BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780901|ref|YP_003065314.1| single-stranded-DNA-specific
exonuclease protein [Candidatus Liberibacter asiaticus str. psy62]
         (600 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780901|ref|YP_003065314.1| single-stranded-DNA-specific exonuclease protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040578|gb|ACT57374.1| single-stranded-DNA-specific exonuclease protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 600

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 600/600 (100%), Positives = 600/600 (100%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF
Sbjct: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS
Sbjct: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID
Sbjct: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS
Sbjct: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM
Sbjct: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT
Sbjct: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD
Sbjct: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID
Sbjct: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET
Sbjct: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK
Sbjct: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600


>gi|315122680|ref|YP_004063169.1| single-stranded-DNA-specific exonuclease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496082|gb|ADR52681.1| single-stranded-DNA-specific exonuclease protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 596

 Score =  511 bits (1316), Expect = e-142,   Method: Composition-based stats.
 Identities = 489/596 (82%), Positives = 543/596 (91%), Gaps = 1/596 (0%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           MN QAFLGVE SISGFRW+SLLGQE INRALAITQKHAIPD+VARVLV R+VSID A++F
Sbjct: 1   MNYQAFLGVERSISGFRWLSLLGQEEINRALAITQKHAIPDLVARVLVGRHVSIDCAEEF 60

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           LNPSIR LMP+PL LTDCDKAARRIVQAIYNSEKI I GDYDVDGAASVALMMRF S+  
Sbjct: 61  LNPSIRSLMPNPLTLTDCDKAARRIVQAIYNSEKIAILGDYDVDGAASVALMMRFFSYYG 120

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           V++NMYIPDRI+DGYGPNP LM+K I+EGAQLIITVDCGSTS++ALQ+++NQGIDVIVID
Sbjct: 121 VDSNMYIPDRILDGYGPNPDLMKKIIDEGAQLIITVDCGSTSHEALQFSSNQGIDVIVID 180

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLL 239
           HHQ+K+EE PAYALVNPNR DDLSGQGHLCAAGVVFLVLV+I RIL+QDNK+P   FDLL
Sbjct: 181 HHQMKTEETPAYALVNPNRSDDLSGQGHLCAAGVVFLVLVMICRILQQDNKIPIKYFDLL 240

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           SLLDLVALATVCDVVPLI LNRAYV KGL+V+R+QGNPGLKALIER+N+S+PITA+NLG+
Sbjct: 241 SLLDLVALATVCDVVPLIDLNRAYVTKGLLVSRKQGNPGLKALIERINLSAPITADNLGF 300

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           MIGP INAGGRIGE+NLGSRLLISDD QELE +AMKLDVLNQNRRLMESAMLEQAE +VL
Sbjct: 301 MIGPCINAGGRIGEANLGSRLLISDDPQELEAIAMKLDVLNQNRRLMESAMLEQAEVEVL 360

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            Q + +QQAS+IVV GD+WHPGIVGLLAARLKEKF RPSFAISF+E GKGIGSGRSIEGF
Sbjct: 361 AQYEHMQQASIIVVAGDQWHPGIVGLLAARLKEKFDRPSFAISFDESGKGIGSGRSIEGF 420

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           DIGKMVSFA EEGIL+KGGGHAMAAGLTVERVNF RL DFFQ FA+  + +L++ PV KI
Sbjct: 421 DIGKMVSFAFEEGILLKGGGHAMAAGLTVERVNFNRLRDFFQAFANKRMSSLVSMPVLKI 480

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG LNASAVNI LI+MLESAGPYG+GNP PVFAFP+HKL+++R+V L HLQMTF+SQDSE
Sbjct: 481 DGALNASAVNIKLIEMLESAGPYGSGNPRPVFAFPSHKLENVRIVKLNHLQMTFKSQDSE 540

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
            LQ IAFRVYGTPLGEFLMQS GK MHV GHLCVN+WRGSKR QLRVLDA+PVE H
Sbjct: 541 VLQGIAFRVYGTPLGEFLMQSHGKWMHVIGHLCVNHWRGSKRAQLRVLDAAPVENH 596


>gi|222085813|ref|YP_002544343.1| single-stranded-DNA-specific exonuclease protein [Agrobacterium
           radiobacter K84]
 gi|221723261|gb|ACM26417.1| single-stranded-DNA-specific exonuclease protein [Agrobacterium
           radiobacter K84]
          Length = 604

 Score =  508 bits (1308), Expect = e-141,   Method: Composition-based stats.
 Identities = 346/590 (58%), Positives = 440/590 (74%), Gaps = 1/590 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S+SG RWVS L Q G NRALA+ Q H +PD++ARVL  R V +D A  FL+P
Sbjct: 14  RAFLGVERSVSGNRWVSRLDQAGQNRALAMAQTHGLPDLIARVLAGRGVGVDEAMAFLDP 73

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP +LTDC+KAA R+++A+   E + IFGDYDVDGAAS AL+ RFL+H  V A
Sbjct: 74  TIRSLMPDPYLLTDCEKAAGRLLRAVKTGETVAIFGDYDVDGAASSALLYRFLTHFGVPA 133

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           ++YIPDRI +GYGPNP+ + + I+ GA LI+TVDCGSTS+++L+ A  + IDV+VIDHHQ
Sbjct: 134 SIYIPDRIFEGYGPNPAAINQLIDNGATLIVTVDCGSTSFESLEAAKARNIDVVVIDHHQ 193

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLL 242
           V  E    +ALVNPNR DDLSGQGHLCAAGVVFLVLV   R LR+   V     DLL+ L
Sbjct: 194 VAHELPHCHALVNPNREDDLSGQGHLCAAGVVFLVLVAALRQLREAGDVRVRTIDLLTWL 253

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR QGNPGL AL  +  +  P++  + G++IG
Sbjct: 254 DIVALATVCDVVPLKGLNRAYVVKGLIAARHQGNPGLAALFRKAGLGGPVSPYHFGFLIG 313

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LG+RLL   D+ E E++A KLD LN+ R+ ME+AML++AEA+ L + 
Sbjct: 314 PRINAGGRIGDAALGARLLTLADTSEAEIIAEKLDELNRERQAMEAAMLQEAEAEALAEY 373

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            +   ASVIV   + WHPGIVGL+A+RLK+KF RP+FAI+F+  GKG GSGRSI GFD+G
Sbjct: 374 GNGDGASVIVTARENWHPGIVGLIASRLKDKFRRPAFAIAFDPMGKGTGSGRSINGFDMG 433

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+ G+LVKGGGHAMAAGLTVER N G+L  FF + A   VP L+     KIDG 
Sbjct: 434 RMVRAAVDAGLLVKGGGHAMAAGLTVERGNLGKLRAFFTEKAERQVPGLVANETLKIDGA 493

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L AS   + LID LE+AGPYG+G+P P+FA P+H+L+  R+V  +H+++T E+QD   L 
Sbjct: 494 LGASGATVDLIDQLETAGPYGSGHPQPIFALPSHRLRDSRLVGQSHIKITLEAQDGGRLD 553

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            IAFR   TPLGE LM SRG ++HV G L  ++W+G++R QLRV DA+  
Sbjct: 554 GIAFRAAETPLGELLMSSRGSQVHVAGTLGADHWQGNRRVQLRVTDAAKA 603


>gi|240850783|ref|YP_002972183.1| single-stranded-DNA-specific exonuclease [Bartonella grahamii
           as4aup]
 gi|240267906|gb|ACS51494.1| single-stranded-DNA-specific exonuclease [Bartonella grahamii
           as4aup]
          Length = 594

 Score =  503 bits (1294), Expect = e-140,   Method: Composition-based stats.
 Identities = 285/590 (48%), Positives = 387/590 (65%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            + FL VE S  G  W+  L  +GIN A AI+QK   PD +ARVL  R+V    A  F+N
Sbjct: 4   SRYFLNVESSACGQAWLDALDVQGINNARAISQKFGFPDQLARVLSARDVDEAEAVAFIN 63

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R LMPDP    D   AA RIV+A+ N E++ +FGDYDVDGA S AL+ RF  +  + 
Sbjct: 64  PTLRTLMPDPESFRDMQCAAERIVKALLNQEQVAVFGDYDVDGACSSALIARFFRYFGIE 123

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +YIPDRI++GYGPN   M   + EGA+LIITVDCG+ S DA++ A   G DV+++DHH
Sbjct: 124 VKIYIPDRIIEGYGPNEQAMRMLVQEGARLIITVDCGANSPDAVKAARLAGADVVILDHH 183

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
           Q+      A ALVNPNR DD S QGHLCAAGVVF+ L  ++ +LR+        DLLS+L
Sbjct: 184 QMSEIHQEAIALVNPNRPDDFSKQGHLCAAGVVFVTLAWVHHLLRKKQFQGQLPDLLSML 243

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALAT+CDVVPL G+NRA+V+KGL VAR   NPG+ AL +   I  P+ + + G+++G
Sbjct: 244 DLVALATICDVVPLQGVNRAFVIKGLQVARSMHNPGITALTKVARIGEPLNSFHFGFLLG 303

