbjct: 69  TIIETRDRNESIVVFGDYDVDGVTSTALLYLAMKRMGFNVSYYIPLRLEEGYGLSKDAIK 128

Query: 144 KFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDL 203
              ++G  L+ITVDCG TS+D +++A   G +V+V DHH+VK    PA A+VNP R DD 
Sbjct: 129 DLRDQGHSLLITVDCGVTSFDEIKFAKEIGFNVVVTDHHEVKDLLPPADAVVNPKRPDDD 188

Query: 204 SGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAY 263
                L   GV F +LV +   L      P+  D    LD+VAL T+ D+VPL   NR  
Sbjct: 189 YPFKGLAGVGVAFKLLVALNETLH----CPI--DPEEYLDIVALGTIADIVPLRDENRYI 242

Query: 264 VVKGLMVARRQGNP--GLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRL 320
           V +G   A+ Q +P  GLKAL+  + I S  +TA+++ + I P +NA GR+  + +   L
Sbjct: 243 VKEG--TAKIQSSPLLGLKALLSYLRIPSENLTAQDIAFKIAPKLNAAGRMDSAIVALEL 300

Query: 321 LISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHP 380
           LIS+D       A +L   NQNR+ +E+ + EQ E + L      +    +V++GD WH 
Sbjct: 301 LISEDMDSAMNTASRLLKHNQNRQTIEAKIFEQTE-RDLENTASFKDDFALVIDGDNWHL 359

Query: 381 GIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGG 439
           G++G++A+RL     +P F I+    DGK  GS RS  G  I  +++     G+L + GG
Sbjct: 360 GVLGIVASRLVSIHNKPVFLIATNGSDGK--GSARSPAGVSIISLLNEV--SGLLREFGG 415

Query: 440 HAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL-ITTPVFKI--DGVLNASAVNIALIDML 496
           H MAAG ++++    ++ +F        +    +  PVFKI  D VL   ++  +++D L
Sbjct: 416 HEMAAGFSIDK---EKISEFRSAINDAYIKLYGLKQPVFKIDVDDVLTLDSITPSILDKL 472

Query: 497 ESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLG 554
           E   P+G  NP P F      ++  ++      H+++   S D +TL AI + + GT   
Sbjct: 473 ELLRPFGHSNPEPKFLIKGLNIEKAKMFGSGSDHVKLILRSGDRKTL-AIGYNM-GTMFD 530

Query: 555 EF 556
           +F
Sbjct: 531 DF 532


>gi|168180830|ref|ZP_02615494.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum NCTC 2916]
 gi|226950176|ref|YP_002805267.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum A2 str. Kyoto]
 gi|182668251|gb|EDT80230.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum NCTC 2916]
 gi|226843610|gb|ACO86276.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum A2 str. Kyoto]
          Length = 593

 Score =  273 bits (697), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 190/587 (32%), Positives = 305/587 (51%), Gaps = 46/587 (7%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I  K  I + +  VLVNR + +++  KDFL PS+  L  +PL++ D DK    I ++I +
Sbjct: 17  IANKSGISETLCTVLVNREIYNLEDIKDFLEPSLEKLY-NPLLMKDMDKGTEIIKRSIID 75

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            +KI I+GDYD DG  S  ++   L  C  N   YIPDR  +GYG     +E+   EG +
Sbjct: 76  KKKIAIYGDYDADGVTSTVILYIALKECEANVIYYIPDRETEGYGMCTERVERLKAEGVE 135

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQV-----KSEE----IP-AYALVNPNRLD 201
           +IIT D G  + + ++ A   G+ V++ DHH++     + EE    +P A A++NP + D
Sbjct: 136 VIITCDNGIAALEQVERAKELGMTVVITDHHELPFIENEKEEREYVVPKADAIINPKQKD 195

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNR 261
                  LC AG+ F    L+Y  L   N  P  +    LL   A+ T+CDVV L G NR
Sbjct: 196 CYYPFKMLCGAGIAFKFSKLLYEKL---NMNPNKYK--ELLQFAAIGTICDVVDLKGENR 250

Query: 262 AYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRL 320
                GL       N GL+ALI+  +++   IT+ N+G++IGP INA GR+  + L   L
Sbjct: 251 IIAKLGLESINNTNNLGLRALIKETSLNEKNITSYNVGFIIGPCINATGRLDTAALSVEL 310

Query: 321 LISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHP 380
            ++ D +  E LA +L  LN  R+  E  M+   E     +   ++   V+V+  +  H 
Sbjct: 311 FLAKDIKRAEKLAKELRNLNTERQ--EITMVGVEEITYAIENSSLKNDKVLVIYKENIHE 368

Query: 381 GIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGFDIGKMVSFAVEEGILVKGG 438
            I G+++ R+K+ + RP+  ++    GK +  GSGRSI+G+++ + +    E   + K G
Sbjct: 369 SIAGIVSGRIKDAYNRPTIVLT---KGKEMPKGSGRSIDGYNLFEELMKCKE--YIYKFG 423

Query: 439 GHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLES 498
           GH MAAGLT+E  N  +L +   K  +      I  P  +ID  L    VN+ LID L+ 
Sbjct: 424 GHPMAAGLTIEEKNIDKLREELNKNCNLKDEDFI--PKIRIDKRLALKEVNLELIDSLQC 481

Query: 499 AGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDS-ETLQAIAF--------- 546
             P+G GN +P+ A  N K++ IR++  +   L++T   +D+ + + AIAF         
Sbjct: 482 LEPFGKGNSSPILAEKNIKIEGIRILGKDQNTLKLTCRVEDTNKRIHAIAFGKVDEFKRD 541

Query: 547 --RVYGTPLGEFLMQS---RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              +Y     E ++ +    G ++ +  +  +N + G+   QLR++D
Sbjct: 542 LENIYEDENVENIITNPLMAGLKLDLIYYPMINEYNGNVYTQLRIID 588


>gi|229543714|ref|ZP_04432774.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus coagulans
           36D1]
 gi|229328134|gb|EEN93809.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus coagulans
           36D1]
          Length = 787

 Score =  273 bits (697), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 187/565 (33%), Positives = 288/565 (50%), Gaps = 29/565 (5%)

Query: 30  ALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQA 88
           A  I+Q+  +  +V+++LVNR ++ ++ A+ FL     L   DP +L D +KAA RI +A
Sbjct: 18  AATISQQLNVSPLVSKLLVNRGITDVEEARSFLFHE-GLAYYDPFLLHDMEKAAARIREA 76

Query: 89  IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE 148
           I   E +++FGDYD DG  S A+MM  L+    +A  YIPDR  +GYGPN +   +   E
Sbjct: 77  IKKEEPVLVFGDYDADGVTSTAIMMAALNDLGAHAEFYIPDRFKEGYGPNEAAFRRAAEE 136

Query: 149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGH 208
           G QLIITVD G  +    + A   GI +I+ DHH+       A+A+V+P   +       
Sbjct: 137 GFQLIITVDTGIAAVHEAEVARELGITLIITDHHEPGPVLPEAFAIVHPKHPESTYPFRE 196

Query: 209 LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGL 268
           L  AGV F V   +Y       KVP   +     DL A+ TV D+VPL+  NR   + G+
Sbjct: 197 LSGAGVAFKVAHALY------GKVPEQLE-----DLAAIGTVADLVPLLDENRLIAINGI 245

Query: 269 MVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQ 327
              R     GL AL    +I    I  E +G+++ P +NA GR+  +   + LL+++D++
Sbjct: 246 KRLRTTKRAGLVALCRCADIRQEEINEETIGFVLAPRLNAAGRLQHAAPAAELLMTEDTE 305

Query: 328 ELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLA 387
           E  MLA  +D LN+ R+ + + M  +A   V  + +  + A V+VV  + W+ G++G+ A
Sbjct: 306 EAGMLAETIDGLNKERQKIVNDMTNEAIELVEEEVE--KGARVLVVGKEGWNAGVIGIAA 363

Query: 388 ARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGL 446
           +RL E+F RP+  +SF+ E G   GS RSI+GF +   +S   +  IL   GGH MAAG+
Sbjct: 364 SRLTERFYRPAIVLSFDPETGLAKGSARSIDGFHMFNELSKCRD--ILPHFGGHPMAAGM 421

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           T+   +   L     + A  + P  +  PV  I   ++     +  I  +    P+G  N
Sbjct: 422 TLSLSDVEELRRRLNEQAAAL-PDEMFVPVTNISAEISIEEAGMEAIREMALLSPFGTAN 480

Query: 507 PNPVFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGK 563
           P P+      +   IR +     HL++T  S++  TL  I F      LG      S   
Sbjct: 481 PKPLLLLDGAECPQIRAIGADGKHLKLTL-SKNGTTLDGIGFG-----LGHLAPHISPSA 534

Query: 564 RMHVTGHLCVNYWRGSKRCQLRVLD 588
            + V G L +N W   ++ Q+ V D
Sbjct: 535 CISVVGELSINEWNNIRKPQMMVKD 559


>gi|312134593|ref|YP_004001931.1| single-stranded-DNA-specific exonuclease recj [Caldicellulosiruptor
           owensensis OL]
 gi|311774644|gb|ADQ04131.1| single-stranded-DNA-specific exonuclease RecJ [Caldicellulosiruptor
           owensensis OL]
          Length = 798

 Score =  273 bits (697), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 172/552 (31%), Positives = 295/552 (53%), Gaps = 22/552 (3%)

Query: 40  PDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           P I+ +VL NR V   +  + FLNPS++ L  +P +L D  +A + I QAI +  +++I+
Sbjct: 30  PQII-KVLNNRGVQEREEIEKFLNPSLKNLH-NPFLLNDMKEAVKIISQAILHRSRVLIY 87

Query: 99  GDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDC 158
           GDYD DG  S  L+   L +  +    YIP+R  DGYG N  +++K + +   ++ITVD 
Sbjct: 88  GDYDCDGVTSTYLLYSNLRNF-LPTTYYIPNRFKDGYGLNLDVLKK-LEDKFDILITVDT 145

Query: 159 GSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLV 218
           G +S++ ++Y   +G  VI+ DHH+ K     A A++NP R D +     L   GV F  
Sbjct: 146 GISSHNEIKYLKEKGKTVIITDHHEPKEVLPDADAVINPKRKDSIYPFRDLAGVGVAF-- 203

Query: 219 LVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPG 278
                ++L       +N  L   LD+VA+ T+ DV+PL+  NR     GL + +   N G
Sbjct: 204 -----KLLHALKSSGINLKLSEYLDVVAIGTIADVMPLVDENRVLAKFGLKILKNTKNVG 258

Query: 279 LKALIERVNISSP--ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           LK LIE   +SS   +   ++ ++IGP +NA GRI ++NL   LL+  D+ + E +A +L
Sbjct: 259 LKKLIEVAGLSSKEELKPYDVSFIIGPRLNAAGRISDANLAVSLLLEKDAIKAESIAKRL 318

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           D  N+ R+ +E   +++A+  ++     I +  + V+    WH G+VG+ ++++ EK+ R
Sbjct: 319 DEENRKRQEIEEKTIKEAQG-LIVNNKSILKKKIFVLSNSSWHAGVVGIASSKITEKYYR 377

Query: 397 PSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRL 456
           PS  ++  ++G   GSGRSI+GF++ + +    E  IL+K GGH  AAGL++   N  +L
Sbjct: 378 PSLLLTLADEGVLKGSGRSIKGFNLFEALRNCAE--ILLKFGGHEHAAGLSLPVDNVDKL 435

Query: 457 CDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNH 516
            +     A +    +I  P  ++D VL+ + ++  LID +    P+G GNP P F   N 
Sbjct: 436 DEILNSIAQD-YHFMIFKPAIEVDLVLSLNEIDDELIDQVYLLEPFGVGNPEPTFLIKNL 494

Query: 517 KLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYW 576
            +++ R +   +    F + +S     + F    + L +       K++ +   L  N++
Sbjct: 495 VVENFRFMGDGNKYYKFFTGNSTKYDVVCF----SNLEDEDELVSMKKVDIVCKLEKNFF 550

Query: 577 RGSKRCQLRVLD 588
              ++ Q  ++D
Sbjct: 551 NSVRKNQFNIID 562


>gi|212638568|ref|YP_002315088.1| Single-stranded DNA-specific exonuclease RecJ [Anoxybacillus
           flavithermus WK1]
 gi|212560048|gb|ACJ33103.1| Single-stranded DNA-specific exonuclease RecJ [Anoxybacillus
           flavithermus WK1]
          Length = 789

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 187/571 (32%), Positives = 297/571 (52%), Gaps = 31/571 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I Q   I  +VA +LV+R   +++ A+ F     +     P +L D +KA  RI +AI N
Sbjct: 24  IAQALHITPLVASLLVSRGYHTVEAARSFFER--KQSFHSPFLLNDMEKAVERIEKAITN 81

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            E I++FGDYD DG +S  +M+  L     N + YIP+R  +GYGPN         +G  
Sbjct: 82  DEHILVFGDYDADGVSSTVVMVSALREKGANVSFYIPNRFTEGYGPNEQAFRLAKQQGVS 141

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           LIITVD G ++      A   GID+I+ DHH+       AYA ++P ++       HL  
Sbjct: 142 LIITVDTGISALHEANVAKQLGIDLIITDHHEPGPVLPEAYATIHP-KISPNYPFKHLAG 200

Query: 212 AGVVF-LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
            GV F L   LI R       VP  +     LD+VA+ T+ D+VPL   N      G+  
Sbjct: 201 VGVAFKLAHALIGR-------VPYEW-----LDVVAIGTIADLVPLQDENHLLARLGIEQ 248

Query: 271 ARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQEL 329
            R+    GL+AL ++  +S + +T + + +MIGP +NA GR+  ++   +LL++ D+ E 
Sbjct: 249 FRQTNRLGLQALCKQCGVSHTAVTEDTIAFMIGPRVNAAGRLDCADPAVQLLLTTDAHEA 308