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG+  LG+RLL  ++  E + +A +LD LNQ R+ ME+  L QAE+ + +  
Sbjct: 304 PRINAGGRIGDQALGARLLSCENKDEADRIAEQLDRLNQERQEMENIQLAQAESYIASLY 363

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D +    +V+    WHPGI+G+LA+RLKE+F  P FAI+ +EDG G+GSGRSI G D+G
Sbjct: 364 QDQEIPLSLVISHKEWHPGIIGILASRLKERFFCPVFAIALKEDGNGVGSGRSINGIDLG 423

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
            +V  AV   +L KGGGH+MAAG+T++         + ++     V  L       IDG 
Sbjct: 424 ALVREAVTLNLLEKGGGHSMAAGITIQSTKIEIFRKWLEEKVSLRVSELHAKKSLSIDGS 483

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L+AS VN AL ++LE AGP+G GN  PVF  P+H+L ++  V   HL++   + + + LQ
Sbjct: 484 LSASGVNEALFELLEKAGPFGTGNATPVFVLPSHRLVNLSEVGKGHLRLIVSNVEGKKLQ 543

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            IAFR  GT LG+FL ++ G+ +H+ GHL +NYW G+   QLRV+DA+ V
Sbjct: 544 GIAFRAVGTSLGDFLFENIGEMIHLAGHLSLNYWNGTTNPQLRVIDAAAV 593


>gi|121601735|ref|YP_989185.1| single-stranded-DNA-specific exonuclease RecJ [Bartonella
           bacilliformis KC583]
 gi|120613912|gb|ABM44513.1| single-stranded-DNA-specific exonuclease RecJ [Bartonella
           bacilliformis KC583]
          Length = 594

 Score =  499 bits (1285), Expect = e-139,   Method: Composition-based stats.
 Identities = 291/587 (49%), Positives = 388/587 (66%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           L V+ S  G  WV  L  +GIN+A AI+QK  +PD +ARVL  R+V       F+NP++R
Sbjct: 8   LDVKSSACGQAWVDSLDIQGINKARAISQKFGLPDQLARVLSARDVDESEVISFINPALR 67

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            LMP+P   TD   AA R+V+AI N E + IFGDYDVDGA S AL+ RF  +  +    Y
Sbjct: 68  TLMPNPEHFTDMQCAAERLVKAIMNQENVAIFGDYDVDGACSSALLARFFRYFGIETKTY 127

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRIV+GYGPN   M+  + EGA LIITVDCG+ S +A++ A   G DV+V+DHHQ+  
Sbjct: 128 IPDRIVEGYGPNAQAMKALVQEGASLIITVDCGANSPEAIKVARLLGADVVVLDHHQMGD 187

Query: 187 EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVA 246
               A ALVNPNR DD S QGHLCAAGVVF+ L  +  +LR+        DLL++LDLVA
Sbjct: 188 LHQEAVALVNPNRPDDFSEQGHLCAAGVVFITLAWVNHLLREKKWEGDIPDLLAMLDLVA 247

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           LAT+CDVVPL G+NRA+VVKGL VAR   NPG+ AL +   I  P+ + +LG+++GP IN
Sbjct: 248 LATICDVVPLKGVNRAFVVKGLQVARSMHNPGIAALAKVARIGEPLNSFHLGFLLGPRIN 307

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGRIG+  LG+RLL  D+  E + +A +LD LNQ R+ MES  L QAEA + +   D +
Sbjct: 308 AGGRIGDQALGARLLSCDNRDEADRIAKQLDQLNQERQEMESVQLAQAEAYIHSIYQDEE 367

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
               IVV    WHPGIVG+LA+RLKE+F  P FAI+ + DGKGIGSGRSI+G D+G++V 
Sbjct: 368 MPLSIVVAHQEWHPGIVGILASRLKERFFCPVFAIALKADGKGIGSGRSIDGIDLGELVR 427

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            AV   +L KGGGH+MAAGLT++        ++ ++    +V  L       IDG ++AS
Sbjct: 428 EAVSLNLLEKGGGHSMAAGLTIQSTKINAFQEWLKEKVSLMVSQLRAEQCLNIDGFISAS 487

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAF 546
             N  L DM+E AGP+G+GN  PVF  P+H+L ++  V   HL++T    + + LQ IAF
Sbjct: 488 GANKDLFDMIEKAGPFGSGNATPVFVLPSHRLVNLHEVGKGHLRLTVSDIEGKKLQGIAF 547

Query: 547 RVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           R   T LG+FL+++  K +H+ G+L +NYW G+   QLRV+DA+ V+
Sbjct: 548 RAVETSLGDFLVKNIDKTIHLAGNLSLNYWNGTITPQLRVIDAAAVD 594


>gi|241204470|ref|YP_002975566.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858360|gb|ACS56027.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 600

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 341/591 (57%), Positives = 436/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V++D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQIHGLPDLIARVLAGRGVTVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R+++AI   E + IFGDYDVDGAAS ALM RFLSH  V A
Sbjct: 70  TIRSLMPDPHKLTDCEKAANRLLRAIERGESVAIFGDYDVDGAASSALMFRFLSHFGVRA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDR+ +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 TIYIPDRVFEGYGPNPAAINQLIDNGAELIVTVDCGSTSHEALAAAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR       L  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRILAIDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E +++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEADVIAQRLDELNRERQAMEAIMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  FF + A   V +L+     KIDG 
Sbjct: 430 RMVRAAVDEGLLVKGGGHAMAAGLTVERTDLGRLRTFFTEKAERTVASLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+L+  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAIPAHRLRDARLVGEKHVKVTLEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   TPLG  L+ SRG  +HV G L  ++++G++R QLRV DA+P +
Sbjct: 550 GIAFRAADTPLGNLLINSRGANLHVAGSLGADHYQGARRIQLRVCDAAPAK 600


>gi|163868609|ref|YP_001609818.1| single-stranded-DNA-specific exonuclease [Bartonella tribocorum CIP
           105476]
 gi|161018265|emb|CAK01823.1| single-stranded-DNA-specific exonuclease [Bartonella tribocorum CIP
           105476]
          Length = 594

 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 283/590 (47%), Positives = 387/590 (65%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            + FL VE S  G  W+  L  +GIN A AI+QK   PD +ARVL  R V    A  F++
Sbjct: 4   SRYFLNVESSACGQAWLDALDVQGINNARAISQKFGFPDQLARVLSARGVDETEAVAFID 63

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R+LMPDP    D   AA RIV+A+ N E++ +FGDYDVDGA + AL+ RF  +  + 
Sbjct: 64  PTLRMLMPDPESFRDMQCAAERIVKALLNQEQVAVFGDYDVDGACASALIARFFRYFGIE 123

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +YIPDRIV+GYGPN   M   + EGA+LIITVDCG+ S DA++ A   G DV+++DHH
Sbjct: 124 VKIYIPDRIVEGYGPNEQAMRMLVQEGARLIITVDCGANSPDAVKAARLAGADVVILDHH 183

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
           Q+      A ALVNPNR DD S QG+LCAAGVVF+ L  ++ +LR+        DLLS+L
Sbjct: 184 QMSEIHQEAIALVNPNRPDDFSEQGYLCAAGVVFVTLAWVHHLLRKKQFEGPLPDLLSML 243

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALAT+CDVVPL G+NRA+VVKGL VAR   N G+ AL +   I  P+ + +LG+++G
Sbjct: 244 DLVALATICDVVPLQGVNRAFVVKGLHVARSMHNLGIAALTKVARIGEPLNSFHLGFLLG 303

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG+  LG+RLL  ++  E + +A +LD LNQ R+ ME   L QAE+ + +  
Sbjct: 304 PRINAGGRIGDQALGARLLSCENKDEADRIAEQLDQLNQERQEMEKIQLAQAESYIASLY 363

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D +    +V+    WHPGI+G+LA+RLKE+F  P FAI+ +EDG G+GSGRSI G D+G
Sbjct: 364 QDQEPPLSLVISHQEWHPGIIGILASRLKERFFCPVFAIALKEDGNGVGSGRSIHGIDLG 423

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
            +V  AV   +L KGGGH+MAAG+T++         + ++    +V  L      +IDG 
Sbjct: 424 ALVREAVTLNLLEKGGGHSMAAGITIQSTKIEFFRKWLEEKVSVMVSQLHAKKSLRIDGS 483

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L+AS  N AL ++LE AGP+G GN  PVF  P+H+L ++  V   HL++   + + + LQ
Sbjct: 484 LSASGANQALFELLEKAGPFGTGNATPVFVLPSHRLMNLSEVGKGHLRLIISNGEGKKLQ 543

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            IAFR  GT LG+FL ++ G+ +H+ GHL +NYW G+   QLRV+DA+ V
Sbjct: 544 GIAFRAVGTALGDFLSRNIGEMIHLAGHLSLNYWNGTINPQLRVIDAAAV 593


>gi|319898876|ref|YP_004158969.1| single-stranded-DNA-specific exonuclease [Bartonella clarridgeiae
           73]
 gi|319402840|emb|CBI76391.1| single-stranded-DNA-specific exonuclease [Bartonella clarridgeiae
           73]
          Length = 594

 Score =  495 bits (1275), Expect = e-138,   Method: Composition-based stats.
 Identities = 291/585 (49%), Positives = 387/585 (66%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
            L VE S  G  WV  L  E +N A AI+QK  +PD +ARVL  R+V    A  F+NP++
Sbjct: 7   LLNVESSAWGQAWVDALDIERVNNARAISQKFGLPDQLARVLAARDVDESEAITFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R+LMP+P    D   AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL +  +   +
Sbjct: 67  RVLMPNPKDFIDMHCAAERLVKAIINREKIAVFGDYDVDGACSAALLARFLHYFGIIVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI++GYGPN   M+  + EGA LIITVDCG+ S DAL+ A   G DVIV+DHHQ++
Sbjct: 127 YIPDRIIEGYGPNEQAMKGLVQEGASLIITVDCGANSPDALRAAKFAGADVIVLDHHQME 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
           +    A ALVNPNR DDLS QGHLCAAGVVF+ L+ + R+LR+        DLLS+LDLV
Sbjct: 187 NVHEEAVALVNPNRPDDLSEQGHLCAAGVVFITLIWVNRLLREKKWGGALPDLLSMLDLV 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALAT+CD+VPL G+NRA+VVKGL VAR   NPG+ AL +  +I  P+ + +LG+++GP I
Sbjct: 247 ALATICDIVPLKGVNRAFVVKGLQVARSMRNPGIAALAKVAHIGEPLNSFHLGFLLGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG   LG+ LL  +D  E + +A +LD LN+ R+ ME   L QAE  + +   D 
Sbjct: 307 NAGGRIGNQALGAYLLSCNDRDEADRIAQQLDQLNKERQEMEMIQLAQAEVYIDSIYQDE 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
              S  V+    WHPGI+G+LAARLKE+F  P  AI+ +EDG GIGSGRSI G D+G +V
Sbjct: 367 AMPSSFVIAHKEWHPGIIGILAARLKERFFCPVLAIALKEDGSGIGSGRSISGIDLGALV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV   +L KGGGH+MAAG T++        ++ ++    +V  L       IDG L+A
Sbjct: 427 HEAVTLNLLEKGGGHSMAAGFTIQSTKIEAFREWLEEKVSLMVSQLRAEKSLSIDGFLSA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           S  N  L DM+E AGP+G+GN  PVF FP+H+L ++  V   HL++     + + L+ IA
Sbjct: 487 SGANKDLFDMIEKAGPFGSGNATPVFVFPSHRLVNLYEVGKGHLRLIISDIEGKKLKGIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           F   GT LG+FL ++ GK++H+ G+L +N+WRGS   QLRV+DA+
Sbjct: 547 FGAVGTSLGKFLSKNIGKKIHLAGNLSLNHWRGSISPQLRVIDAA 591


>gi|319408572|emb|CBI82225.1| single-stranded-DNA-specific exonuclease [Bartonella
           schoenbuchensis R1]
          Length = 593

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 291/586 (49%), Positives = 382/586 (65%), Gaps = 1/586 (0%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIR 66
           L V+ S     WV  L  +GIN A AI+QK   PD +ARVL  RNV    A  F+NP++R
Sbjct: 8   LNVKSSACDQAWVDPLDIQGINNARAISQKFGFPDQLARVLAARNVDESEAVSFINPTLR 67

Query: 67  LLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMY 126
            L+P+P   TD   AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL +  +   +Y
Sbjct: 68  NLLPNPESFTDMQCAAERLVKAIMNREKIAVFGDYDVDGACSSALLARFLRYFGITVKIY 127

Query: 127 IPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKS 186
           IPDRIV+GYGPN   M+    EGA LIITVDCG+ S DA++ A   G DV+V+DHHQ+  
Sbjct: 128 IPDRIVEGYGPNEQAMKMLAQEGASLIITVDCGANSPDAIKAARFAGADVVVLDHHQMSD 187

Query: 187 EEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVA 246
               A ALVNPNR DD S QGHLCAAG+VF+ LV +  +LR+        DLLS+LDLVA
Sbjct: 188 VHQEAVALVNPNRPDDFSEQGHLCAAGIVFVTLVWVNHLLRKQKWTETVPDLLSMLDLVA 247

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           LATVCDVVPL G+NRA+VVKGL VAR   N G+ AL +   I  PI + +LG+++GP IN
Sbjct: 248 LATVCDVVPLRGVNRAFVVKGLQVARSMHNAGIAALAKVARIGEPINSFHLGFLLGPRIN 307

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGRIG+  LG+RLL  D+  E + +A +L+ LNQ R+ ME+  L QAEA + +   D +
Sbjct: 308 AGGRIGDQALGARLLSCDNRDEADKMAEQLNKLNQERQEMEAIQLAQAEAYIDSVHHDKE 367

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S+ VV    WHPGIVG+LA+RLKE+F  P F I+ + DG G GSGRSI G D+G +V 
Sbjct: 368 MSSL-VVACQEWHPGIVGILASRLKERFFCPVFVIALKADGSGTGSGRSISGVDLGALVH 426

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            AV   +L KGGGH+MAAG+T++        ++ ++    +V  L       IDG L+AS
Sbjct: 427 EAVTLNLLEKGGGHSMAAGITIQSTKVEAFREWLEEKVSLVVSQLRAKKSLSIDGFLSAS 486

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAF 546
             N  L DM+E AGP+G+ N  PVF  P+H+L S+  V   HL++     + + LQ IAF
Sbjct: 487 GANKDLFDMIEKAGPFGSENATPVFVLPSHRLVSVCEVGKGHLRLFVSDLEGKKLQGIAF 546

Query: 547 RVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
              GT LG FL ++ G+ +HV G+L +NYW G+ + QLRV+DA+ V
Sbjct: 547 HAVGTSLGNFLSENVGETIHVAGNLSLNYWNGTIKPQLRVIDAATV 592


>gi|319407211|emb|CBI80850.1| single-stranded-DNA-specific exonuclease [Bartonella sp. 1-1C]
          Length = 594

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 289/589 (49%), Positives = 387/589 (65%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +  L ++ S     W+  L  +  N A AI+QK  +P+ +ARVL  RNV    A  F+NP
Sbjct: 5   RYLLNIQSSACNQVWIDALDIDRTNNARAISQKFGLPEQLARVLAARNVDESEAMVFINP 64

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R+LMP+P   TD D AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL    +  
Sbjct: 65  TLRVLMPNPKKFTDMDCAAERLVKAIINQEKIAVFGDYDVDGACSAALLARFLHCFGIIV 124

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI++GYGPN   M+  + EGA LIITVDCG+ S +A++ A   G DVIV+DHHQ
Sbjct: 125 KIYIPDRIIEGYGPNEQAMKGLVQEGASLIITVDCGANSPNAIRAARLAGADVIVLDHHQ 184

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
           +++    A ALVNPNR DD S QGHLCAAGVVF+ L+ + R+LR+        DLLS+LD
Sbjct: 185 MENIHEEAVALVNPNRPDDFSEQGHLCAAGVVFITLMWVNRLLREKKWKGALPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALAT+CDVVPL G+NRA+VVKGL VAR   NPG+ AL +   I  P+ + +LG+++GP
Sbjct: 245 LVALATICDVVPLQGVNRAFVVKGLQVARSMHNPGIAALAKVARIGEPLNSFHLGFLLGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG   LG+ LL  +D  E + +A +LD LN+ R+ ME + L QAEA + +   
Sbjct: 305 RINAGGRIGNQALGAYLLSCNDRDEADRIAQQLDQLNKERQEMEISQLAQAEAYIDSIYQ 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           +    S  V+    WHPGI+G+LAARLKE+F  P   I+ +EDG GIGSGRSI G D+G 
Sbjct: 365 ERTIPSSFVIAHKGWHPGIIGILAARLKERFFCPVLIIALKEDGSGIGSGRSISGIDLGA 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AV   +L KGGGH+MAAG T++        ++ ++    IV  L       IDG L
Sbjct: 425 LVHEAVTLNLLEKGGGHSMAAGFTIQSDKIEAFREWLEEKISLIVSQLRAEKSLSIDGFL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +AS  N  L DM+E AGP+G+GN  PVF FP+H+L ++  V   HL++   + + E LQ 
Sbjct: 485 SASGANKDLFDMIEKAGPFGSGNATPVFVFPSHRLVNLYEVGKGHLRLIISNIEGEKLQG 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           IAF   GT LG+FL ++ GK +H+ G+L +N+WRGS   QLRV+DA+ V
Sbjct: 545 IAFGAVGTTLGKFLSENIGKTIHLAGNLSLNHWRGSISPQLRVIDAAAV 593


>gi|86357505|ref|YP_469397.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           CFN 42]
 gi|86281607|gb|ABC90670.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           CFN 42]
          Length = 600

 Score =  493 bits (1270), Expect = e-137,   Method: Composition-based stats.
 Identities = 343/593 (57%), Positives = 433/593 (73%), Gaps = 1/593 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
             +AFLGVE S    RWV+ L Q G NRALA+ Q H +PD++ARVL  R V +D A +FL
Sbjct: 8   VPRAFLGVEKSALDNRWVARLDQAGQNRALAMAQVHGLPDLIARVLAGRGVRVDEAIEFL 67