Query: 330 EMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAAR 389
           +MLA ++D +N+ R+ + + + E+A   V     D     V+VV  + W+ G++G++A+R
Sbjct: 309 DMLAEQIDAMNRERQQLVNEITEEAIQLVEQHYRD---DRVLVVAKEGWNVGVIGIVASR 365

Query: 390 LKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTV 448
           L EKF RP+  +S  +E G   GS RSIEGFD+   +S      IL   GGH MAAG+T+
Sbjct: 366 LVEKFYRPTIVLSIDQEKGIAKGSARSIEGFDLFANLSNC--RDILPHFGGHPMAAGMTL 423

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
              +   L     + A   +      P+  ID   + S V++ LI+ +    P+G GNP 
Sbjct: 424 SFHDVDELRRRLNEAAEQQLTDEHFIPITHIDLCCSISDVSLELIEQMNRLAPFGMGNPK 483

Query: 509 PVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMH 566
           P   F + +L ++R +  +  HL++   +++ +TL+AI F  +G    E    +   R+ 
Sbjct: 484 PRVLFQHVQLDTLRKIGTDQNHLKLLL-AEEGKTLEAIGFG-FGNIGDEI---APNVRLS 538

Query: 567 VTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
           + G L +N W   ++ QL + D +  E   F
Sbjct: 539 IVGELAINEWNNFRKPQLMIQDIAVNEWQLF 569


>gi|310766539|gb|ADP11489.1| ssDNA exonuclease RecJ [Erwinia sp. Ejp617]
          Length = 572

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 194/524 (37%), Positives = 280/524 (53%), Gaps = 27/524 (5%)

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVAL-MMRFLSHCSVNANMYIPDRIVD 133
           L+  +KA   +  A+ +++ IMI GD+D DGA S AL ++      + N    +P+R  D
Sbjct: 54  LSGIEKAVTLLQHALADNQCIMIVGDFDADGATSTALAVLSLRGMGAQNVKYLVPNRFDD 113

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AY 192
           GYG +P ++E+    GAQLI+TVD G +S   +  A  +GI V+V DHH +  E +P A 
Sbjct: 114 GYGLSPEVVEQAAARGAQLIVTVDNGISSLAGVALAHQKGIAVVVTDHH-LPGEILPDAD 172

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD--NKVPLNFDLLSLLDLVALATV 250
           A+VNPN  D       L   GV F +++ +   LR    N +P   +L  LLDLVAL TV
Sbjct: 173 AIVNPNLSDCAFPSRALAGVGVAFYLMLALRARLRDGGVNGLP---NLAELLDLVALGTV 229

Query: 251 CDVVPLIGLNRAYVVKGLMVARR-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAG 308
            DVVPL   NR  V +GL   R  +  PG++AL+E  N  +  + A +LG+ +GP +NA 
Sbjct: 230 ADVVPLDANNRILVWQGLSRIRAGKCRPGIRALLEVANRDARQLAASDLGFALGPRLNAA 289

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+ + ++G  LL+S+D  +  MLA +LD LNQ R+ +E  M  Q+EA  LT C+ ++  
Sbjct: 290 GRLDDMSVGVALLLSEDLGQARMLASELDALNQTRKEIEQGM--QSEA--LTLCNRLEST 345

Query: 369 SV-----IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           S      I +    WH G+VG+LA+RLKE+F RP  A +   DG   GSGRSI G  +  
Sbjct: 346 SEALPLGIAMYHPEWHQGVVGILASRLKERFHRPVIAFAPAGDGMLKGSGRSITGLHMRD 405

Query: 424 MVSF--AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           ++     +  G++VK GGHAMAAGL++E   F      F     + + A     V   DG
Sbjct: 406 VLERLDTLHPGLIVKFGGHAMAAGLSLEEAKFDEFRQRFADLVGDWLDAESLQGVVWSDG 465

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET- 540
            L A  + +   ++L  AGP+G   P P F     KL   R+V   HL++  E     T 
Sbjct: 466 ELMAQELTLPTAELLREAGPWGQAFPEPTFD-GKFKLLQQRLVGERHLKVMIEPLGGGTL 524

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
           L  IAF V              K++ +   L VN +RG++  QL
Sbjct: 525 LDGIAFNVDTA----LWPDPSVKQVELAYRLDVNEFRGTRSVQL 564


>gi|154496366|ref|ZP_02035062.1| hypothetical protein BACCAP_00654 [Bacteroides capillosus ATCC
           29799]
 gi|150274449|gb|EDN01526.1| hypothetical protein BACCAP_00654 [Bacteroides capillosus ATCC
           29799]
          Length = 689

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 189/573 (32%), Positives = 293/573 (51%), Gaps = 34/573 (5%)

Query: 30  ALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQA 88
           A A  +   +P + A VL  R + +++ AKDFL     LL  DP ++ D D+A  RI  A
Sbjct: 15  AQAAMEADGVPPLAASVLCARGLDTVEKAKDFLRSDEDLLW-DPFLMKDMDRAVSRIAAA 73

Query: 89  IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE 148
           +  +E I ++GDYDVDG  S  L+  +L         YIPDR+ +GYG + S +     +
Sbjct: 74  LDQNEHIAVYGDYDVDGITSTCLLTDYLRSRGAKVTPYIPDRMEEGYGLSCSAVSALHAK 133

Query: 149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGH 208
           G  LIITVDCG T+    ++A + GIDV++ DHH+ K     A A+V+P+R D      H
Sbjct: 134 GVSLIITVDCGITAVAEAEFAASLGIDVVITDHHECKDRIPTAAAVVDPHRRDCGYPFKH 193

Query: 209 LCAAGVVF-LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKG 267
           L   GV   LVL L        +K   +  L    DL A+ TV DV+ ++G NR  +  G
Sbjct: 194 LAGVGVALKLVLAL-------GDKTEESALLRRYADLAAVGTVADVMQVVGENRTIIRMG 246

Query: 268 LMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDS 326
           L   +    PGL+AL+    ++  P+T+ ++GY + P INA GR+G + L + LL++ D 
Sbjct: 247 LAALKNTVRPGLRALLHEAGLTERPLTSVSIGYTLAPRINASGRMGCAGLAAELLLTSDP 306

Query: 327 QELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLL 386
              E LA +L  LN+ R+ +E  + E+  A       + + A V+  EG  WH G+VG++
Sbjct: 307 ARGEALARELCALNRERQAVELDIYEECVAMADAMRPEDRPALVLAREG--WHQGVVGIV 364

Query: 387 AARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI--LVKG-GGHAMA 443
           A+RL EK+  P+F I   +DGKG GS RS  GF++     FA  E    L++G GGH +A
Sbjct: 365 ASRLSEKYSCPTFMICL-QDGKGKGSCRSFGGFNL-----FAALEQCRDLLEGFGGHELA 418

Query: 444 AGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN---IALIDMLESAG 500
           AG T+   +     +   +   +           ++D   + + +    +  +D+LE   
Sbjct: 419 AGFTILEEHIPAFRERMLELVRSSTGGAAMEAALEVDAEADPALLTQEGVLSLDLLE--- 475

Query: 501 PYGAGNPNPVFAFPNHKLQSIRVVNLA-HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ 559
           PYG GNP PVF+     + +   V    HL++   ++   +  AI F V     G     
Sbjct: 476 PYGTGNPKPVFSMSGCTVTNASEVGGGRHLKLKV-TKGGRSFDAIFFSVSLAEAG----L 530

Query: 560 SRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           + G R+ +     +N +RG +  QL+++D  P 
Sbjct: 531 APGDRVDLAFSPQINEFRGWRSVQLQLIDLRPA 563


>gi|300718201|ref|YP_003743004.1| Single-stranded-DNA-specific exonuclease [Erwinia billingiae Eb661]
 gi|299064037|emb|CAX61157.1| Single-stranded-DNA-specific exonuclease [Erwinia billingiae Eb661]
          Length = 572

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 192/522 (36%), Positives = 280/522 (53%), Gaps = 23/522 (4%)

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFL-SHCSVNANMYIPDRIVD 133
           L+  ++AA  + +A+ ++  IMI GD+D DGA S AL +  L S    N    +P+R  D
Sbjct: 54  LSGIERAAEILQKALADNLCIMIVGDFDADGATSTALTVLALRSMGGRNIKYLVPNRFDD 113

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AY 192
           GYG +P ++E+    GAQLI+TVD G +S+  +  A  +GI V++ DHH +  E +P A 
Sbjct: 114 GYGLSPEVVEQAAARGAQLIVTVDNGISSHAGVDLAHEKGISVVITDHH-LPGETLPAAE 172

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+VNPN  D       L   GV F +++ +   LR D+ V +  +L  LLDLVAL TV D
Sbjct: 173 AIVNPNLEDCAFPSRSLAGVGVAFYLMLALRARLR-DSGVEVLPNLAELLDLVALGTVAD 231

Query: 253 VVPLIGLNRAYVVKGLMVARR-QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           VVPL   NR  V +GL   R  +   G+KAL+E  N     + A +LG+ +GP +NA GR
Sbjct: 232 VVPLDANNRILVWQGLSRIRAGKCRAGIKALLEIANRDPRQLAASDLGFALGPRLNAAGR 291

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           + + ++G  LL+S+D  +  MLA +LD LNQ R+ +E  M  Q EA  L  CD ++    
Sbjct: 292 LDDMSVGVALLLSEDIAQARMLASELDALNQTRKEIEQGM--QTEA--LALCDALESKDE 347

Query: 371 -----IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
                I +    WH G+VG+LA+RLKE+F RP  A +   DG   GSGRSI G  +   +
Sbjct: 348 ALPLGIAMYHPEWHQGVVGILASRLKERFHRPVIAFAPSGDGTLKGSGRSIAGLHMRDAL 407

Query: 426 SF--AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
                +  G+++K GGHAMAAGL++E  NF R    F       + A     V   DG L
Sbjct: 408 ERLDTLHPGLIIKFGGHAMAAGLSLEEANFDRFRQHFGDLVGEWLDAEALQGVVWSDGEL 467

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQ 542
            A  + +   ++L  AGP+G   P P F     KL   R+V   HL++  E       L 
Sbjct: 468 MAQELTLTTAELLREAGPWGQAFPEPQFD-GKFKLIQQRLVGERHLKVMIEPLGGGPLLD 526

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
            IAF +  T   +  +    +++ +   L +N +RG++  QL
Sbjct: 527 GIAFNIDTTQWPDPSV----RQVELAYKLDINEFRGNRSVQL 564


>gi|16800628|ref|NP_470896.1| hypothetical protein lin1560 [Listeria innocua Clip11262]
 gi|16414047|emb|CAC96791.1| lin1560 [Listeria innocua Clip11262]
          Length = 783

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 181/565 (32%), Positives = 297/565 (52%), Gaps = 32/565 (5%)

Query: 31  LAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLILTDCDKAARRIVQAI 89
           LA   K ++P  +A++L  R ++     D F +P  +    DP +L + D A  RI QAI
Sbjct: 21  LAEQLKISLP--LAKLLWKRKITTQGQFDKFFHPE-KYESYDPFLLAEMDLAVARIKQAI 77

Query: 90  YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEG 149
             +E+I+++GDYD DG  S+A++M+ L H   NA  YIP+R  +GYGPN +  +   N+G
Sbjct: 78  DLNEQILVYGDYDADGVTSIAVLMKTLRHLGANAEFYIPNRFTEGYGPNIAAFDMAKNQG 137

Query: 150 AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHL 209
             LIITVD G  + + + +A   G+DVIV DHH+ +     A A+++P           L
Sbjct: 138 VDLIITVDNGIAALEVMTHAKEIGLDVIVTDHHEPREVMPDAIAVIHPKHPKSAYPFDEL 197

Query: 210 CAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLM 269
              GV +    L + +L ++ K         LLDLVA+ TV D+V L   NR  V  GL 
Sbjct: 198 AGVGVAY---KLSHALLGEEPK--------ELLDLVAVGTVADLVSLTDENRLLVQLGLR 246

Query: 270 VARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQE 328
             R   N GL  L ++ ++     T E +G+ + P +NA GR+G ++  + LL+++D +E
Sbjct: 247 QLRENANLGLAVLAKKASLKLEEATEETIGFGLAPRLNAVGRLGPADPAADLLLTEDPEE 306

Query: 329 LEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
              LA ++D  N+ R+ +   + + A A +  +       ++IVV G+ W+ GI+G++A+
Sbjct: 307 ALFLAEEIDDANKERKQVVVDVTKLAMAAIEAKE---SLGNIIVVSGEGWNTGILGIVAS 363

Query: 389 RLKEKFGRPSFAISFEE-DGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLT 447
           +L   + RP+  +  +   G   GSGRS+E F + +  +      ++   GGH MAAGLT
Sbjct: 364 KLVSVYSRPAIVLGIDPVTGVAKGSGRSVEAFHLYQ--ALDKHRSLMTAFGGHPMAAGLT 421

Query: 448 VERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNP 507
           +   N   L +  Q+ A ++       P  KI+  +N + ++++ I  LE   P+G  NP
Sbjct: 422 LPAENLAELDNKLQEEASHLSDEDF-RPALKIEEKINLADISVSFIAQLEKLAPFGMDNP 480

Query: 508 NPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSE-TLQAIAFRVYGTPLGEFLMQ-SRGK 563
            P+F      L+  + +  +  HL+    ++DS+ TL AI F V     G+ + + S   
Sbjct: 481 KPIFLLEEMNLKGTKRIGADKTHLKTMLANEDSDVTLDAIGFGV-----GDLVEKISPHA 535

Query: 564 RMHVTGHLCVNYWRGSKRCQLRVLD 588
            + V G L +N W   K+ QLR++D
Sbjct: 536 AVDVVGELSINEWNNIKKPQLRMMD 560


>gi|238926104|ref|ZP_04657864.1| possible single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           flueggei ATCC 43531]
 gi|238885994|gb|EEQ49632.1| possible single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           flueggei ATCC 43531]
          Length = 671