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P+IR LMPDP  LTDC+KAA R+V+AI   E + IFGDYDVDGAAS ALM RFLSH  V
Sbjct: 68  DPTIRSLMPDPHTLTDCEKAATRLVRAIERGESVAIFGDYDVDGAASSALMFRFLSHFGV 127

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
            AN+YIPDRI +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDH
Sbjct: 128 KANIYIPDRIFEGYGPNPAAINQLIDNGARLIVTVDCGSTSHEALAAAAARNIDVVVIDH 187

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF-DLLS 240
           HQV  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR      +   DLL 
Sbjct: 188 HQVTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRIMALDLLQ 247

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LD+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++
Sbjct: 248 WLDIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFL 307

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LGSRLL  DD+ E E++A +LD LN+ R+ ME+ ML++AEA+ L 
Sbjct: 308 IGPRINAGGRIGDAALGSRLLTLDDAGEAEVIAQRLDELNRERQAMEAMMLQEAEAEALA 367

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +  D + AS+IV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD
Sbjct: 368 EYGDGEGASIIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFD 427

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G+MV  AVEEGILVKGGGHAMAAGLTVER + GRL  FF + A   V +L+     KID
Sbjct: 428 MGRMVRAAVEEGILVKGGGHAMAAGLTVERADLGRLRTFFTEKAARTVASLVANETLKID 487

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   
Sbjct: 488 GAIGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTLEAMDGSR 547

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           L  IAFR   T LG  L+ SRG  +HV G L   +++G++R QLRV DA+P +
Sbjct: 548 LDGIAFRAADTGLGNLLINSRGASLHVAGSLGAEHYQGARRIQLRVCDAAPAK 600


>gi|319404201|emb|CBI77794.1| single-stranded-DNA-specific exonuclease [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 594

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 289/589 (49%), Positives = 386/589 (65%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +  L ++ S     W+  L  +  N A AI+QK  +PD +ARVL  RNV    A  F+NP
Sbjct: 5   RYLLNIQSSACNQAWIDALDMDRTNNARAISQKFGLPDQLARVLAARNVDESEAVVFINP 64

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMP+P   TD D AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL    +  
Sbjct: 65  TLRALMPNPKKFTDMDCAAERLVRAIINQEKITVFGDYDVDGACSAALLARFLHCFGIIV 124

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI++GYGPN   M+  + EGA LIITVDCG+ S +A++ A   G DVIV+DHHQ
Sbjct: 125 KIYIPDRIIEGYGPNEQAMKGLVQEGASLIITVDCGANSPNAIRAARLAGADVIVLDHHQ 184

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
           +++    A ALVNPNR DD S QGHLCAAGVVF+ L+ + R+LR+        DLLS+LD
Sbjct: 185 MENIHEEAVALVNPNRPDDFSEQGHLCAAGVVFITLMWVNRLLREKKWKGALPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALAT+CDVVPL G+NRA+VVKGL VAR   NPG+ AL +   I  P+ + +LG+++GP
Sbjct: 245 LVALATICDVVPLQGVNRAFVVKGLQVARSMHNPGIAALAKVARIGEPLNSFHLGFLLGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG   LG+ LL  +D  E + +A +LD LN+ R+ ME + L QAEA + +   
Sbjct: 305 RINAGGRIGNQALGAYLLSCNDRDEADRIAQQLDQLNKERQEMEISQLAQAEAYIDSIYQ 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           +    S  V+    WHPGI+G+LAARLKE+F  P   I+ +EDG GIGSGRSI G D+G 
Sbjct: 365 ERTIPSSFVIAHKGWHPGIIGILAARLKERFFCPVLIIALKEDGSGIGSGRSISGIDLGA 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AV   +L KGGGH+MAAG T++        ++ ++    IV  L       IDG L
Sbjct: 425 LVHEAVALNLLEKGGGHSMAAGFTIQSDKIEAFREWLEEKISLIVSQLRAEKSLNIDGFL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +AS  N  L DM+E AGP+G+GN  PVF FP+H+L ++  V   HL++   + + E LQ 
Sbjct: 485 SASGANKDLFDMIEKAGPFGSGNATPVFVFPSHRLVNLYEVGKGHLRLIISNIEGEKLQG 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           IAF   GT LG+FL ++ GK +H+ G+L +N+WRG+   QLRV+DA+ V
Sbjct: 545 IAFGAVGTALGKFLSENIGKTIHLAGNLSLNHWRGNISPQLRVIDAAAV 593


>gi|49475553|ref|YP_033594.1| single-stranded-DNA-specific exonuclease [Bartonella henselae str.
           Houston-1]
 gi|49238359|emb|CAF27583.1| Single-stranded-DNA-specific exonuclease [Bartonella henselae str.
           Houston-1]
          Length = 594

 Score =  493 bits (1268), Expect = e-137,   Method: Composition-based stats.
 Identities = 292/590 (49%), Positives = 387/590 (65%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            + FL V+ S  G  W+  L  +GIN A AI+QK   PD +ARVL  R+V    A  F+N
Sbjct: 4   SRYFLNVQSSACGQAWLDALDIQGINNARAISQKFGFPDQLARVLSARDVDESEAVAFIN 63

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R LMPDP   TD   AA RIV+AI   EK+ +FGDYDVDGA S AL+ RFL +  V 
Sbjct: 64  PTLRTLMPDPKSFTDMQYAAERIVKAILKQEKVAVFGDYDVDGACSSALIARFLRYFGVE 123

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +YIPDRIV+GYGPN   M   + +GA LIITVDCG+ S DA++ A   G DV+V+DHH
Sbjct: 124 VKIYIPDRIVEGYGPNEQAMRMLVQQGAHLIITVDCGANSPDAVKAARLAGADVVVLDHH 183

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
           Q+      A ALVNPNR DD SGQGHLCAAGVVF+ L  ++ +LR+   V    DLLS+L
Sbjct: 184 QMSEVHQEAVALVNPNRPDDFSGQGHLCAAGVVFVTLAWVHHLLRKKKFVEELPDLLSML 243

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALAT+CDVVPL G+NRA+VVKGL VA    NPG+ AL +   I  P+ + +LG+++G
Sbjct: 244 DLVALATICDVVPLQGVNRAFVVKGLQVAHSMHNPGIAALTKVARIGEPLNSFHLGFLLG 303

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG+  LG+RLL  +D  E + +A +L+ LNQ R+ ME+  L QAE+ + +  
Sbjct: 304 PRINAGGRIGDQALGARLLSCEDKGEADRIAEQLNQLNQERQEMEAIQLAQAESYIDSLY 363

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D ++   +V+    WHPGI+GLLA+RLKE+F  P FAI+ +E+G GIGSGRSI G D+G
Sbjct: 364 QDREKPLSLVIAHQEWHPGIIGLLASRLKERFFCPVFAIALKENGSGIGSGRSISGIDLG 423

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
            +V  AV   +L KGGGH+MAAG+T++         + ++     V  L       IDG 
Sbjct: 424 ALVREAVTLNLLEKGGGHSMAAGITIQSTKIEIFRKWLEERVSLNVSQLHAEKSLNIDGC 483

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L+AS  N AL DM+E AGP+G+GN  PVF  P+H+L ++  V   HL+    + + + LQ
Sbjct: 484 LSASGANKALFDMIEKAGPFGSGNTTPVFVLPSHRLMNLCEVGKGHLRFIMSNMEGKKLQ 543

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            IAFR  GT LG FL  + G+ +HV G++ +NYW G+   QLRV+DA+ V
Sbjct: 544 GIAFRAVGTSLGYFLSGNVGEMIHVAGNISLNYWNGNISPQLRVIDAAAV 593


>gi|190891568|ref|YP_001978110.1| single-stranded-DNA-specific exonuclease [Rhizobium etli CIAT 652]
 gi|190696847|gb|ACE90932.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           CIAT 652]
          Length = 600

 Score =  491 bits (1264), Expect = e-136,   Method: Composition-based stats.
 Identities = 342/591 (57%), Positives = 433/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V +D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQVHGLPDLIARVLAGRGVPVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R+V AI   E + IFGDYDVDGAAS ALM RFLSH  V A
Sbjct: 70  TIRSLMPDPHTLTDCEKAATRLVSAIERGENVAIFGDYDVDGAASSALMFRFLSHFGVKA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDRI +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRIFEGYGPNPAAINQLIDNGARLIVTVDCGSTSHEALAAAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR       L  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRILALDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEAELIAQRLDELNRERQAMEAMMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  FF + A   V  L+     KIDG 
Sbjct: 430 RMVRAAVDEGLLVKGGGHAMAAGLTVERADLGRLRTFFTEKAARTVANLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTLEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L  ++++G++R Q+RV DA+P +
Sbjct: 550 GIAFRAADTALGNLLVNSRGASLHVAGTLGADHYQGARRIQMRVCDAAPAK 600


>gi|327190809|gb|EGE57877.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           CNPAF512]
          Length = 600

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 341/591 (57%), Positives = 433/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q + +PD++ARVL  R V +D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQVYGLPDLIARVLAGRGVPVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R++ AI   E + IFGDYDVDGAAS ALM RFLSH  V A
Sbjct: 70  TIRSLMPDPHTLTDCEKAATRLMSAIERGENVAIFGDYDVDGAASSALMFRFLSHFGVKA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDRI +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRIFEGYGPNPAAINQLIDNGARLIVTVDCGSTSHEALASAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR       L  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRILALDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEAEIIAQRLDELNRERQAMEAVMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGLLAARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLLAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  FF + A   V  L+     KIDG 
Sbjct: 430 RMVRAAVDEGLLVKGGGHAMAAGLTVERADLGRLRTFFTEKAARTVANLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTLEAMDGTRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L  ++++G++R Q+RV DA+P +
Sbjct: 550 GIAFRAADTALGNLLVNSRGASLHVAGTLGADHYQGARRIQMRVCDAAPAK 600


>gi|154253388|ref|YP_001414212.1| single-stranded-DNA-specific exonuclease RecJ [Parvibaculum
           lavamentivorans DS-1]
 gi|154157338|gb|ABS64555.1| single-stranded-DNA-specific exonuclease RecJ [Parvibaculum
           lavamentivorans DS-1]
          Length = 603

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 264/595 (44%), Positives = 370/595 (62%), Gaps = 7/595 (1%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            +AFLGVE S +G  W+S L       ALAI Q+  +P+IVARVL  R V+ +    +L 
Sbjct: 6   TRAFLGVERSATGRAWLSRL--ADDRLALAIAQREGLPEIVARVLAGRGVAPEDCAAYLA 63

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           PS++ LMPDP ++TD +KAA R+ QAI   EKI +FGDYDVDGA S AL+ RF       
Sbjct: 64  PSLKTLMPDPRVVTDMEKAATRVAQAIMAGEKIAVFGDYDVDGATSSALLQRFFRAAGSE 123

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +YIPDRI +GYGPN   + +  +EG  L+ITVDCG+ ++ AL  A + G+  IV+DHH
Sbjct: 124 LRIYIPDRIREGYGPNAPALLRLKDEGIDLVITVDCGTMAHKALGLAADAGLPSIVVDHH 183

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLS 240
           Q +    PAYALVNPNRLDD SG G L A GV FL +V   R LR+          DL+ 
Sbjct: 184 QAEPALPPAYALVNPNRLDDESGLGQLAAVGVAFLFVVATNRALREAGWYATRPEPDLMQ 243

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVAL T+CDVVPL+GLNRA+V +GL V  R+ N GL AL +   ++      + G++
Sbjct: 244 WLDLVALGTICDVVPLLGLNRAFVAQGLRVMARRQNIGLAALGDVARLNGAPVPYHCGFL 303

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP +NAGGR+G+++LG+RLL ++D +E   +A +L+V+N  R+ +E+ +LE+A  +V  
Sbjct: 304 LGPRVNAGGRVGKADLGARLLTTEDVEEARAIAEELNVMNGERQAIEAQVLEEALTQVDE 363

Query: 361 QC---DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIE 417
           +           +I+  G  WHPG++G++A+RLK+K+ RPS  ++F+  G+G GSGRS+ 
Sbjct: 364 RLSAARANTLPPIIIASGHGWHPGVIGIVASRLKDKYERPSLVLAFDGKGEGKGSGRSLT 423

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVF 477
           G D+G+ V+ A+E G+LV GGGHAMAAGLT+   N   L  F  K   + V A       
Sbjct: 424 GVDLGRAVTAALEAGLLVNGGGHAMAAGLTLREDNLEALEAFLAKRLADDVSAASEARAL 483

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
           K+DG L+A      L ++L+ AGPYGAGN  P FA P+ ++    +V   H+++    +D
Sbjct: 484 KLDGALSARGATRELYELLQQAGPYGAGNAEPRFAVPSVRVVKADIVGKDHVRVILSGED 543

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
              ++AIAFR   TPLG  LM      +HV G L  + W+G +  QL + DA P 
Sbjct: 544 GGRIKAIAFRAATTPLGAVLMDKGSGLLHVAGRLSADDWQGRRAVQLTIEDAVPT 598


>gi|319405639|emb|CBI79262.1| single-stranded-DNA-specific exonuclease [Bartonella sp. AR 15-3]
          Length = 594

 Score =  491 bits (1263), Expect = e-136,   Method: Composition-based stats.
 Identities = 291/589 (49%), Positives = 388/589 (65%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +  L V+ S     WV  L  + IN A AI+QK  +PD +ARVL  R+V    A  F+NP
Sbjct: 5   RYLLNVQSSACDQAWVDALDMDRINNARAISQKFGLPDQLARVLAARDVDEAEAVAFINP 64

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R+LMPDP  +TD D AA R+V+AI N EKI +FGDYDVDGA S AL+ RFL    +  
Sbjct: 65  TLRILMPDPKKITDVDCAAERLVKAIINQEKIAVFGDYDVDGACSAALLARFLHCFGIIV 124

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI++GYGPN   M   + EGA LIITVDCG+ S DA++ A   G DVIV+DHHQ
Sbjct: 125 KIYIPDRIIEGYGPNEQAMRGLVQEGASLIITVDCGANSPDAIRAARLAGADVIVLDHHQ 184

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
           +++    A ALVNPNR DD S QGHLCAAGVVF+ L+ + R+LR+        DLLS+LD
Sbjct: 185 MENIHEEAVALVNPNRPDDFSEQGHLCAAGVVFITLMWVNRLLRKKKWGGALPDLLSMLD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALAT+CDVVPL G+NRA+V KGL VAR   NPG+ AL +  +I  P+ + +LG+++GP
Sbjct: 245 LVALATICDVVPLQGVNRAFVNKGLQVARSMYNPGIAALAKVAHIGEPLNSFHLGFLLGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG   LG+ LL  +D  E + +A +LD LN+ R+ ME   L QAE+ + +   
Sbjct: 305 RINAGGRIGNQALGAYLLSCNDRDEADRIAQELDRLNKERQEMEMIQLAQAESYLDSIYQ 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           +    S  V+    WHPGI+G+LAARLKE+F  P   I+ +EDG GIGSGRSI G ++G 
Sbjct: 365 EKTIPSPFVIAHKEWHPGIIGILAARLKERFFCPVLVIALKEDGSGIGSGRSISGINLGA 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AV   +L KGGGH+MAAG T++        ++ ++    +V  L       IDG L
Sbjct: 425 LVREAVTLNLLEKGGGHSMAAGFTIQSTKIEAFREWLEEKVSLMVSQLRAKKSLSIDGFL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +AS  N  L DM+E AGP+G+GN  PVFAFP+H+L  +  V   HL++   + + E LQ 
Sbjct: 485 SASGANKDLFDMIEKAGPFGSGNAIPVFAFPSHRLVKLYEVGKGHLRLIISNIEGEKLQG 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           IAF   GTPLG+FL ++ GK +H+ G+L +N+WRG+   QLRV+DA+ V
Sbjct: 545 IAFGAVGTPLGQFLFENIGKTIHLAGNLSLNHWRGNISPQLRVIDAAAV 593


>gi|49474261|ref|YP_032303.1| single-stranded-DNA-specific exonuclease [Bartonella quintana str.
           Toulouse]
 gi|49239765|emb|CAF26152.1| Single-stranded-DNA-specific exonuclease [Bartonella quintana str.
           Toulouse]
          Length = 594

 Score =  490 bits (1262), Expect = e-136,   Method: Composition-based stats.
 Identities = 291/587 (49%), Positives = 389/587 (66%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V+ S  G  W+  L  +GIN A AI+QK   PD +ARVL  R+V    A  F+NP++
Sbjct: 7   FLNVQSSACGQAWLDALDLKGINNARAISQKFGFPDALARVLSARDVDESEAVAFINPTL 66

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDP    D   AA RIV+AI N EK+ +FGDYDVDGA S AL+ RFL +  +   +
Sbjct: 67  RTLMPDPESFMDMQCAAERIVKAILNQEKVAVFGDYDVDGACSSALIARFLRYFEIEVKI 126

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDRI++GYGPN   M   + +GA LIITVDCG+ S DA++ A  +G DV+V+DHHQ+ 
Sbjct: 127 YIPDRIIEGYGPNEQAMRMLVQKGAHLIITVDCGANSPDAVRAARLEGADVVVLDHHQMT 186

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
                A ALVNPNR DD SGQGHLCAAGVVF+ L  +  +LR+        DLLS+LDLV
Sbjct: 187 EVHQEAVALVNPNRPDDFSGQGHLCAAGVVFVTLAWVNHLLRKKKFGEKLPDLLSMLDLV 246

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALAT+CDVVPL G+NRA+VVKGL VAR   N G+ AL +   I  P+ + +LG+++GP I
Sbjct: 247 ALATICDVVPLQGVNRAFVVKGLQVARSMHNFGIAALTKVARIDEPLNSFHLGFLLGPRI 306

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG+  LG+RLL  +D  E + +A +LD LNQ R+ ME   L QAE+ + +   + 
Sbjct: 307 NAGGRIGDQALGARLLCCEDKDEADKIAERLDRLNQERQEMEGVQLAQAESYIDSLYQER 366