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 174/568 (30%), Positives = 297/568 (52%), Gaps = 33/568 (5%)

Query: 32  AITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIY 90
           A+  +  +  I+ ++L  R + + + A+ FL+P+      DP ++ D ++ A R++ A+ 
Sbjct: 25  ALAAEIGVTPIIGQLLWQRGIRTAEEARAFLHPADTPFH-DPFLMADMERGAERVLCAVR 83

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
             E I+I+GDYDVDG  + AL+MR +     N + YIP+R  +GYG N   +++   EG 
Sbjct: 84  RDEPIVIYGDYDVDGMTATALLMRSIRTLGGNVSYYIPNRFTEGYGLNADALQQIAGEGC 143

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHL 209
           +L++TVDCG  S D +  AT  G+D+++ DHH +  + +P AYA++NP+R D    + +L
Sbjct: 144 RLLVTVDCGIASVDTVAEATG-GMDIVITDHH-LPGQMLPSAYAVMNPHRADCAYPEKNL 201

Query: 210 CAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLM 269
              GV F ++  ++++ R+++           LD+ AL TV D+VPL+G NR  V  GL 
Sbjct: 202 AGVGVAFKLVQALWQMEREES-------FAEYLDIAALGTVADLVPLVGENRKIVQMGLR 254

Query: 270 VARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQE 328
                   G++ALIE   ++   I    +G+ + P +NA GR+  +  G+ LL+++D+  
Sbjct: 255 QMAEHPCVGIRALIEVAGLADKSINTGQVGFQLAPRLNAAGRLETARHGAELLLTEDTAC 314

Query: 329 LEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
              +A +L+ LN  RR +E  +L +AE ++     D+     IVV G+ W+ G++G++A+
Sbjct: 315 ASRMAGELNALNTERRDLEQDILAEAERQLADFTPDV---PAIVVAGEEWNAGVIGIVAS 371

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTV 448
           RL EK+ RPS  ++  +D    GS RSI G  + + +S   +   L++ GGHAMAAGLT 
Sbjct: 372 RLVEKYYRPSIVLTRRDDVYK-GSCRSIAGLHLYEALSACRD--TLIQFGGHAMAAGLT- 427

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITT---PVFKIDGVLNASAVNIALIDMLESAGPYGAG 505
             ++  RL DF + F+  +   L      P   +  +   +   +  ++ L    PYG G
Sbjct: 428 --LSCERLSDFRRAFSEAVRTRLTAQDFIPKVAVSALAAPADWTVETVEELALLEPYGMG 485

Query: 506 NPNPVFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGK 563
           NP P+F   N + Q    +     HL+M   +++       A       L   L +    
Sbjct: 486 NPRPIFGVRNVRPQKASSIGAEGKHLRMDIGTREH---HITALYWNAGDLATVLTEEDSD 542

Query: 564 RMHVTGHLCVNYWRGSKRCQLRVLDASP 591
             +      +N W+G +  Q  V   +P
Sbjct: 543 LAYTPS---INEWQGERSVQCMVDTVTP 567


>gi|292487144|ref|YP_003530014.1| single-stranded DNA-specific exonuclease [Erwinia amylovora
           CFBP1430]
 gi|292900475|ref|YP_003539844.1| single-stranded-DNA-specific exonuclease [Erwinia amylovora ATCC
           49946]
 gi|291200323|emb|CBJ47451.1| single-stranded-DNA-specific exonuclease [Erwinia amylovora ATCC
           49946]
 gi|291552561|emb|CBA19606.1| Single-stranded DNA-specific exonuclease [Erwinia amylovora
           CFBP1430]
          Length = 572

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 196/524 (37%), Positives = 280/524 (53%), Gaps = 27/524 (5%)

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVD 133
           L+  D+A   + +A+ ++  IMI GD+D DGA S AL +  L      N    +P+R  D
Sbjct: 54  LSGIDQAVTILQKALLDNLCIMIVGDFDADGATSTALTVLSLRGMGAQNVKYLVPNRFDD 113

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AY 192
           GYG +P ++E+    GAQLI+TVD G +S   +  A  +GI VIV DHH +  E +P A 
Sbjct: 114 GYGLSPEVVEQAAVRGAQLIVTVDNGISSLAGVALAHQKGIAVIVTDHH-LPGEILPDAD 172

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD--NKVPLNFDLLSLLDLVALATV 250
           A+VNPN  D       L   GV F +++ +   LR D  N +P   +L  LLDLVAL TV
Sbjct: 173 AIVNPNLSDCAFPSRALAGVGVAFYLMLALRARLRDDGVNTLP---NLAELLDLVALGTV 229

Query: 251 CDVVPLIGLNRAYVVKGLMVARR-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAG 308
            DVVPL   NR  V +GL   R  +  PG++AL+E  N  +  + A +LG+ +GP +NA 
Sbjct: 230 ADVVPLDANNRILVWQGLSRIRAGKCRPGIRALLEIANRDARQLAASDLGFALGPRLNAA 289

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+ + ++G  LL+S+D  +  MLA +LD LNQ R+ +E  M  Q+EA  LT C+ ++ A
Sbjct: 290 GRLDDMSVGVALLLSEDLAQARMLASELDALNQTRKEIEQGM--QSEA--LTLCNRLESA 345

Query: 369 SV-----IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           S      I +    WH G+VG+LA+RLKE+F RP  A +   DG   GSGRSI G  +  
Sbjct: 346 SEALPLGIAMYHPEWHQGVVGILASRLKERFHRPVIAFAPAGDGMLKGSGRSIAGLHMRD 405

Query: 424 MVSF--AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           ++     +  G++VK GGHAMAAGL+++   F      F     + + A     V   DG
Sbjct: 406 VLERLDTLHPGLIVKFGGHAMAAGLSLQEAKFDEFRQRFADLVGDWLDAESLQGVVWSDG 465

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES-QDSET 540
            L A  + +   ++L  AGP+G   P P F     KL   R+V   HL++  E       
Sbjct: 466 ELMAQELTLPTAELLRDAGPWGQAFPEPTFD-GKFKLLQQRLVGERHLKVMVEPLGGGPL 524

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
           L  IAF V              K++ +   L VN +RG++  QL
Sbjct: 525 LDGIAFNVDTA----LWPDPAVKQVELAYKLDVNEYRGNRNVQL 564


>gi|332883950|gb|EGK04230.1| single-stranded-DNA-specific exonuclease RecJ [Dysgonomonas mossii
           DSM 22836]
          Length = 575

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 179/582 (30%), Positives = 301/582 (51%), Gaps = 21/582 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPD 71
           I  + + +L  Q+   R   + +K  I  ++ ++L+ R +S  + A+ F +PS+R L  D
Sbjct: 2   IYKWNYEALTTQQKEQRD-ELAKKLGISPVLCQLLIQRGISSAEEARKFFHPSLRDLH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L D DKA +RI +A+   ++I+I+GDYDVDG  +VAL+ +FL   + N + YIPDR 
Sbjct: 60  PFLLPDMDKAIKRIEKALGQKQRILIYGDYDVDGTTAVALVYKFLRKFTTNLDYYIPDRY 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYG +   ++     G +LII +DCG  + + + YA ++GID I+ DHH        A
Sbjct: 120 DEGYGISEQGIDYAEETGVKLIIALDCGIKANEKIDYAKSKGIDFIIGDHHMPDDVLPDA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A+++  RLD      HL   GV F ++    + L Q NK+  + ++  LLDLVA++   
Sbjct: 180 VAVIDAKRLDSTYPYEHLSGCGVGFKLV----QALAQSNKIDFS-EITDLLDLVAVSVAS 234

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+VP+ G NR     GL       + GLK +I+   ++   IT  ++ + IGP INA GR
Sbjct: 235 DIVPITGENRVLTYFGLKQINSNPSLGLKGIIDICGLTYKNITVNDIIFKIGPRINASGR 294

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           + +      LL+S   ++    +M +D  N +RR ++  + E+A  + + +  D+++   
Sbjct: 295 MMKGKEAVDLLLSSTIEDAREKSMNIDHYNDDRRELDKRITEEA-IQFIDENVDMKEKKS 353

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           IV+  + WH G++G++A+RL EK+ RP+  ++ +  G   GS RS+ GFD+ K +     
Sbjct: 354 IVIYNETWHKGVIGIVASRLTEKYLRPAVVLT-KSQGLITGSARSVMGFDVYKAIEAC-- 410

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           + IL   GGH  AAGL+++  N       F+  +  ++   +  P  ++D  L+   +N 
Sbjct: 411 KDILENFGGHTYAAGLSLKEENLKEFKSRFEALSLEMIAPEMMRPQIRVDAELSFKEINQ 470

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPN-HKLQSIRVVNLAHLQMTFESQD---SETLQAIAF 546
              + L +  P+G  N NP+F   N     + ++V   ++ +  E  D   S  +  IAF
Sbjct: 471 KFTEDLAAFAPFGPENLNPIFVTCNVMDYGTSKLVGKDNVHLKLEMIDDTLSTPVNGIAF 530

Query: 547 RVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           R   +          GK   +   L  N   G    QL V D
Sbjct: 531 RQQDSS----DKVKSGKPFDICYTLEENTHNGKTNIQLYVKD 568


>gi|168183172|ref|ZP_02617836.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum Bf]
 gi|182673590|gb|EDT85551.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum Bf]
          Length = 593

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 190/587 (32%), Positives = 305/587 (51%), Gaps = 46/587 (7%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I  K  I + +  VLVNR + +++  KDFL PS+  L  +PL++ D DK    I ++I +
Sbjct: 17  IANKSGISETLCTVLVNREIYNLEDIKDFLEPSLEKLY-NPLLMKDMDKGTEIIKRSIID 75

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            +KI I+GDYD DG  S  ++   L  C  N   YIPDR  +GYG     +E+   EG +
Sbjct: 76  KKKIAIYGDYDADGVTSTVILYIALKECEANVIYYIPDRETEGYGMCTERVERLKAEGVE 135

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQV-----KSEE----IP-AYALVNPNRLD 201
           +IIT D G  + + ++ A + G+ V++ DHH++     + EE    +P A A++NP + D
Sbjct: 136 VIITCDNGIAALEQVERAKDLGMTVVITDHHELPFIENEKEEREYVVPKADAIINPKQKD 195

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNR 261
                  LC AG+ F    L+Y  L   N  P  +    LL   A+ T+CDVV L G NR
Sbjct: 196 CYYPFKMLCGAGIAFKFSKLLYEKL---NMNPNKYK--ELLQFAAIGTICDVVDLKGENR 250

Query: 262 AYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRL 320
                GL       N GL+ALI+  +++   IT+ N+G++IGP INA GR+  + L   L
Sbjct: 251 IIAKLGLESINNTNNLGLRALIKETSLNEKNITSYNVGFIIGPCINATGRLDTAALSVEL 310

Query: 321 LISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHP 380
            ++ D +  E LA +L  LN  R+  E  M    E     +   ++   V+V+  +  H 
Sbjct: 311 FLAKDIKRAEELAKELRNLNTERQ--EITMEGVEEITYTIENSSLKNDKVLVIYKENIHE 368

Query: 381 GIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGFDIGKMVSFAVEEGILVKGG 438
            I G+++ R+K+ + RP+  ++    GK +  GSGRSI+G+++ + +    E   + K G
Sbjct: 369 SIAGIVSGRIKDAYNRPTIVLT---KGKEMPKGSGRSIDGYNLFEELMKCKE--YIYKFG 423

Query: 439 GHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLES 498
           GH MAAGLT+E  N  +L +   K  +      I  P  +ID  L    VN+ LID L+ 
Sbjct: 424 GHPMAAGLTIEEKNIDKLREELNKNCNLKDEDFI--PKIRIDKRLPLKEVNLELIDSLQC 481

Query: 499 AGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDS-ETLQAIAF--------- 546
             P+G GN +P+ A  N K++ IR++  +   L++T   +D+ + + AIAF         
Sbjct: 482 LEPFGKGNSSPILAEKNIKIEGIRILGKDQNTLKLTCRVEDTNKRIHAIAFGKVDEFKRD 541

Query: 547 --RVYGTPLGEFLMQS---RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              +Y     E ++ +    G ++ +  +  +N + G+   QLR++D
Sbjct: 542 LENIYEDENVENIITNPLMAGLKLDLIYYPMINEYNGNVYTQLRIID 588


>gi|150020204|ref|YP_001305558.1| single-stranded-DNA-specific exonuclease RecJ [Thermosipho
           melanesiensis BI429]
 gi|149792725|gb|ABR30173.1| single-stranded-DNA-specific exonuclease RecJ [Thermosipho
           melanesiensis BI429]
          Length = 977

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 171/518 (33%), Positives = 286/518 (55%), Gaps = 31/518 (5%)

Query: 39  IPDIVARVLVNRN-VSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           IP + A++LV+R  V+ + A  F+NPS   L   P +L D D+A + ++ A      I++
Sbjct: 22  IPLLTAQLLVSRGYVTPESAYRFINPSKNDLRS-PFLLKDMDRAVKYLLLARNKKYPILV 80

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYDVDG   VA ++ FLS        +IP+R+  GYG  P +++++  +G +L+++VD
Sbjct: 81  YGDYDVDGITGVATLVTFLSKHGWKVKYFIPNRLDVGYGIQPEIVDEYFKKGYRLLLSVD 140

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF- 216
           CG TS+DA+++A   G+ V++ DHH +KS    A+A+V+P R D+          GV + 
Sbjct: 141 CGITSFDAVKHARELGMYVVITDHHTIKSGIPNAHAVVDPKREDETYPFKDFAGVGVAYK 200