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
           +    IV+    WHPGI+G+LA+RLKE+F  P F+I+ +EDG G+GSGRSI+G D+G +V
Sbjct: 367 ETPMSIVIAHQEWHPGIIGILASRLKERFFCPVFSIALKEDGSGVGSGRSIDGIDLGALV 426

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
             AV   +L KGGGH+MAAG+T++        ++ +K    +V  L       IDG L+A
Sbjct: 427 REAVMLNLLEKGGGHSMAAGITIQSTKIEIFREWLEKKVSLMVSRLRAKKSLSIDGCLSA 486

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
           S  N AL DM+E AGP+G+GN  PVF  P+H+L ++  V   HL++   + + + LQ IA
Sbjct: 487 SGANKALFDMIEKAGPFGSGNTTPVFVLPSHRLINLCEVGKGHLRLVISNMEGKKLQGIA 546

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           FR  GTPLG FL ++ G+ +HV G+L +NYW G+   QLRV+DA+ V
Sbjct: 547 FRAMGTPLGYFLSENIGEMIHVAGNLSLNYWNGTINPQLRVIDAAAV 593


>gi|218463397|ref|ZP_03503488.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli
           Kim 5]
          Length = 600

 Score =  490 bits (1261), Expect = e-136,   Method: Composition-based stats.
 Identities = 341/591 (57%), Positives = 430/591 (72%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V +D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQVHGLPDLIARVLAGRGVPVDEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  LTDC+KAA R+++AI   E + IFGDYDVDGAAS ALM RFLSH  V  
Sbjct: 70  TIRSLMPDPHTLTDCEKAATRLMRAIERGESVAIFGDYDVDGAASSALMFRFLSHFGVKT 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDRI +GYGPNP+ + + I+ GA+LI+TVDCGSTS++AL  A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRIFEGYGPNPAAINQLIDNGARLIVTVDCGSTSHEALAAAAARNIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLL 242
           V  E  P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR       L  DLL  L
Sbjct: 190 VTHELPPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKGILAIDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E EM+A +LD LN+ R+ M++ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAGEAEMIAQRLDELNRERQAMDAVMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           KMV  AV+EG+LV GGGHAMAAGLTVER + GRL  FF + A   V  L      KIDG 
Sbjct: 430 KMVRAAVDEGLLVTGGGHAMAAGLTVERADLGRLRTFFTEKAARTVANLAANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTLEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L   +++G++R QLRV DA+P +
Sbjct: 550 GIAFRAADTALGNLLVNSRGASLHVAGTLGAEHYQGARRLQLRVCDAAPAK 600


>gi|325292975|ref|YP_004278839.1| single-stranded-DNA-specific exonuclease [Agrobacterium sp. H13-3]
 gi|325060828|gb|ADY64519.1| single-stranded-DNA-specific exonuclease [Agrobacterium sp. H13-3]
          Length = 602

 Score =  487 bits (1254), Expect = e-135,   Method: Composition-based stats.
 Identities = 338/588 (57%), Positives = 432/588 (73%), Gaps = 1/588 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFL VE S +  RWVS L Q   NRALA++Q HAIP+++ARVL  R V +D A  FL+P
Sbjct: 12  RAFLSVERSATEQRWVSRLDQAAQNRALAMSQIHAIPELIARVLAGRGVGVDEALAFLDP 71

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP +LTDC+KAA R+V+AI   EK+ IFGDYDVDGAAS ALM RFL+H  +  
Sbjct: 72  TIRSLMPDPHMLTDCEKAAERLVRAIETGEKVAIFGDYDVDGAASSALMYRFLAHFGLTP 131

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP+ M++    GA LI+TVDCGSTS+++L  A + G DV+VIDHHQ
Sbjct: 132 KIYIPDRIFEGYGPNPAAMQQLAANGATLILTVDCGSTSHESLNAAKDAGTDVVVIDHHQ 191

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-QDNKVPLNFDLLSLL 242
           V SE  PA ALVNPNR DDLSGQGHLCAAGVVFLVLV   R+L+ + N+     DLL+LL
Sbjct: 192 VGSELPPAVALVNPNREDDLSGQGHLCAAGVVFLVLVATLRLLKDRRNRQAFTIDLLALL 251

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR   N GL AL  +  +  P+T  + G++IG
Sbjct: 252 DIVALATVCDVVPLKGLNRAYVVKGLIAARHMNNAGLAALFRKAGLGGPVTPYHFGFLIG 311

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DDS + +++A KLD LN+ R+ ME+ ML +AEA+ L + 
Sbjct: 312 PRINAGGRIGDAALGSRLLTLDDSSQADVIAEKLDELNRERQAMEAVMLAEAEAEALYEY 371

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D   A VIV   + WHPGIVGLLA+RLK++F RP+FAI+F+  GKG GSGRSI GFD+G
Sbjct: 372 GDGSGAGVIVTARENWHPGIVGLLASRLKDRFRRPAFAIAFDPSGKGTGSGRSINGFDMG 431

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+ G+LVKGGGHAMAAGLTVER N G+L  FF++ A   V  L+ + V KIDG 
Sbjct: 432 RMVRAAVDAGLLVKGGGHAMAAGLTVERANLGKLRTFFEEAAAKTVSELVESSVLKIDGA 491

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + L+D LE AGPYG+G+  P+FA P H+L+ +R+V  +H+++T E+ D   L 
Sbjct: 492 IGASGATLQLVDQLEQAGPYGSGHSQPIFAVPAHRLRDVRLVGTSHVKITLEAMDGSRLD 551

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            IAFR    PLG+ L+ +RG+ +HV G +  + W+G +R QLRVLDA+
Sbjct: 552 GIAFRAAEAPLGQMLLNARGRSIHVAGTVGADLWQGQRRVQLRVLDAA 599


>gi|15888900|ref|NP_354581.1| single-stranded-DNA-specific exonuclease [Agrobacterium tumefaciens
           str. C58]
 gi|15156672|gb|AAK87366.1| single-stranded-DNA-specific exonuclease [Agrobacterium tumefaciens
           str. C58]
          Length = 602

 Score =  485 bits (1248), Expect = e-134,   Method: Composition-based stats.
 Identities = 342/588 (58%), Positives = 435/588 (73%), Gaps = 1/588 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFL VE S +  RWVS L Q G NRALA++Q HAIP+++ARVL  R V +D A  FL+P
Sbjct: 12  RAFLSVERSATEQRWVSRLDQAGQNRALAMSQIHAIPELIARVLAGRGVGVDDALAFLDP 71

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP +LTDC+KAA R+V+AI   EK+ IFGDYDVDGAAS AL  RFL+H  +  
Sbjct: 72  TIRSLMPDPHMLTDCEKAAERLVRAIETGEKVAIFGDYDVDGAASSALTYRFLAHFGLTP 131

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP+ M++    GA LI+TVDCGSTS+++LQ A + G DV+VIDHHQ
Sbjct: 132 EIYIPDRIFEGYGPNPAAMQQLAANGATLIVTVDCGSTSHESLQAAKDAGTDVVVIDHHQ 191

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILR-QDNKVPLNFDLLSLL 242
           V +E  PA ALVNPNR DDLSGQGHLCAAGVVFLV+V   R+L+ + N+     DLLSLL
Sbjct: 192 VGTELPPAVALVNPNREDDLSGQGHLCAAGVVFLVMVATLRLLKDRRNRQAFTLDLLSLL 251

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR   N GL AL ++  +  P+T  + G++IG
Sbjct: 252 DIVALATVCDVVPLKGLNRAYVVKGLIAARHMNNAGLAALFKKAGLGGPVTPYHFGFLIG 311

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A KLD LN+ R+ ME+AML +AEA+ L + 
Sbjct: 312 PRINAGGRIGDAALGSRLLTIDDTTEAEVIAEKLDELNRERQAMEAAMLAEAEAEALYEY 371

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D   A VIV   + WHPGIVGLLA+RLK++F RP+FAI+F+  GKG GSGRSI GFD+G
Sbjct: 372 GDGSGAGVIVTARENWHPGIVGLLASRLKDRFRRPAFAIAFDPSGKGTGSGRSINGFDMG 431

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AVE G+LVKGGGHAMAAGLTVER N G+L  FF++ A   V  L+ + V KIDG 
Sbjct: 432 RMVRAAVETGLLVKGGGHAMAAGLTVERANLGKLRTFFEEAAAKTVNELVESSVLKIDGA 491

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + L+D LE AGPYG+G+  P+FA P H+L+ +R+V  AH+++T E+ D   L 
Sbjct: 492 IGASGATLQLVDQLEQAGPYGSGHSQPIFAVPAHRLRDVRLVGTAHVKITLEAMDGSRLD 551

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            IAFR    PLG+ L+ +RG+ +HV G +  + W+G +R QLRVLDA+
Sbjct: 552 GIAFRAAEAPLGQMLLNARGRNIHVAGTVGADLWQGQRRVQLRVLDAA 599


>gi|116251859|ref|YP_767697.1| single-stranded-DNA-specific exonuclease [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115256507|emb|CAK07591.1| putative single-stranded-DNA-specific exonuclease [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 586

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 337/586 (57%), Positives = 431/586 (73%), Gaps = 1/586 (0%)