Query: 217 LVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGN 276
           L+  L   +   D++V        LLD+VAL T+ D+V L+  NR  V +GL    +   
Sbjct: 201 LISALALELGLPDDEVN------ELLDIVALGTIADMVDLVDENRYIVKEGLKKLNQTQR 254

Query: 277 PGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
            GL  L++++NI + IT++++GY + P +NA GR+  +    +L+ +++    E LA  L
Sbjct: 255 VGLVQLMKKLNIKN-ITSQDIGYRLAPKLNAAGRLYSAEDAYKLITTNNLSSAEQLAEIL 313

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
              N  R+ +E+ +  +A  K+  +   I+   +++V G++WH G++G++A +L +K+ +
Sbjct: 314 MGYNFTRQEIENKIFNEAVYKI--EKSKIKDLPILIVSGEKWHAGVLGIVATKLVQKYNK 371

Query: 397 PSFAISFEEDGKGIGSGRSIEG---FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNF 453
           PS  IS  EDG G GSGRS++G   FD+    S   EE      GGH MA G ++     
Sbjct: 372 PSLVISL-EDGMGRGSGRSVDGVNIFDVLSSFSRYFEE-----IGGHPMAVGFSIREEKI 425

Query: 454 GRLCDFFQKF---AHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
             L D   K    +H  V + I     +ID VL+   VN  +I+ L    P+G GNP PV
Sbjct: 426 DELIDVISKEFVDSHFEVDSKI-----EIDTVLDIDEVNDEVINSLSYLEPFGHGNPEPV 480

Query: 511 FAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAF 546
           F   N  +  IR     +++++M  + ++   ++ I F
Sbjct: 481 FLIKNSLVDRIRFFGNVVSNVRMVLKGKNKNVIEGIGF 518


>gi|312171248|emb|CBX79507.1| Single-stranded DNA-specific exonuclease [Erwinia amylovora ATCC
           BAA-2158]
          Length = 572

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 196/524 (37%), Positives = 280/524 (53%), Gaps = 27/524 (5%)

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVD 133
           L+  D+A   + +A+ ++  IMI GD+D DGA S AL +  L      N    +P+R  D
Sbjct: 54  LSGIDQAVTILQKALLDNLCIMIVGDFDADGATSTALTVLSLRGMGAQNVKYLVPNRFDD 113

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AY 192
           GYG +P ++E+    GAQLI+TVD G +S   +  A  +GI VIV DHH +  E +P A 
Sbjct: 114 GYGLSPEVVEQAAVRGAQLIVTVDNGISSLAGVALAHQKGIAVIVTDHH-LPGEILPDAD 172

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQD--NKVPLNFDLLSLLDLVALATV 250
           A+VNPN  D       L   GV F +++ +   LR D  N +P   +L  LLDLVAL TV
Sbjct: 173 AIVNPNLSDCAFPSRALAGVGVAFYLMLALRARLRDDGVNTLP---NLAELLDLVALGTV 229

Query: 251 CDVVPLIGLNRAYVVKGLMVARR-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAG 308
            DVVPL   NR  V +GL   R  +  PG++AL+E  N  +  + A +LG+ +GP +NA 
Sbjct: 230 ADVVPLDANNRILVWQGLSRIRAGKCRPGIRALLEIANRDARQLAASDLGFALGPRLNAA 289

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+ + ++G  LL+S+D  +  MLA +LD LNQ R+ +E  M  Q+EA  LT C+ ++ A
Sbjct: 290 GRLDDMSVGVALLLSEDLAQARMLASELDALNQTRKEIEQGM--QSEA--LTLCNRLESA 345

Query: 369 SV-----IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           S      I +    WH G+VG+LA+RLKE+F RP  A +   DG   GSGRSI G  +  
Sbjct: 346 SEALPLGIAMYHPEWHQGVVGILASRLKERFHRPVIAFAPAGDGMLKGSGRSIAGLHMRD 405

Query: 424 MVSF--AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           ++     +  G++VK GGHAMAAGL+++   F      F     + + A     V   DG
Sbjct: 406 VLERLDTLHPGLIVKFGGHAMAAGLSLQEAKFDEFRQRFADLVGDWLDAESLQGVVWSDG 465

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES-QDSET 540
            L A  + +   ++L  AGP+G   P P F     KL   R+V   HL++  E       
Sbjct: 466 ELMAQELTLPTAELLRDAGPWGQAFPEPTFD-GKFKLLQQRLVGERHLKVMVEPLGGGPL 524

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
           L  IAF V              K++ +   L VN +RG++  QL
Sbjct: 525 LDGIAFNVDTA----LWPDPAVKQVELAYKLDVNEYRGNRNVQL 564


>gi|166364907|ref|YP_001657180.1| single-strand-DNA-specific exonuclease [Microcystis aeruginosa
           NIES-843]
 gi|166087280|dbj|BAG01988.1| single-strand-DNA-specific exonuclease [Microcystis aeruginosa
           NIES-843]
          Length = 654

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 175/576 (30%), Positives = 300/576 (52%), Gaps = 23/576 (3%)

Query: 32  AITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPL-ILTDCDKAARRIVQAI 89
            + ++  +  ++A +L+NR +   + AK +++P    L P PL    D +K+   +V+AI
Sbjct: 22  GLAREMGLSSLLATILINRGIDTPELAKTYIDPEADTL-PSPLGEFPDLEKSVNLLVKAI 80

Query: 90  YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEG 149
              +KI I GDYD DG  S +L++R L H     N  IP R+ +GYG N  ++E+F   G
Sbjct: 81  ARGDKIAICGDYDADGMTSTSLLLRALRHLGARVNHAIPSRMKEGYGINQRIVEEFAESG 140

Query: 150 AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHL 209
             LI+TVD G ++++ +  A   G+ VI+ DHH +      A A++NP  L   S    L
Sbjct: 141 VGLILTVDNGISAHEPIALAIELGLKVIITDHHDLPPILPNASAILNPKLLTPNSPYQGL 200

Query: 210 CAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLM 269
              GV +++ V   + + +     L     SLL L  L T+ D+ PLIG+NR ++ +GL 
Sbjct: 201 AGVGVAYILAVTTAQKMGK-----LQGLTESLLALFTLGTIADLAPLIGVNRRWLKRGLR 255

Query: 270 VARRQGNPGLKALIERVNISSP---ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDS 326
              +    G+++L++   IS     +  +++G+ +GP INA GRIG+  +   LL +D++
Sbjct: 256 KLPKSQLVGIQSLMQIAGISEEQKQLQPDDIGFKLGPRINAIGRIGDPQIVIELLTTDEA 315

Query: 327 QELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLL 386
                 AM+ + +N+ R+ +   + E+A   V       QQ  V+V+    WH G++G++
Sbjct: 316 GIALERAMQCEQINRTRQELCEKIEEEAIKLVEETPIFWQQDRVLVLVEKDWHHGVIGIV 375

Query: 387 AARLKEKFGRPSFAISFEED--GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAA 444
           A+RL E++G P F  ++EE+  GK  GS R IE F + + + F   + +L K GGH MA 
Sbjct: 376 ASRLVERYGVPVFIGTYEEEDTGKIRGSARGIEEFHVFEALQFC--QDLLGKFGGHKMAG 433

Query: 445 GLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGA 504
           G ++   N         +F+H I+      P+ KID +L+   +N+ L   ++S  P+G 
Sbjct: 434 GFSLPTANLLAFKQRLSQFSHKILQIEQLKPLIKIDTILDFKQINLQLFQQIDSLQPWGI 493

Query: 505 GNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKR 564
           GN  PVF  PN ++   + +   HL++     D+  ++A+A+R      GE+       R
Sbjct: 494 GNELPVFWTPNVRVVEQKTIGKNHLKLLLAQSDNTRIKALAWR-----WGEYC--PLPTR 546

Query: 565 MHVTGHLCVNYWRGSKRCQLRVLDAS-PVEGHHFAK 599
           + +   L  N W G+   ++ ++    P E ++  K
Sbjct: 547 LDIAYKLKENTWNGNTTIEIELVGVRLPQENNNIKK 582


>gi|312875796|ref|ZP_07735786.1| single-stranded-DNA-specific exonuclease RecJ [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311797277|gb|EFR13616.1| single-stranded-DNA-specific exonuclease RecJ [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 798

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 176/575 (30%), Positives = 304/575 (52%), Gaps = 22/575 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW+        N  + I  +   P I+ +VL NR V   +  + FLNPS++ L  +P +L
Sbjct: 7   RWILKDNNNFENMDIEIDGRKIKPQII-KVLNNRGVQEKEEIERFLNPSLKNLH-NPFLL 64

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
           +D  +A + I +AI +  +++I+GDYD DG  S  L+   L +  +  + YIP+R  DGY
Sbjct: 65  SDMKEAVKIIHEAILHKSRVLIYGDYDCDGVTSTYLLYSTLRNF-LPTSYYIPNRFKDGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N  +++K + +   L+ITVD G ++ + ++Y   +G  VI+ DHH+ K     A A++
Sbjct: 124 GLNLDVLKK-LEDKFDLLITVDTGISAQNEVKYLKEKGKKVIITDHHEPKEVLPDADAVI 182

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP R D +     L   GV F       ++L       LN  L   LD+VA+ T+ DV+P
Sbjct: 183 NPKRKDSVYPFRDLAGVGVAF-------KLLHALKSSGLNLKLSEYLDVVAIGTIADVMP 235

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP--ITAENLGYMIGPSINAGGRIGE 313
           L+  NR +   GL V +   N GLK LIE   +SS   +   ++ ++IGP +NA GRI +
Sbjct: 236 LVDENRIFAKFGLKVLKNTRNVGLKKLIEVAGLSSKEELKPYDVSFIIGPRLNAAGRISD 295

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +NL   LL+  D+ + E +A +LD  N+ R+ +E   +++A++ ++ +   I +  + V+
Sbjct: 296 ANLAVSLLLEKDAIKAESIAKRLDEENRKRQEIEEKTIKEAQS-LIAKNKSILKKKIFVL 354

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WH G+VG+ ++++ EK+ RPS  ++  + G   GSGRSI+GF++ + +    E  I
Sbjct: 355 SNGSWHAGVVGIASSKITEKYYRPSLLLTVADQGILKGSGRSIKGFNLFEALKSCSE--I 412

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+K GGH  AAGL++   N  +L +     A +    +I  P  ++D VL+ + ++  L+
Sbjct: 413 LLKFGGHEYAAGLSLPVDNVEKLDEILNSIAQD-YHFMIFKPAIEVDLVLSLNEIDDELV 471

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           D +    P+G GNP P F   N  +++ R +   +    F + +S     + F    + L
Sbjct: 472 DQVYLLEPFGVGNPEPTFLIKNLVVENFRFMGEDNKYYKFFTGNSTKYDVVCF----SNL 527

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            +       K++ +   L  N +   ++ Q  ++D
Sbjct: 528 EDEDELISMKKVDIVCKLERNLFNSVRKNQFNIID 562


>gi|237796199|ref|YP_002863751.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum Ba4 str. 657]
 gi|229264065|gb|ACQ55098.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum Ba4 str. 657]
          Length = 593

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 190/587 (32%), Positives = 304/587 (51%), Gaps = 46/587 (7%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I  K  I + +  VLVNR + +++  KDFL PS+  L  +PL++ D DK    I ++I +
Sbjct: 17  IANKSGISETLCTVLVNREIYNLEDIKDFLEPSLEKLY-NPLLMKDMDKGTEIIKRSIID 75

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            +KI I+GDYD DG  S  ++   L  C  N   YIPDR  +GYG     +E+   EG +
Sbjct: 76  KKKIAIYGDYDADGVTSTVILYIALKECEANVIYYIPDRETEGYGMCTERVERLKAEGVE 135

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQV-----KSEE----IP-AYALVNPNRLD 201
           +IIT D G  + + ++ A   G+ V++ DHH++     + EE    +P A A++NP + D
Sbjct: 136 VIITCDNGIAALEQVERAKELGMTVVITDHHELPFIENEKEEREYVVPKADAIINPKQKD 195

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNR 261
                  LC AG+ F    L+Y  L   N  P  +    LL   A+ T+CDVV L G NR
Sbjct: 196 CYYPFKMLCGAGIAFKFSKLLYEKL---NMNPNKYK--ELLQFAAIGTICDVVDLKGENR 250

Query: 262 AYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRL 320
                GL       N GL+ALI+  +++   IT+ N+G++IGP INA GR+  + L   L
Sbjct: 251 IIAKLGLESINNTNNLGLRALIKETSLNEKNITSYNVGFIIGPCINATGRLDTAALSVEL 310

Query: 321 LISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHP 380
            ++ D +  E LA +L  LN  R+  E  M    E     +   ++   V+V+  +  H 
Sbjct: 311 FLAKDIKRAEELAKELRNLNTERQ--EITMEGVEEITYTIENSSLKNDKVLVIYKENIHE 368

Query: 381 GIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGFDIGKMVSFAVEEGILVKGG 438
            I G+++ R+K+ + RP+  ++    GK +  GSGRSI+G+++ + +    E   + K G
Sbjct: 369 SIAGIVSGRIKDAYNRPTIVLT---KGKEMPKGSGRSIDGYNLFEELMKCKE--YIYKFG 423

Query: 439 GHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLES 498
           GH MAAGLT+E  N  +L +   K  +      I  P  +ID  L    VN+ LID L+ 
Sbjct: 424 GHPMAAGLTIEEKNIDKLREELNKNCNLKDEDFI--PKIRIDKRLPLKEVNLELIDSLQC 481

Query: 499 AGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDS-ETLQAIAF--------- 546
             P+G GN +P+ A  N K++ IR++  +   L++T   +D+ + + AIAF         
Sbjct: 482 LEPFGKGNSSPILAEKNIKIEGIRILGKDQNTLKLTCRVEDTNKRIHAIAFGKVDEFKRD 541