Query: 9   VECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLL 68
           +E S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V++D A +FL+P+IR L
Sbjct: 1   MEKSALDNRWVARLDQAGQNRALAMSQIHGLPDLIARVLAGRGVTVDEAIEFLDPTIRSL 60

Query: 69  MPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP 128
           MPDP  LTDC+KAA R+++AI   E + IFGDYDVDGAAS ALM RFLSH  V A +YIP
Sbjct: 61  MPDPHKLTDCEKAATRLLRAIERGESVAIFGDYDVDGAASSALMFRFLSHFGVRATIYIP 120

Query: 129 DRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE 188
           DR+ +GYGPNP+ + + ++ GAQLI+TVDCGSTS++AL  A  + IDV+VIDHHQV  E 
Sbjct: 121 DRVFEGYGPNPAAINQLVDNGAQLIVTVDCGSTSHEALAAAAARNIDVVVIDHHQVTHEL 180

Query: 189 IPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLLDLVAL 247
            P +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR       L  DLL  LD+VAL
Sbjct: 181 PPCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRAAGNKRILAIDLLQWLDIVAL 240

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
           ATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL+ +  ++ P+T  + G++IGP INA
Sbjct: 241 ATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALLRKAGLAGPVTPYHFGFLIGPRINA 300

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGRIG++ LGSRLL  DD+ E +++A +LD LN+ R+ ME+ ML++AEA+ L +  D + 
Sbjct: 301 GGRIGDAALGSRLLTLDDAGEADVIAQRLDELNRERQAMEAIMLQEAEAEALAEYGDGEG 360

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
           ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G+MV  
Sbjct: 361 ASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMGRMVRA 420

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           AV+EG+LVKGGGHAMAAGLTVER N GRL  FF + A   V  L+     KIDG + AS 
Sbjct: 421 AVDEGLLVKGGGHAMAAGLTVERANLGRLRTFFTEKAERTVAGLVANETLKIDGAIGASG 480

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
             + LID LE+AGPYG+G+  P+FA P H+L+  R+V   H+++T E+ D   L  IAFR
Sbjct: 481 ATLELIDRLEAAGPYGSGHAQPLFAVPAHRLRDARLVGEKHVKVTLEAMDGSRLDGIAFR 540

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
              TPLG  L+ SRG  +HV G L  ++++G++R QLRV DA+P +
Sbjct: 541 AADTPLGNLLINSRGASLHVAGSLGADHYQGARRIQLRVCDAAPAK 586


>gi|209549146|ref|YP_002281063.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534902|gb|ACI54837.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 600

 Score =  481 bits (1239), Expect = e-133,   Method: Composition-based stats.
 Identities = 340/591 (57%), Positives = 433/591 (73%), Gaps = 1/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S    RWV+ L Q G NRALA++Q H +PD++ARVL  R V+ D A +FL+P
Sbjct: 10  RAFLGVEKSALDNRWVARLDQAGQNRALAMSQIHGMPDLIARVLAGRGVTADEAIEFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP ILTDC++AA R+V AI   E + IFGDYDVDGAAS ALM RFL+H  V A
Sbjct: 70  TIRGLMPDPHILTDCERAATRLVSAIERGENVAIFGDYDVDGAASSALMFRFLTHFGVKA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
           N+YIPDR+ +GYGPNP+ M + I+ GA+LI+TVDCGSTS++AL+ A  + IDV+VIDHHQ
Sbjct: 130 NIYIPDRVFEGYGPNPAAMNQLIDNGARLIVTVDCGSTSHEALEAAAARSIDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLL 242
           V  E    +ALVNPNR DDLSGQGHLCAAGVVF+VLV   R+LR       L  DLL  L
Sbjct: 190 VTHELPHCHALVNPNREDDLSGQGHLCAAGVVFMVLVATLRLLRASGNKGILALDLLQWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           D+VALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL  +  ++ P+T  + G++IG
Sbjct: 250 DIVALATVCDVVPLKGLNRAYVVKGLVAARHQSNAGLAALFRKAGLAGPVTPYHFGFLIG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A +LD LN+ R+ ME+ ML++AEA+ L + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDTGEAEVIAQRLDELNRERQAMEAIMLQEAEAEALAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D + ASVIV   ++WHPGIVGL+AARLKEKF RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 370 GDGEGASVIVTAHEKWHPGIVGLIAARLKEKFKRPAFAIAFDPSGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           +MV  AV+EG+LVKGGGHAMAAGLTVER + GRL  FF + +   V  L+     KIDG 
Sbjct: 430 RMVRAAVDEGLLVKGGGHAMAAGLTVERADLGRLRTFFTEKSARTVANLVANETLKIDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + AS   + LID LE+AGPYG+G+  P+FA P H+++  R+V   H+++T E+ D   L 
Sbjct: 490 IGASGATLELIDRLEAAGPYGSGHAQPLFAVPAHRVRDARLVGEKHVKVTMEAMDGSRLD 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            IAFR   T LG  L+ SRG  +HV G L   +++G++R QLRV DA+P +
Sbjct: 550 GIAFRAADTALGNLLINSRGASLHVAGALGAEHYQGARRIQLRVCDAAPAK 600


>gi|288957790|ref|YP_003448131.1| single-stranded-DNA-specific exonuclease [Azospirillum sp. B510]
 gi|288910098|dbj|BAI71587.1| single-stranded-DNA-specific exonuclease [Azospirillum sp. B510]
          Length = 616

 Score =  481 bits (1238), Expect = e-133,   Method: Composition-based stats.
 Identities = 251/599 (41%), Positives = 357/599 (59%), Gaps = 11/599 (1%)

Query: 1   MND-QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD 59
           M +  AFL V  S+SG RW +    E   +A A+TQ   +P+IV RVL  R V+ +  + 
Sbjct: 19  MTEPAAFLNVANSLSGKRWQARPCDE--RQAQALTQGRGLPEIVGRVLAARGVTEESCET 76

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FLNP+++ L+PDP    D D AA RI +AI + E + +FGDYDVDGA S AL+ RF    
Sbjct: 77  FLNPTLKALLPDPSRFRDMDPAAERIARAIRDGEPVAVFGDYDVDGATSAALLRRFFRAL 136

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
             +  +Y+PDRI +GYGPN + + +   EG +L++TVDCG +++ AL+ A    ++V+V+
Sbjct: 137 GADIRVYVPDRIKEGYGPNAAALLRLKGEGVRLVVTVDCGISAFAALEAAAEAELEVVVL 196

Query: 180 DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FD 237
           DHH  +    PA ALVNPNRLD+      LCAAGV F+ +V + R LR           +
Sbjct: 197 DHHAAEPRLPPAVALVNPNRLDEDGAYRTLCAAGVTFITIVAVNRALRTSGFYRDRAEPN 256

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           L+  LDLVAL TVCDVVPL GLNRA V +GL V  R+ NPGL AL +   +     A + 
Sbjct: 257 LMEWLDLVALGTVCDVVPLTGLNRALVAQGLKVMARRANPGLAALSDVAGVKEKPDAYHA 316

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAK 357
           GY++GP +NAGGR+G S+LG+RLL +DD  E   LA +L+  N  RR +E A+L++A  +
Sbjct: 317 GYVLGPRVNAGGRVGASDLGARLLSTDDPVEAMELAQRLEGHNAERRAVEQAVLDEALER 376

Query: 358 VLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDG----KGIGSG 413
           V T+     +  ++ V G  WHPG++G++AARLKE++ RP+  ++ EE       G  SG
Sbjct: 377 VATEAGR--ETDLVFVTGAGWHPGVIGIVAARLKERYSRPACVVALEETADGTLIGKASG 434

Query: 414 RSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALIT 473
           RS+ G D+G  V  A +EG+L+ GGGH MAAG TV       L DF        V A   
Sbjct: 435 RSVRGVDLGAAVIAARQEGLLLAGGGHRMAAGFTVAGDKIDALRDFLHGRISEQVAAAPL 494

Query: 474 TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
            P+ ++DG L+    ++ L+ ML+  GPYG GN  P FA  + ++    VV   H++   
Sbjct: 495 VPMLELDGALSVGGASVGLVTMLDKLGPYGTGNSEPRFAIADARVVRADVVGANHVRCIL 554

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           +  D   L+AIAFR   + +G+ L+  RG   H+ G L ++ W GS+  QL + DA+P 
Sbjct: 555 QGNDGARLKAIAFRALDSDMGQALLTGRGTPFHLAGVLRIDRWNGSEGVQLLIDDAAPA 613


>gi|222148683|ref|YP_002549640.1| single-stranded-DNA-specific exonuclease [Agrobacterium vitis S4]
 gi|221735669|gb|ACM36632.1| single-stranded-DNA-specific exonuclease [Agrobacterium vitis S4]
          Length = 600

 Score =  480 bits (1234), Expect = e-133,   Method: Composition-based stats.
 Identities = 336/591 (56%), Positives = 430/591 (72%), Gaps = 1/591 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           ++AFL VE S+SG RWVS L Q G+NR+LAI Q H IPD+VARVL  R V++  A+ FL+
Sbjct: 9   ERAFLNVETSVSGQRWVSRLDQAGLNRSLAIAQVHGIPDLVARVLAGRGVAVADAQAFLD 68

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+IR LMPDP  LTD DKAA R+V AI  SE++ IFGDYDVDGAAS AL+ RFL+H  + 
Sbjct: 69  PTIRDLMPDPSSLTDGDKAADRLVAAIMRSERVAIFGDYDVDGAASSALLWRFLAHFGIE 128

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPN   + + I  GAQLI+TVDCGSTS++AL+ A  +G+DV+VIDHH
Sbjct: 129 AEIYIPDRIFEGYGPNAVAIGQLIERGAQLIVTVDCGSTSHEALEEARRRGVDVVVIDHH 188

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNF-DLLSL 241
           Q+  +     ALVNPNR DDLSGQGHLCAAGVVF+VLV   R LR+         DLL+ 
Sbjct: 189 QMGQDLPACLALVNPNRSDDLSGQGHLCAAGVVFMVLVGTLRKLREAGHGAARSLDLLAW 248

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATVCDVVPL GLNRAYVVKGL+ AR Q N GL AL++   I  P+T  + G+++
Sbjct: 249 LDLVALATVCDVVPLKGLNRAYVVKGLIAARHQQNAGLAALLKIAGIGGPVTPYHFGFLV 308

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LGSRLL  DD+ E + +A +LD LN+ R+ ME+ ML +AEA+ + +
Sbjct: 309 GPRINAGGRIGDAALGSRLLTLDDAAEADEIAAQLDDLNRQRQAMEAQMLAEAEAEAMAE 368

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
               + A+VI+   + WHPGIVGLLAARLKE+F RP+FAI+F+  GKG GSGRSI GFD+
Sbjct: 369 YGTGENAAVILTAREGWHPGIVGLLAARLKERFQRPAFAIAFDGSGKGTGSGRSIAGFDM 428

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           GKMV  AV+ G+LVKGGGHAMAAGLTVER N G+L  FF + A   V AL      KIDG
Sbjct: 429 GKMVRAAVDNGLLVKGGGHAMAAGLTVERGNLGKLRAFFDEQAQEKVMALSAIRALKIDG 488

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            + AS   +ALID+LE+AGPYG+G+  P+FA P H+++  R++  +H+++T E+ D   +
Sbjct: 489 AVGASGATLALIDLLETAGPYGSGHSQPIFAIPAHRIRDSRLIGTSHVKVTLEAPDGSRI 548

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
             IAFR   TPLG+ L+  RG  +HV G L    W+G++R Q+R+LDA+P 
Sbjct: 549 DGIAFRAKETPLGDLLLGRRGDAVHVAGCLGAELWQGTRRIQIRILDAAPA 599


>gi|312115910|ref|YP_004013506.1| single-stranded-DNA-specific exonuclease RecJ [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311221039|gb|ADP72407.1| single-stranded-DNA-specific exonuclease RecJ [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 609

 Score =  479 bits (1232), Expect = e-133,   Method: Composition-based stats.
 Identities = 273/595 (45%), Positives = 363/595 (61%), Gaps = 3/595 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            AFLGVE S  G +W+  L  +  + A AI Q+H +P+IV R+L  R VS+D   D LNP
Sbjct: 15  SAFLGVERSARGLKWIERLAPQDAHIAAAIAQRHNLPEIVGRILAARGVSLDEVADVLNP 74

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L PDP   TD DKAA RI +AI   E+I IFGDYDVDGA+S AL+ RFL+   ++A
Sbjct: 75  TLRALCPDPSTFTDMDKAADRIARAIETGERIAIFGDYDVDGASSSALLKRFLAWHGLDA 134

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   + + I +GAQLI+TVDCGSTS++AL  A  +G++V+V+DHHQ
Sbjct: 135 RIYIPDRITEGYGPNGPAIAQLIEDGAQLIVTVDCGSTSFEALDVAAKRGVEVVVVDHHQ 194

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFDLLSL 241
           V  E   A+A+VNPNR D LSGQGHLCAAGV FL+ V   R LR           DLL  
Sbjct: 195 VNEELPVAHAVVNPNRQDCLSGQGHLCAAGVTFLLCVAAQRRLRAKGAYAKSPAPDLLGW 254

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LD+VALATVCDVVPL G+NRA+VV+GL V R + NPGL+AL +   ++ P +   LG+++
Sbjct: 255 LDIVALATVCDVVPLSGVNRAFVVQGLKVLRNRRNPGLRALADAAGVNKPPSPYTLGFVL 314

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG+++LG+RLL S+D  E   +A  LD LN+ RR +E   +E+A A     
Sbjct: 315 GPRINAGGRIGDASLGARLLASEDDIETRRIAETLDRLNRERREIEIKTVEEAAAWADRT 374

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFD 420
             +   A +I+     WH G+VGL A+RL E+F RP    S ++D G+  GS RS+ G D
Sbjct: 375 LMEDPSAPIIIAGSPSWHKGLVGLAASRLTERFQRPCLIFSQDDDAGESTGSARSVSGVD 434

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           IG  V  AVE G+  KGGGH MAAG+TV+      L  F +             P   ID
Sbjct: 435 IGAAVRGAVEAGVAKKGGGHTMAAGITVDTARLHELAAFLRAALDPAYRVASAAPELAID 494

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           GVL   A  +     LE+AGPYG GNP P F+  + +   I+ ++  HL++  +  D   
Sbjct: 495 GVLKPRAATLDFCAQLEAAGPYGQGNPAPRFSLASVRPTMIKEISGGHLRLALQDVDGSQ 554

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
           + A+AFR   T +G  L   R    HV G +  + W G  R +  + D +P    
Sbjct: 555 ISAVAFRAAQTEIGAALAAGRDLACHVAGRIERDEWGGKSRIEFHIEDVAPANAR 609


>gi|83312829|ref|YP_423093.1| single-stranded DNA-specific exonuclease [Magnetospirillum
           magneticum AMB-1]
 gi|82947670|dbj|BAE52534.1| Single-stranded DNA-specific exonuclease [Magnetospirillum
           magneticum AMB-1]
          Length = 597

 Score =  478 bits (1231), Expect = e-133,   Method: Composition-based stats.
 Identities = 253/588 (43%), Positives = 366/588 (62%), Gaps = 8/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+SG RW++  G E    A A+ Q+ A+P++V RVL +R + +D A+ FLNP+
Sbjct: 13  AFLGVERSLSGRRWLARPGDE--RLAQALAQRLALPELVGRVLASRGIGLDEAESFLNPT 70

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L   DKA  R+V A+   E I IFGDYDVDGA S AL+   L+     A 
Sbjct: 71  LRDLLPDPGHLKGMDKAVERLVAAVTRGETIGIFGDYDVDGATSSALLRNALADMGAKAR 130

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   + +  +EG  +++TVDCG+T++DAL+ AT  G+D+IV+DHH  
Sbjct: 131 VYIPDRIKEGYGPNAPALLRLRDEGVAVVVTVDCGTTAFDALETATRAGLDMIVVDHHVG 190

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLL 242
           ++    A A++NPNRLD+ S  GHL A GV FL+ V + R L+           DL+  L
Sbjct: 191 EAALPAALAVINPNRLDETSPHGHLAAVGVAFLLAVGLNRGLKAAGWYQSRPAPDLMRWL 250

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVAL TVCDVVPL+G+NRA VV+GL V  ++ N GL AL +   +     +  LGY++G
Sbjct: 251 DLVALGTVCDVVPLVGVNRALVVQGLKVMAKRANVGLAALADVAGVKERPDSYTLGYVLG 310

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P +NAGGR+GE+ LG+RL+ +D+  E   +A +LD  N++R+ +E+ +L  A  +V T+ 
Sbjct: 311 PRVNAGGRVGEAELGTRLMSTDNPAEAAEIARQLDGYNKDRQEIEAVVLLDAIEQVETRP 370

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
           DD     ++V  G+ WHPG++G++A RLKE++GR +  ++  E  +G GSGRS+ G D+G
Sbjct: 371 DD--GRPLLVAAGENWHPGVIGIVAGRLKERYGRVACVVA-LEGDQGKGSGRSVPGLDLG 427

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
             +  A + G+L  GGGHAMAAG TV R     L DF  +     +      P+ ++DG 
Sbjct: 428 SAIIAARQAGLLRAGGGHAMAAGFTVARDKLTALSDFLAERLQAQL-EGDLVPLLELDGA 486

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L+A A  I L++ L   GP+G+GNP P FA    ++    VV   H+++       + L+
Sbjct: 487 LDAGAAGIELVETLAGVGPFGSGNPEPRFAISGARIAKADVVGSGHVRLILTGAGGKRLK 546

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           AIAFR   + +G  L+ S G   H+ G L V+ W+G+   QL V DA+
Sbjct: 547 AIAFRAADSEMGHALLSSAGASFHLAGTLRVDTWQGNSSVQLIVDDAA 594


>gi|46201274|ref|ZP_00055375.2| COG0608: Single-stranded DNA-specific exonuclease [Magnetospirillum
           magnetotacticum MS-1]
          Length = 596

 Score =  477 bits (1227), Expect = e-132,   Method: Composition-based stats.
 Identities = 252/588 (42%), Positives = 370/588 (62%), Gaps = 8/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+SG RW++  G E    A+ + Q+  +P++