Query: 547 --RVYGTPLGEFLMQS---RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              +Y     E ++ +    G ++ +  +  +N + G+   QLR++D
Sbjct: 542 LENIYEDENVENIITNPLMAGLKLDLIYYPMINEYNGNVYTQLRIID 588


>gi|293569806|ref|ZP_06680893.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus faecium
           E1071]
 gi|291587554|gb|EFF19431.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus faecium
           E1071]
          Length = 765

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 179/534 (33%), Positives = 272/534 (50%), Gaps = 29/534 (5%)

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FL+P  + L  DP ++ D DKA  RI +A+ + EKI+++GDYD DG  S  +M   L   
Sbjct: 50  FLHPKEQELH-DPYLMHDMDKAISRIQEAVISGEKILVYGDYDADGITSATVMKETLELL 108

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
                +++P+R   GYGPN S+ ++ I EG QLIITVD G    DA+ YA   G+DVI+ 
Sbjct: 109 GAEVEVFLPNRFEHGYGPNQSVYQEKIEEGIQLIITVDNGVAGNDAVAYAQQAGVDVIIT 168

Query: 180 DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           DHH++      AYA+V+P           L   GV F V   +        + P+ F   
Sbjct: 169 DHHELPENLPDAYAIVHPRHPAGHYPFPDLAGVGVAFKVASALL------EEPPVEF--- 219

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE-NLG 298
             LDLVA+ T+ D+V L   NR  V  G+         GL+AL E   +      E  +G
Sbjct: 220 --LDLVAIGTIADLVSLTDENRILVSLGIDAIHHSERIGLQALFEESGVKMRDADETTIG 277

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           + I P +NA GR+G+      LL + D +E  + A KL+ +N+ R+    A++EQ   + 
Sbjct: 278 FSIAPRLNAIGRMGDPRPAVSLLATFDEEEASVQAKKLNEINEERK----AIVEQITQEA 333

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           L   +      ++V  G  WH G++G++A ++  + G+P+  ++ +EDG   GSGRSIE 
Sbjct: 334 LAMVNKENHIHLLVNRG--WHEGVLGIVAGKIMNETGKPTLVLTLKEDGSAKGSGRSIEA 391

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            ++ +M+    +  +    GGH  A GLT+   N   L +   ++  +    L+  P  +
Sbjct: 392 LNLFEMLDQMRD--LFTYFGGHHAAVGLTMPSENVTILQEKMNQYIVDHQIDLMRGPELR 449

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQ 536
           ID VL  + V +  ID L+   P+G  NP P F F   + ++I+ +  N  HL+    S 
Sbjct: 450 IDEVLLPNEVTVERIDELKLLAPFGTDNPLPQFLFRQVQAENIKRIGANQQHLKFVL-SD 508

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            S  L A+AF  +GT   E L      ++ V G L +N W G K+ QL V D S
Sbjct: 509 ASSQLDAVAFG-FGTQEEELL----NNQVDVVGKLSINEWNGRKKPQLMVSDFS 557


>gi|229013626|ref|ZP_04170757.1| Exonuclease RecJ [Bacillus mycoides DSM 2048]
 gi|228747685|gb|EEL97557.1| Exonuclease RecJ [Bacillus mycoides DSM 2048]
          Length = 773

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 189/577 (32%), Positives = 295/577 (51%), Gaps = 27/577 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E +   LA   K  +  +V  + + R ++  D   DFLN + +    DP +L
Sbjct: 7   RWKEKEYNEELVSELA--NKLQLSPLVTSLFLGRGLNTEDKIADFLNTADQEFH-DPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L         YIP+R  +GY
Sbjct: 64  EGMDRTVERVKKAIENGEQILIFGDYDADGVSSTTVLYLALKELGAEVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +        +VP +     LL++  + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALL------GRVPEH-----LLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S S IT E++G+ + P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFALAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       ++  V+V+ 
Sbjct: 293 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPP-EENKVLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S +   +   GS RSI GFD+   +S   E  +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLSIDPHKETAKGSARSIAGFDLFANLSDCRE--L 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ A    P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLNMNDVDELRRRLNEQADVILTAEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +  + +HL+M      + TL  I F  +GT
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQA-TLDTIGFG-FGT 527

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              E    S   ++ V G + +N W   K+ QL V D
Sbjct: 528 YAKEI---SPVAKVSVVGEVSINEWNNFKKPQLMVQD 561


>gi|304407546|ref|ZP_07389198.1| single-stranded-DNA-specific exonuclease RecJ [Paenibacillus
           curdlanolyticus YK9]
 gi|304343497|gb|EFM09339.1| single-stranded-DNA-specific exonuclease RecJ [Paenibacillus
           curdlanolyticus YK9]
          Length = 801

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 182/568 (32%), Positives = 290/568 (51%), Gaps = 33/568 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           + Q  A+P +VAR+LV R + S + A  FL+  + L   DP +L   + A +RI  AI  
Sbjct: 24  LMQALALPPLVARLLVGRGIESEEAATSFLHGGMELTH-DPYLLAGMEAAVQRIRHAIEQ 82

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            + I I+GDYD DG +S +LM+  L       + YIP R  +GYG N + ++     G +
Sbjct: 83  EQWIRIYGDYDADGVSSTSLMIHLLERLGAKFDYYIPHRTREGYGMNCAAIDLAAEAGVK 142

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP-AYALVNPNRLDDLSGQGHLC 210
           LIITVD G ++ D + YA  +GI+V+V DHH+   E +P AY+++NP           L 
Sbjct: 143 LIITVDTGISAVDEIAYAKAKGIEVVVTDHHE-PPEVLPDAYSIINPKLPYCQYPYKSLA 201

Query: 211 AAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
             GV F +   +        + PL+     L D+VAL T+ DV+PL G NR  V +GL  
Sbjct: 202 GVGVAFKLATALL------GEAPLD-----LTDIVALGTIADVMPLNGENRVLVRQGLKE 250

Query: 271 ARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQEL 329
              +  PG  AL E   +    +T+ N+ + + P INA GR+  +     LL + D +  
Sbjct: 251 MALRTRPGFLALAETAGVQLQAVTSTNVAFSMAPRINASGRLDHAGGAVELLTTSDQEAA 310

Query: 330 EMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA-----SVIVVEGDRWHPGIVG 384
           E+LA +LD LN+ R+ +   M+++A ++   +C    +A     +VIV+ G+ W+ G++G
Sbjct: 311 ELLAARLDALNRERQRIVEEMVDEAMSQWAEKCRIAAEACQSPPAVIVLAGEGWNAGVIG 370

Query: 385 LLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMA 443
           ++A+++ E++ +P+  +  + E GK  GS RSI+GFD+   ++   +  +    GGH  A
Sbjct: 371 IVASKMLERYYKPTVVLGIDTETGKCKGSARSIDGFDLHAALTACAD--LFDHFGGHQAA 428

Query: 444 AGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYG 503
           AG+T+ R     L       A   +      P   ID   +    ++  ID L    P+G
Sbjct: 429 AGMTLHRDKLDALEQSLSDSAMAWLSPEDWVPKTFIDLACSPKEASLDTIDQLALLEPFG 488

Query: 504 AGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ-S 560
           AGNP P F F    +   R +     HL++    Q S  L+A+ F       GE   + +
Sbjct: 489 AGNPAPRFLFEQQPVTDKRTMGKESKHLRLALGGQPSR-LEAVGF-----GFGELAERIA 542

Query: 561 RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
            G +  + G L VN W G+++ QL + D
Sbjct: 543 FGAQADLVGELSVNEWNGNRKPQLFIQD 570


>gi|294792134|ref|ZP_06757282.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella sp.
           6_1_27]
 gi|294457364|gb|EFG25726.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella sp.
           6_1_27]
          Length = 660

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 184/554 (33%), Positives = 290/554 (52%), Gaps = 22/554 (3%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           IVA+++VNR++ +D  + FL  ++  L+ DP  L D D A   +++ I + + I+I+GDY
Sbjct: 29  IVAKLMVNRHIDVDEGRRFLQGTLSDLL-DPFTLKDMDVAVSLVLETIESHKPIVIYGDY 87

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDG  + +++ RFL     +   YIP+R  +GYG N   ++  I  G  L+ITVDCG +
Sbjct: 88  DVDGITATSVLYRFLKKLGADVTYYIPERQSEGYGLNLEALKHLIERGTDLVITVDCGIS 147

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
           SYD ++ A    I++I+ DHH        A A++N  + D      +L   GV F +   
Sbjct: 148 SYDIVE-AVRDRINMIITDHHTAPDVIPRAKAVINHKQKDCPYKDKNLSGVGVAFKLCQA 206

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           ++  L +  +  L+      LD+VAL TV DVVPL+G NR  V  GL       N G+  
Sbjct: 207 LW--LTKHGEWYLDD-----LDIVALGTVADVVPLVGENRIIVKSGLEKMNSYPNLGINK 259

Query: 282 LIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           LI+   +    IT+ ++GY + P +NA GR+  +     LL++DD+   E +A +L+  N
Sbjct: 260 LIDVSGLHERTITSGHIGYTLAPRLNAAGRVTHATRAVELLVTDDADIAEAIAEELNETN 319

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
           + R+ +E  + E A   V  Q    +   V +V G+ WHPG++G++A+RL E+F +P+  
Sbjct: 320 RERQELERNIHELARIDVANQGH--KADYVTIVAGEEWHPGVIGIVASRLVEEFYKPTLV 377

Query: 401 ISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF 460
           IS   DG G GS RSI+GF+I   +     E IL++ GGH+ AAG +++      L +  
Sbjct: 378 ISI-HDGVGKGSCRSIDGFNIYDALKSC--EDILLQFGGHSAAAGFSIDANRIDELRERL 434

Query: 461 QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQS 520
            K+   +V A    PV  ID  L    +++ +ID +    PYG  N  PVFA     +Q 
Sbjct: 435 TKYCKEVVTAEEYIPVVAIDAELPVDDIDVDIIDRVSDLEPYGMANSTPVFAIMEATVQD 494

Query: 521 IRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG 578
           I ++     H ++ F + +  TL AIA+         F+    G  + V   L  N W+G
Sbjct: 495 IMLMGQLKNHCKVIFATSNG-TLDAIAWNRPDLFRSIFV----GTVVKVAFSLQKNEWQG 549

Query: 579 SKRCQLRVLDASPV 592
               QL +    P+
Sbjct: 550 LVSPQLMIQAIEPL 563


>gi|229135232|ref|ZP_04264031.1| Exonuclease RecJ [Bacillus cereus BDRD-ST196]
 gi|228648274|gb|EEL04310.1| Exonuclease RecJ [Bacillus cereus BDRD-ST196]
          Length = 781

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 189/577 (32%), Positives = 295/577 (51%), Gaps = 27/577 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E +   LA   K  +  +V  + + R ++  D   DFLN + +    DP +L
Sbjct: 15  RWKEKEYNEELVSELA--NKLQLSPLVTSLFLGRGLNTEDKIVDFLNTTDQEFH-DPFLL 71

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L         YIP+R  +GY
Sbjct: 72  EGMDRTVERVKKAIENGEQILIFGDYDADGVSSTTVLYLALKELGAEVEFYIPNRFTEGY 131

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 132 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 191

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +        +VP +     LL++  + TV D+V 
Sbjct: 192 HPKLEGGVYPFHYLAGVGVAFKVAHALL------GRVPEH-----LLEIAVIGTVADLVS 240

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S S IT E++G+ + P INA GR+ ++
Sbjct: 241 LHGENRLLVQRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFALAPRINAVGRLEDA 300

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       ++  V+V+ 
Sbjct: 301 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPP-EENKVLVLA 359

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S +   +   GS RSI GFD+   +S   E  +
Sbjct: 360 KEGWNPGVIGIVASKLVERFYRPTIVLSIDPHKETAKGSARSIAGFDLFANLSDCRE--L 417

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ A    P+  +D       V +A I
Sbjct: 418 LPHFGGHPMAAGMTLNMNDVDELRRRLNEQADVILTAEDFIPITAVDAFCKVEDVTLAAI 477

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +  + +HL+M      + TL  I F  +GT
Sbjct: 478 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQA-TLDTIGFG-FGT 535

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              E    S   ++ V G + +N W   K+ QL V D
Sbjct: 536 YAKEI---SPVAKVSVVGEVSINEWNNFKKPQLMVQD 569


>gi|220916521|ref|YP_002491825.1| single-stranded-DNA-specific exonuclease RecJ [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219954375|gb|ACL64759.1| single-stranded-DNA-specific exonuclease RecJ [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 573

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 200/558 (35%), Positives = 292/558 (52%), Gaps = 25/558 (4%)

Query: 42  IVARVLVNR-NVSIDYAKDFLNPSIRLL-MPDPLILTDCDKAARRIVQAIYNSEKIMIFG 99
           + ARVL  R +     A+ FL  + RL  +PDP  +   D A  RIV+A+   E+I  +G
Sbjct: 31  LAARVLAARGHADPAEAEAFL--AARLADLPDPFRMKGMDAAVERIVRALEGGERIACYG 88

Query: 100 DYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG 159
           DYDVDG  S AL+  FL     +   Y P R+V+GYG N   +     +G +L++T+DCG
Sbjct: 89  DYDVDGVTSTALLCGFLRAAGADVVTYTPHRLVEGYGLNGDAVRSLAAQGVRLLVTLDCG 148

Query: 160 STSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF-LV 218
            TS D ++ A   G+D +V+DHH V  E   A A++NP++         L A GV F L 
Sbjct: 149 ITSVDEVRVAAGLGVDTVVVDHHTVPVELPAAAAILNPHQPGCAYPSKDLAAVGVTFALA 208

Query: 219 LVLIYRILRQDNKVPLNFD--LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGN 276
           + L  R+  +    P   +  L  +LDLVAL TV DVVPL+G NR  V  GL        
Sbjct: 209 MALRRRLRERGRFGPARPEPNLKEVLDLVALGTVADVVPLVGANRILVRWGLEQLATSRR 268

Query: 277 PGLKALIERVNIS--SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAM 334
           PG++AL     I+  +P+TA  +G+ + P INA GR+ ++  G RLL+S D+   + LA 
Sbjct: 269 PGVRALKRVAGIADGTPVTAGQVGFRLAPRINAAGRLDDAGRGVRLLLSGDAAAAQALAD 328

Query: 335 KLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKF 394
           +LD  NQ R+ +E  +LEQA A    +     +  V+  +G  WH G+VG++A+R+ E+F
Sbjct: 329 ELDRENQARQEIERRILEQALADAAARVAAGARGLVLARDG--WHAGVVGIVASRVVERF 386

Query: 395 GRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
            RP+  ++  EDG G GSGRSIEGF +    + A   G L + GGH  AAG+TVER    
Sbjct: 387 HRPAVLVAL-EDGAGKGSGRSIEGFHL--YDALAACSGHLARFGGHRHAAGVTVERAQVE 443

Query: 455 RLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFP 514
                F+  A   +      P  +IDG +  + V     + L   GP+GAG+P PVFA  
Sbjct: 444 PFRAAFEAHAAATIADEDLVPRCRIDGWVGDAEVTEDAAEALGRLGPFGAGHPEPVFALR 503

Query: 515 NHKLQSIRV-VNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCV 573
               ++  V    AHL++         L AI F      +G+    + G  +     +  
Sbjct: 504 GAAARARTVGAGGAHLKLAL----GRGLDAIGF-----GMGD-RAPACGGPVDAAFTIGF 553

Query: 574 NYWRGSKRCQLRVLDASP 591
           + W G++R QL++ D  P
Sbjct: 554 DEWDGTRRLQLKLKDLRP 571


>gi|325262047|ref|ZP_08128785.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium sp. D5]
 gi|324033501|gb|EGB94778.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium sp. D5]
          Length = 570

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 190/585 (32%), Positives = 311/585 (53%), Gaps = 32/585 (5%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF-LNPSIRLLMPDPLIL 75
           +W   + +   N    I  K+ I  I+AR++ NR++  D   +F LN +I  L  D +++
Sbjct: 3   KWFVCMKKADFN---GIADKYHISPILARLIRNRDMMEDGEIEFYLNGTIADLY-DGMLM 58

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA   + + I   + I + GDYD+DG  +  ++   +S      +  IPDRI DGY
Sbjct: 59  MDMDKAVEILAEKIRGGDAIRVIGDYDIDGVNATYVLQEGISRLGGVVDTDIPDRIRDGY 118

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV-------KSEE 188
           G N  L+++ + +G   IIT D G  + D + Y   QG+ +IV DHH+V       + E 
Sbjct: 119 GLNRMLIDRALEDGIDTIITCDNGIAASDEIAYGKQQGLTIIVTDHHEVPYLDAGGEKEY 178

Query: 189 I--PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVA 246
           +  PA A+V+P+R D       LC A V + ++  +Y ++++D       D+  L++ VA
Sbjct: 179 LLPPADAVVDPHRPDCEYPFKGLCGAAVAYKLVEALYEVMQKDVD-----DIDYLMENVA 233

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSI 305
           +ATV DV+ L G NR +V +GL + +R GNPGLKALIE   +    ++A ++G+++GP I
Sbjct: 234 IATVGDVMDLQGENRIFVKQGLEMLKRTGNPGLKALIECTGVPVDRLSAYHIGFVLGPCI 293

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NA GR+  +     LL +   +E  MLA  L  LN +R+ M    +EQA  ++  +   +
Sbjct: 294 NASGRLDTAKRALELLNAPSRREAVMLAEDLKALNDSRKEMTEKGVEQAVDQI--ENTSL 351

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           ++  V+VV     H  I G++A R+KE++ RP+F ++  E+G   GSGRSIE +++ + +
Sbjct: 352 KEDKVLVVYLPECHESIAGIIAGRIKERYYRPTFVLTQGEEGVK-GSGRSIESYNMFEEM 410

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
                  +  K GGH +AAGL++E  N  R  +   + A  ++      P   ID  L  
Sbjct: 411 CRC--RALFTKFGGHKLAAGLSLEEDNVDRFRETINELA--VLSEEDLLPKVSIDMQLPL 466

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE--TLQA 543
           + V  AL+  LE   P+G GN  P+FA  N K+   R++      + F+ QD     ++A
Sbjct: 467 AYVTEALVSELEILEPFGKGNTKPLFAEKNLKVLRPRIIGKNQNVLKFQVQDKRGNQMEA 526

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           I F    + L E++ Q   + M  T +  VN + G +  Q+ V++
Sbjct: 527 IYFGDAASCL-EYIRQK--EEMSFTFYPSVNEYMGKRTLQITVVN 568


>gi|293570535|ref|ZP_06681590.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus faecium
           E980]
 gi|291609481|gb|EFF38748.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus faecium
           E980]
          Length = 765

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 178/532 (33%), Positives = 270/532 (50%), Gaps = 29/532 (5%)

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FL+P  + L  DP ++ D DKA  RI +A+ + EKI+++GDYD DG  S  +M   L   
Sbjct: 50  FLHPKEQELH-DPYLMHDMDKAISRIQEAVISGEKILVYGDYDADGITSATVMKETLELL 108

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
                +++P+R V GYGPN S+ ++ I EG QLIITVD G    DA+ YA   G+DVI+ 
Sbjct: 109 GAEVEVFLPNRFVHGYGPNQSVYQEKIQEGIQLIITVDNGVAGNDAVAYAQQAGVDVIIT 168

Query: 180 DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           DHH++  +   AYA+V+P           L   GV F V   +        + P  F   
Sbjct: 169 DHHELPEKLPDAYAIVHPRHPAGQYPFPDLAGVGVAFKVASALL------EEPPAEF--- 219

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE-NLG 298
             LDLVA+ T+ D+V L   NR  V  G+         GL+AL E   +      E  +G
Sbjct: 220 --LDLVAIGTIADLVSLTDENRILVALGIDAIHHSERIGLQALFEESGVKMRDADETTIG 277

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           + I P +NA GR+G+      LL + D +E  + A KL+ +N+ R+    A++EQ   + 
Sbjct: 278 FSIAPRLNAIGRMGDPRPAVSLLATFDEEEASIQAKKLNEINEERK----AIVEQITEEA 333

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           L   +      ++V  G  WH G++G++A ++  + G+P+  ++ +EDG   GSGRSIE 
Sbjct: 334 LAMVNKENHIHLLVNRG--WHEGVLGIVAGKIMNETGKPTLVLTLKEDGSAKGSGRSIEA 391

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            ++ +M+    +  +    GGH  A GLT+   N   L +   ++  +    L   P  +
Sbjct: 392 LNLFEMLDQMRD--LFTYFGGHHAAVGLTMPSENVTILQEKMNQYIVDRQIDLTRGPELR 449

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQ 536
           ID VL  + V +  ID L+   P+G  NP P F F   +  +++ +  N  HL+    S 
Sbjct: 450 IDEVLLPNEVTVERIDELKLLAPFGTDNPLPQFLFRQVQAANVKRIGANQQHLKFVL-SD 508

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
           +S  L A+AF  +GT   E L       + V G L +N W G K+ QL V D
Sbjct: 509 ESSQLDAVAFG-FGTQEEELL----NNLVDVVGKLSINEWNGRKKPQLMVSD 555


>gi|226311467|ref|YP_002771361.1| hypothetical protein BBR47_18800 [Brevibacillus brevis NBRC 100599]
 gi|226094415|dbj|BAH42857.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 782

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 188/573 (32%), Positives = 295/573 (51%), Gaps = 39/573 (6%)

Query: 30  ALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLILTDCDKAARRIVQA 88
           A +I     +  +V+++LV R +     A+DFL     L   DP +L   +++  RI QA
Sbjct: 18  AASIAADCQLTPLVSKLLVIRGIDTSQKARDFLQAGPELFH-DPFLLDGMEQSVHRIQQA 76

Query: 89  IYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINE 148
           I   E I I+GDYD DG +S +LM+  L       + YIP+R  +GYG +   +      
Sbjct: 77  IQRQEPICIYGDYDADGVSSTSLMVHLLRQLGAVFDYYIPNRFTEGYGLHKDALAHLHQS 136

Query: 149 GAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGH 208
           G +LIITVD G ++ + + YA   G+DVIV DHH+  +    A+A++NP +         
Sbjct: 137 GYKLIITVDTGISAVEQVAYANQLGLDVIVTDHHEPPAVIPEAFAVINPKKPGCSYPFDM 196

Query: 209 LCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGL 268
           L   GV F V    + +L++    PL+     L DL AL T+ D+VPL+  NR     GL
Sbjct: 197 LAGVGVAFKV---GHALLKEP---PLH-----LADLAALGTIADLVPLVDENRILARAGL 245

Query: 269 MVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQ 327
                  N GL+ALI    ++ + ++A ++G+ +GP +NA GR+  +    +LL + D  
Sbjct: 246 KRLNHTRNLGLQALIRVCGLADTELSAGHVGFALGPRLNASGRLETAESAVKLLTTSDMD 305

Query: 328 ELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLA 387
           E E  A  LD LN+ R+ + +AM E+A  +++ +     Q +V+V+  + W+ G+VG++A
Sbjct: 306 EAEKCAQALDDLNRERQEIVAAMTEEA-VQMVNELYPPDQNNVLVLAKEGWNVGVVGIVA 364

Query: 388 ARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGL 446
           +RL E F RP+  +  + E G   GS RSI GFD+ + ++   E   L   GGH MAAG+
Sbjct: 365 SRLVELFYRPTIVLGIDPEKGTAKGSARSIAGFDMYEGLTACKE--WLPHYGGHTMAAGM 422

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           T+   N   L     + A   + +   TP+ K+D  ++   +++   + LE   PYG GN
Sbjct: 423 TLPVENLDLLRQKLNELAGEWLSSEDFTPMTKVDVAMSMEEISLTAAEQLEQLAPYGMGN 482

Query: 507 PNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAF-------RVYGTPLGEFL 557
           P P+      + Q +R +  +  HL+ T  ++   +L AI F       RV  TP   F 
Sbjct: 483 PTPLVLLEEVETQGMRTIGRDDNHLKCTL-NKAGTSLDAIGFNWAHVTKRV--TPKARF- 538

Query: 558 MQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                   HV G L VN W G+++ QL + D S
Sbjct: 539 --------HVLGELSVNEWNGNRKPQLTIRDLS 563


>gi|269798273|ref|YP_003312173.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella parvula
           DSM 2008]
 gi|269094902|gb|ACZ24893.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella parvula
           DSM 2008]
          Length = 661

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 184/554 (33%), Positives = 289/554 (52%), Gaps = 22/554 (3%)

Query: 42  IVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDY 101
           IVA+++VNR++ +D  + FL  ++  L+ DP  L D D A   +++ I + + I+I+GDY
Sbjct: 30  IVAKLMVNRHIDVDEGRRFLQGTLSDLL-DPFTLKDMDVAVSLVLETIESHKPIVIYGDY 88

Query: 102 DVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGST 161
           DVDG  + +++ RFL     +   YIP+R  +GYG N   ++  I  G  L+ITVDCG +
Sbjct: 89  DVDGITATSVLYRFLKKLGADVTYYIPERQSEGYGLNLEALKHLIERGTDLVITVDCGIS 148

Query: 162 SYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVL 221
           SYD ++ A    I++I+ DHH        A A++N  + D      +L   GV F +   
Sbjct: 149 SYDIVE-AVRDRINMIITDHHTAPDVIPRAKAVINHKQKDCPYKDKNLSGVGVAFKLCQA 207

Query: 222 IYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKA 281
           ++  L +  +  L+      LD+VAL TV DVVPL+G NR  V  GL       N G+  
Sbjct: 208 LW--LTKHGEWYLDD-----LDIVALGTVADVVPLVGENRIIVKSGLEKMNSYPNLGINK 260

Query: 282 LIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLN 340
           LI+   +    IT+ ++GY + P +NA GR+  +     LL++DD+   E +A +L+  N
Sbjct: 261 LIDVAGLHERTITSGHIGYTLAPRLNAAGRVTHATRAVELLVTDDADIAEAIAEELNETN 320

Query: 341 QNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFA 400
           + R+ +E  + E A   V  Q    +   V +V G+ WHPG++G++A+RL E+F +P+  
Sbjct: 321 RERQELERNIHELARIDVANQGH--KADYVTIVAGEEWHPGVIGIVASRLVEEFYKPTLV 378

Query: 401 ISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFF 460
           IS   DG G GS RSI+GF+I   +     E IL++ GGH+ AAG +++      L    
Sbjct: 379 ISI-HDGVGKGSCRSIDGFNIYDALKSC--EDILLQFGGHSAAAGFSIDANRIDELRYRL 435

Query: 461 QKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQS 520
            K+   +V A    PV  ID  L    +++ +ID +    PYG  N  PVFA     +Q 
Sbjct: 436 TKYCKEVVTAEEYIPVVAIDAELPVDDIDVDIIDRVSDLEPYGMANSTPVFAIMEATVQD 495

Query: 521 IRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRG 578
           I ++     H ++ F + +  TL AIA+         F+    G  + V   L  N W+G
Sbjct: 496 IMLMGQLKNHCKVIFATSNG-TLDAIAWNCPDLFRSIFV----GTVVKVAFSLQKNEWQG 550

Query: 579 SKRCQLRVLDASPV 592
               QL +    P+
Sbjct: 551 LVSPQLMIQAIEPL 564


>gi|163942159|ref|YP_001647043.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           weihenstephanensis KBAB4]
 gi|163864356|gb|ABY45415.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           weihenstephanensis KBAB4]
          Length = 773

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 189/577 (32%), Positives = 295/577 (51%), Gaps = 27/577 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E +   LA   K  +  +V  + + R ++  D   DFLN + +    DP +L
Sbjct: 7   RWKEKEYNEELVSELA--NKLQLSPLVTSLFLGRGLNTEDKIVDFLNTADQEFH-DPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L         YIP+R  +GY
Sbjct: 64  EGMDRTVERVKKAIENGEQILIFGDYDADGVSSTTVLYLALKELGAEVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +        +VP +     LL++  + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALL------GRVPEH-----LLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S S IT E++G+ + P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFALAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       ++  V+V+ 
Sbjct: 293 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPP-EENKVLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGK-GIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S +   +   GS RSI GFD+   +S   E  +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLSIDPHKETAKGSARSIAGFDLFANLSDCRE--L 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ A    P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLNMNDVDELRRRLNEQADVILTAEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +  + +HL+M      + TL  I F  +GT
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQA-TLDTIGFG-FGT 527

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              E    S   ++ V G + +N W   K+ QL V D
Sbjct: 528 YAKEI---SPVAKVSVVGEVSINEWNNFKKPQLMVQD 561


>gi|126653977|ref|ZP_01725814.1| YrvE [Bacillus sp. B14905]
 gi|126589534|gb|EAZ83676.1| YrvE [Bacillus sp. B14905]
          Length = 773

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 181/589 (30%), Positives = 301/589 (51%), Gaps = 25/589 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           +S  RW   + +  +N   A+     +  I A++L  R        + L       + DP
Sbjct: 3   LSKKRW--QVERPDVNLVQALQNDLQLSAIAAKILAARGCETTADAESLLNMTEANVHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++    +A  RI QA+ N EKI+++GDYD DG  S  +M+  L +   + +  IP+R +
Sbjct: 61  FLMHGMTEAVARIEQALDNGEKILVYGDYDADGVTSTTVMLNVLLNLGADVSFKIPNRFI 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
            GYGP+ +L  +   EG QLIITVD G +  + ++ A   G+DVIV DHH+   E  PA 
Sbjct: 121 HGYGPHEALFREAYEEGVQLIITVDNGISGIEPIRVAKELGLDVIVTDHHEPGEELPPAD 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
            +++P   +     G L   GV F +   +Y       ++P +     LL+ VA+ TV D
Sbjct: 181 IILHPRIPEGHYPFGELAGVGVAFKLAHALY------GELPTH-----LLEYVAIGTVAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRI 311
           +VPL+  NR  V +G+   RR  +P ++A+ +  +   + I  E +G+  GP  NA GR+
Sbjct: 230 LVPLVDENRYLVKRGIEEMRRSLSPWVQAMCDIASTEQAKINEETIGFYFGPRFNAVGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
           G+++ G  LL+++DS +   LA +L+  N  R+ +  ++ ++A A +  +   I  + V+
Sbjct: 290 GDASPGVELLMAEDSAKATALAKQLNACNTERKDIVKSITDEAIALIEAE-KKISDSLVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVE 430
           VV G+ W+ G+VG++A+RL E++ RP+  +S + D G   GS RSIEGF +      A  
Sbjct: 349 VVAGEGWNAGVVGIVASRLVEQYYRPTIVLSLDPDKGTAKGSARSIEGFHLYN--ELAKN 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T+   +   L       A   +     TPV  ID  L+   ++ 
Sbjct: 407 RDILPHFGGHPMAAGMTLSIEHVDELRSRLDTQARACLTEEQLTPVVHIDIPLSLDEISA 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRV 548
             I+ + + GPYG   P PV+   + ++ S+R +  A  H++M   +   + L ++ F  
Sbjct: 467 DAIEEISTLGPYGTDFPKPVYVLEDVEISSMRKIGAAENHIKMEL-TNGYDKLDSVGF-- 523

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
           +   L + L  + G ++   G L +N W+G K+ Q  + D    E   F
Sbjct: 524 HKGHLHDEL--TYGIKVSFIGDLQINEWQGRKKAQFMIEDVQTTEWQLF 570


>gi|170755730|ref|YP_001782370.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum B1 str. Okra]
 gi|169120942|gb|ACA44778.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           botulinum B1 str. Okra]
          Length = 593

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 190/587 (32%), Positives = 304/587 (51%), Gaps = 46/587 (7%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
           I  K  I + +  VLVNR + +++  KDFL PS+  L  +PL++ D DK    I ++I +
Sbjct: 17  IANKSGISETLCTVLVNREIYNLEDIKDFLEPSLEKLY-NPLLMKDMDKGTEIIKRSIID 75

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            +KI I+GDYD DG  S  ++   L  C  N   YIPDR  +GYG     +E+   EG +
Sbjct: 76  KKKIAIYGDYDADGVTSTVILYIALKECEANVIYYIPDRETEGYGMCTERVERLKAEGVE 135

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQV-----KSEE----IP-AYALVNPNRLD 201
           +IIT D G  + + ++ A   G+ V++ DHH++     + EE    +P A A++NP + D
Sbjct: 136 VIITCDNGIAALEQVERAKELGMTVVITDHHELPFIENEKEEREYVVPKADAIINPKQKD 195

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNR 261
                  LC AG+ F    L+Y  L   N  P  +    LL   A+ T+CDVV L G NR
Sbjct: 196 CYYPFKMLCGAGIAFKFSKLLYEKL---NMNPNKYK--ELLQFAAIGTICDVVDLKGENR 250

Query: 262 AYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRL 320
                GL       N GL+ALI+  +++   IT+ N+G++IGP INA GR+  + L   L
Sbjct: 251 IIAKLGLESINNTNNLGLRALIKETSLNEKNITSYNVGFIIGPCINATGRLDTAALSVEL 310

Query: 321 LISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHP 380
            ++ D +  E LA +L  LN  R+  E  M    E     +   ++   V+V+  +  H 
Sbjct: 311 FLAKDIKRAEELAKELRNLNTERQ--EITMEGVEEITYTIENSSLKNDKVLVIYKENIHE 368

Query: 381 GIVGLLAARLKEKFGRPSFAISFEEDGKGI--GSGRSIEGFDIGKMVSFAVEEGILVKGG 438
            I G+++ R+K+ + RP+  ++    GK +  GSGRSI+G+++ + +    E   + K G
Sbjct: 369 SIAGIVSGRIKDAYNRPTIVLT---KGKEMPKGSGRSIDGYNLFEELMKCKE--YIYKFG 423

Query: 439 GHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLES 498
           GH MAAGLT+E  N  +L +   K  +      I  P  +ID  L    VN+ LID L+ 
Sbjct: 424 GHPMAAGLTIEEKNIDKLREELNKNCNLKDEDFI--PKIRIDKRLPLKEVNLELIDSLQC 481

Query: 499 AGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDS-ETLQAIAF--------- 546
             P+G GN +P+ A  N K++ IR++  +   L++T   +D+ + + AIAF         
Sbjct: 482 LEPFGKGNSSPILAEKNIKIEGIRILGKDQNTLKLTCRVKDTNKRIHAIAFGKVGEFKRD 541

Query: 547 --RVYGTPLGEFLMQS---RGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              +Y     E ++ +    G ++ +  +  +N + G+   QLR++D
Sbjct: 542 LENIYEDENVENIITNPLMAGLKLDLIYYPMINEYNGNVYTQLRIID 588


>gi|134298599|ref|YP_001112095.1| single-stranded-DNA-specific exonuclease RecJ [Desulfotomaculum
           reducens MI-1]
 gi|134051299|gb|ABO49270.1| exonuclease RecJ [Desulfotomaculum reducens MI-1]
          Length = 885

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 183/553 (33%), Positives = 282/553 (50%), Gaps = 21/553 (3%)

Query: 39  IPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           I  I A++L+NR + ++D A+ FL   +   M  P ++ D  KA  RI+ A    E+I++
Sbjct: 26  ISKIFAQLLINRGIYTVDQARAFLGSELDK-MFSPWLMQDMKKAVERILGARDKGEQILV 84

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           +GDYDVDG     +++  L      A+ +IP R+ +GYG N   +E+ +  G  L++TVD
Sbjct: 85  YGDYDVDGITGTTVLVLALRRLGCKADYFIPHRLEEGYGLNKVALERAVERGVSLVVTVD 144

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
           CG +  + ++ A   G++V++ DHH+   +   A A+++P R         L   GV   
Sbjct: 145 CGISGAEEVEVAKALGLEVVITDHHEPPVQLPAAVAILDPKRSGCSYPFKELAGVGV--- 201

Query: 218 VLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNP 277
            L LI  +  Q      N++    LDLV L TV D+VPL G NR  V  GL        P
Sbjct: 202 ALKLIQGLFEQAGLSQRNWE--EYLDLVCLGTVADIVPLQGENRILVKHGLPQISNSKRP 259

Query: 278 GLKALIERVNISSPIT-AENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKL 336
           GL+ALI+   I + +     LG+ + P +NA GR+G++ LG  LL+++D    E +A +L
Sbjct: 260 GLQALIKVSGIKAEVLGTRELGFGLAPRLNAAGRMGDAGLGVELLLAEDLLVAEEMAEEL 319

Query: 337 DVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGR 396
           D  N  R+ +ES +L +A A +L    +I Q  V+V+  + WHPG++G++A+RL ++F R
Sbjct: 320 DRGNHERQQVESKVLSEALA-LLETDSEISQGKVLVLASENWHPGVIGIVASRLVDRFYR 378

Query: 397 PSFAISFEEDGKGIGSGRSIEGFDIGK-MVSFAVEEGILVKGGGHAMAAGLTVERVNFGR 455
           P F IS EE GKG GS RSI GF++ + MVS    +  L + GGHAMAAG ++       
Sbjct: 379 PVFMISLEE-GKGKGSARSIPGFNLYQAMVSC---QDHLEQFGGHAMAAGFSIHVDKINE 434

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
                   A   +     TP   +D ++N + +++  +  L    P G  NP P+     
Sbjct: 435 FRKTINAMAEEFLSEEHLTPNLDLDALINLNDLSMDTVQELNQLSPLGHCNPGPILGCCQ 494

Query: 516 HKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCV 573
             + + R V  N  HL+M    +D   L  I F +      E L  +    M       +
Sbjct: 495 ATVINCREVGKNGGHLKMRVR-EDHTVLDGIGFNL--ASYSEMLAANDTVDMAFIP--SI 549

Query: 574 NYWRGSKRCQLRV 586
           N W G    QL V
Sbjct: 550 NVWNGRTSVQLEV 562


>gi|304385115|ref|ZP_07367461.1| single-stranded-DNA-specific exonuclease RecJ [Pediococcus
           acidilactici DSM 20284]
 gi|304329309|gb|EFL96529.1| single-stranded-DNA-specific exonuclease RecJ [Pediococcus
           acidilactici DSM 20284]
          Length = 773

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 179/557 (32%), Positives = 286/557 (51%), Gaps = 34/557 (6%)

Query: 42  IVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGD 100
           I+ R+LV R   + D   +FL    + ++ DP +L D  KA  RI+ AI  +EKI+++GD
Sbjct: 30  IIVRILVARGFRTADEMTNFLAMD-QSVVHDPFLLHDMQKAVERIMSAIEANEKILVYGD 88

Query: 101 YDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFI-NEGAQLIITVDCG 159
           YD DG  S  +M   L+    + N ++P+R  DGYGPN +  + FI NE  QLI+TVD G
Sbjct: 89  YDADGVTSTTIMYETLAQLGADVNYFVPNRFKDGYGPNLAEYQHFINNEQVQLIVTVDNG 148

Query: 160 STSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVL 219
               +A+ YA   G+DV+V DHH++  +   AYA+V+P   +     G L   GV F V 
Sbjct: 149 VAGNEAINYAQEHGVDVVVTDHHEMPDQLPNAYAIVHPRHPEGEYPFGDLSGVGVAFKVA 208

Query: 220 VLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGL 279
             +        +VP  F     LDL A+ T+ D+V +   NR  V  GL +       GL
Sbjct: 209 CALLE------EVPEEF-----LDLYAIGTIADLVSMTDENRLLVKLGLQLIPETSRIGL 257

Query: 280 KALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDV 338
           + LI    + +S I  E +G+ + P INA GR+G+++   +LL + D ++   +A  ++ 
Sbjct: 258 QKLIAVAGVETSQIDEETIGFTVAPRINAVGRLGDASQAVKLLTTFDEEQATAIAKDINA 317

Query: 339 LNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPS 398
            N  R+ + + + E A    + + +  +    +V+ G  WH G++G++A+RL E   +P+
Sbjct: 318 TNTKRQGLVNEIYEMAAE--IAKDEGHRDLQTLVISGHDWHQGVLGIVASRLVELTNKPT 375

Query: 399 FAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVE--EGILVKGGGHAMAAGLTVERVNFGR 455
             +S + +DG   GSGRS+   ++ + ++ A E  EG     GGH MA G+TV+  N   
Sbjct: 376 IVLSDQNQDGVYKGSGRSVANLNLFEALNPAREHFEGF----GGHHMAIGITVKEANLPV 431

Query: 456 LCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPN 515
           L D  +K A          P   +D  +  S ++  L+  ++  GP+G  NP P  A  N
Sbjct: 432 LADQLEKAAEQAQLDFRQRPQLNLDATVAISELSTDLVTKIKQLGPFGMDNPVPKLAITN 491

Query: 516 HKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFL--MQSRGKRMHVTGHL 571
            ++  ++ +  N AHL+ T  +Q  + L AIAF+      GE    +      + + G L
Sbjct: 492 VRVTDVKAIGQNQAHLKFT-ANQAGQQLAAIAFQ-----RGEIADKLSHLSNTIDLAGTL 545

Query: 572 CVNYWRGSKRCQLRVLD 588
            +N WRG+   QL   D
Sbjct: 546 GINEWRGNVTLQLMTED 562


>gi|218439815|ref|YP_002378144.1| single-stranded-DNA-specific exonuclease RecJ [Cyanothece sp. PCC
           7424]
 gi|218172543|gb|ACK71276.1| single-stranded-DNA-specific exonuclease RecJ [Cyanothece sp. PCC
           7424]
          Length = 654

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 178/568 (31%), Positives = 293/568 (51%), Gaps = 34/568 (5%)

Query: 33  ITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI-LTDCDKAARRIVQAIY 90
           + Q   +  ++A+VLVNR ++  + A+ +L P  +LL P PL    D   +   +  AI 
Sbjct: 21  LVQTTGLLPLMAQVLVNREINTPELAQVYLEPESQLL-PQPLEEFPDLGVSVELLQDAIA 79

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
           + +KI+I GDYD DG  S AL++R L H   + +  IP R+ +GYG N  ++E   + G 
Sbjct: 80  SQDKIVICGDYDADGMTSTALLLRALKHLGADVDYAIPSRMKEGYGINTRIVEDCASSGV 139

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
            LI+TVD G ++Y+ +  A + G+ VI+ DHH +  +  PA A++NP  L + S    L 
Sbjct: 140 GLILTVDNGISAYEPIARAIDLGLSVIITDHHDLPEKLPPADAILNPKLLPESSPYRGLA 199

Query: 211 AAGVVFLVLVLIYRILRQDNKVPLNFDLLS-----LLDLVALATVCDVVPLIGLNRAYVV 265
             GV +++ V   +          N  LL      LL+L  L T+ D+ PL+G+NR ++ 
Sbjct: 200 GVGVAYILAVTTAQ----------NLGLLKGLTDQLLELFTLGTIADLAPLVGVNRRWLK 249

Query: 266 KGLMVARRQGNPGLKALIERVNISSP---ITAENLGYMIGPSINAGGRIGESNLGSRLLI 322
           +GL    +    G++ALI+   +S     +  +++G+ +GP INA GRIG+  L   LL 
Sbjct: 250 RGLRKLPKSQLAGIQALIQMAGVSEEQKQLQPDDIGFKLGPRINAIGRIGDPQLVIELLT 309

Query: 323 SDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGI 382
           +D+       AM+ + +NQ R+ +   + E+A   + T   + QQ  V+V+    WH G+
Sbjct: 310 TDEEGLALERAMQCEQINQKRQQLCKKIEEEAINLIETLPVNWQQDRVLVIVQPHWHHGV 369

Query: 383 VGLLAARLKEKFGRPSFAISFEED--GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGH 440
           +G++A+RL E++G P F  ++EE+   K  GS R IE F + + + F   + +L K GGH
Sbjct: 370 IGIVASRLVERYGAPVFIGTYEEEEPEKIRGSARGIEEFHVFEALEFC--DDLLGKYGGH 427

Query: 441 AMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAG 500
             A G ++   N     +   +FAH  +      P+ KID   +   +   L   +++  
Sbjct: 428 KAAGGFSLPIQNLEAFKERLSRFAHQCLKPEYLKPLIKIDAQTDFKQLTPYLYQQIDNLQ 487

Query: 501 PYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGT-PLGEFLMQ 559
           P+G GN  PVF   N KL   R+V   HL++    +D   ++AIA+R     PL   L  
Sbjct: 488 PWGIGNDFPVFWTANVKLIEQRIVGQKHLKLVLAQEDGTEIKAIAWRWADYFPLPTCL-- 545

Query: 560 SRGKRMHVTGHLCVNYWRGSKRCQLRVL 587
                  +   L  N+W G+   +L ++
Sbjct: 546 ------DIAYKLKENHWNGNTTIELEII 567


>gi|197121723|ref|YP_002133674.1| single-stranded-DNA-specific exonuclease RecJ [Anaeromyxobacter sp.
           K]
 gi|196171572|gb|ACG72545.1| single-stranded-DNA-specific exonuclease RecJ [Anaeromyxobacter sp.
           K]
          Length = 573

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 201/558 (36%), Positives = 291/558 (52%), Gaps = 25/558 (4%)

Query: 42  IVARVLVNR-NVSIDYAKDFLNPSIRLL-MPDPLILTDCDKAARRIVQAIYNSEKIMIFG 99
           + ARVL  R +     A+ FL  + RL  +PDP  +   D A  RIV+A+   E+I  +G
Sbjct: 31  LAARVLTARGHADPAEAEAFL--AARLADLPDPFRMKGMDAAVERIVRALEGGERIACYG 88

Query: 100 DYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCG 159
           DYDVDG  S AL+  FL     +   Y P R+V+GYG N   +     +G +L++T+DCG
Sbjct: 89  DYDVDGVTSTALLCGFLRAAGADVVTYTPHRLVEGYGLNGDAVRSLAGQGVRLLVTLDCG 148

Query: 160 STSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF-LV 218
            TS D ++ A   G+D +V+DHH V  E   A A++NP++         L A GV F L 
Sbjct: 149 ITSVDEVRVAAGLGLDTVVVDHHTVPVELPAAAAILNPHQPGCGYPSKDLAAVGVTFALA 208

Query: 219 LVLIYRILRQDNKVPLNFD--LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGN 276
           + L  R+  +    P   +  L   LDLVAL TV DVVPL+G NR  V  GL        
Sbjct: 209 MALRRRLRERGRFGPARPEPNLKEALDLVALGTVADVVPLVGANRILVRWGLEQLATSRR 268

Query: 277 PGLKALIERVNIS--SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAM 334
           PG++AL     I+  +P+TA  +G+ + P INA GR+ ++  G RLL+S D+   + LA 
Sbjct: 269 PGVRALKRVAGIADGTPVTAGQVGFRLAPRINAAGRLDDAGRGVRLLLSGDAAAAQALAD 328

Query: 335 KLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKF 394
           +LD  NQ R+ +E  +LEQA A    +     +  V+  +G  WH G+VG++A+R+ E+F
Sbjct: 329 ELDRENQARQEIERRILEQALADAAARVAAGARGLVLARDG--WHAGVVGIVASRVVERF 386

Query: 395 GRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFG 454
            RP+  I+  EDG G GSGRSIEGF +    + A   G L + GGH  AAG+TVER    
Sbjct: 387 HRPAVLIAL-EDGAGKGSGRSIEGFHL--YDALAACSGHLARFGGHRHAAGVTVERAQVE 443

Query: 455 RLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFP 514
                F+  A   +      P  +IDG +  + V     + L   GP+GAG+P PVFA  
Sbjct: 444 PFRAAFEAHAAATIADEDLVPRCRIDGWVGDAEVTEDAAEALGRLGPFGAGHPEPVFALR 503

Query: 515 NHKLQSIRV-VNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCV 573
               ++  V    AHL++         L AI F      +G+    + G  +     +  
Sbjct: 504 GAAARARTVGAGGAHLKLAL----GRGLDAIGF-----GMGD-RAPACGGPVDAAFTIGF 553

Query: 574 NYWRGSKRCQLRVLDASP 591
           + W G++R QL++ D  P
Sbjct: 554 DEWDGTRRLQLKLKDLRP 571


>gi|147677378|ref|YP_001211593.1| hypothetical protein PTH_1043 [Pelotomaculum thermopropionicum SI]
 gi|146273475|dbj|BAF59224.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 946

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 180/562 (32%), Positives = 294/562 (52%), Gaps = 23/562 (4%)

Query: 33  ITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYN 91
             +K  I  + A++L+NR + +++  + F+   +  L   P +L D D A  RI+QA+  
Sbjct: 68  FARKLDISPVTAQLLINRGIYTVEQGRAFIGSELSRLH-RPELLRDMDTAVARILQAVEA 126

Query: 92  SEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ 151
            EKI+I+GDYD DG  + AL+++       +A+ YIP R+ +GYG +   ++K + +G  
Sbjct: 127 GEKILIYGDYDADGITATALLIKVFRRLGADADYYIPGRLEEGYGVHLEPLQKALQKGTG 186

Query: 152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCA 211
           L++TVDCG ++    ++A   G+D+I+ DHH+   E   A A++NP R D       L  
Sbjct: 187 LVVTVDCGISALAEAEWARANGLDLIITDHHEPPPEIPNACAVINPKRPDCSYPFKELAG 246

Query: 212 AGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVA 271
            G+   +   +        K  L++     LDL  L TV D+VP+ G NR  V  GL   
Sbjct: 247 VGLALKLAQALLERTGAGEKAWLDY-----LDLACLGTVADIVPVQGENRILVKHGLPRL 301

Query: 272 RRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
              G+PGL+AL+    I    ++   +GY + P +NA GRIG   +G RLL++DD +E  
Sbjct: 302 AGTGSPGLQALMAVSGIKGDNLSPREVGYALAPRLNAAGRIGTPQMGVRLLMTDDLEEAR 361

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD-IQQASVIVVEGDRWHPGIVGLLAAR 389
            LA +L+  NQ R+ +ES + E  EA  L + D  + +A V V+    WH G++G++A+R
Sbjct: 362 HLAGELNRYNQVRQKIESKVFE--EALSLLEADPGLAEAPVPVLASPGWHAGVIGIVASR 419

Query: 390 LKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
           L EK  RP   IS E +  G GS RSI GF++ K +S   E   L++ GGHA+AAG  VE
Sbjct: 420 LAEKLYRPVLLISLEGE-LGRGSARSIPGFNVYKALSHCHE--YLLEYGGHALAAGFKVE 476

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
                 L      +A   V A    P  ++DG++    V+  L++ ++   P+G  NP+P
Sbjct: 477 GGMVEDLRKKINGYARTAVEAEKLIPYLELDGIVEVGQVSEELVNEIKLLSPFGPSNPDP 536

Query: 510 VFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRVYGTPLGEFL-MQSRGKRMH 566
           +       +   RV+    +HL++    +++  +  I F      LG +  + +  +++ 
Sbjct: 537 LLCCLEAFVLESRVIGKGSSHLKLRLRGKNT-VMDGIGFN-----LGAYAEVLATAEKVD 590

Query: 567 VTGHLCVNYWRGSKRCQLRVLD 588
           +     +N + G +  QL V D
Sbjct: 591 LAFVPGINEYNGRRSLQLEVKD 612


>gi|325105083|ref|YP_004274737.1| exonuclease RecJ [Pedobacter saltans DSM 12145]
 gi|324973931|gb|ADY52915.1| exonuclease RecJ [Pedobacter saltans DSM 12145]
          Length = 577

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 178/584 (30%), Positives = 297/584 (50%), Gaps = 25/584 (4%)

Query: 9   VECSISGFRWVSLL--GQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSI 65
            +C     RW   L    E +++   + Q+  I DI+A +L NR + S   AK F  P +
Sbjct: 7   TQCKYMEKRWAEHLITNFEAVDK---LAQELNISDILAHMLYNRGITSFSEAKAFFRPEL 63

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           + L  DP ++   ++A  RI +AI  +E I+++GDYDVDG  SVAL+  F      N + 
Sbjct: 64  QHLH-DPFLMNGMEEAVARIEEAIRENENILVYGDYDVDGTTSVALVYSFFKEIYPNISY 122

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDR ++GYG +   ++   +    LII +DCG  + D ++YA ++GID I+ DHH + 
Sbjct: 123 YIPDRYIEGYGISSQGIDFAADNDVSLIIALDCGIKAVDKVEYAKSKGIDFIICDHH-LP 181

Query: 186 SEEIP-AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
            EEIP A A+++P RLD       L   G+ F +     +   + N VP    +   LDL
Sbjct: 182 GEEIPAAVAVLDPKRLDCNYPYKELSGCGLGFKLA----QAYAEKNDVPFE-KVCEYLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VA++   D+VP+ G NR     GL         GLKALIE    +   T  ++ + IGP 
Sbjct: 237 VAVSIASDIVPITGENRVLAYYGLQKLNNNPCNGLKALIELSGKTDRFTISDIVFSIGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INA GRI ++    RLLI+  +Q  E     +++ N  R+  ++ + EQA   + +  + 
Sbjct: 297 INAAGRIDDAKHSVRLLIASSTQLAEDAGFIINLKNTERKEYDTNITEQALNMIGSSPEM 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
           I + S +V + + WH G++G++A+RL EK+ +P+  ++ + +G   GS RS+ G+D+ + 
Sbjct: 357 IGRKSTVVYDKN-WHKGVIGIVASRLTEKYYKPTVVLT-DSNGHVAGSARSVLGYDLYEA 414

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +    +  +L + GGH  AAGLT++  N  +  + F+    + +   +      ++  + 
Sbjct: 415 LCECSD--LLEQFGGHKYAAGLTMKPENVNKFIERFETVVASSITEEMLVQQISVEKCIG 472

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPN-HKLQSIRVVNLAHLQMTFESQDSETLQA 543
            S +      +L    P+G  N  P+F     +      +V   HL+M+   +DS   + 
Sbjct: 473 LSDITPKFFRILNQFAPFGPQNMVPIFMTREVYSYGYGSIVGNNHLKMSVRQKDSSVFEC 532

Query: 544 IAFRVYGTPLGEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRV 586
           I F      LG++L Q +RG    +   +  N W+  +  QL +
Sbjct: 533 IGF-----GLGDYLEQINRGTPFDICYTIEENVWKDRRSIQLNI 571


>gi|257884694|ref|ZP_05664347.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus faecium
           1,231,501]
 gi|261207763|ref|ZP_05922448.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus faecium
           TC 6]
 gi|257820532|gb|EEV47680.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus faecium
           1,231,501]
 gi|260078146|gb|EEW65852.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus faecium
           TC 6]
          Length = 744

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 179/534 (33%), Positives = 271/534 (50%), Gaps = 29/534 (5%)

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FL+P  + L  DP ++ D DKA  RI +A+ + EKI+++GDYD DG  S  +M   L   
Sbjct: 29  FLHPKEQELH-DPYLMHDMDKAISRIQEAVISGEKILVYGDYDADGITSATVMKETLELL 87

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQG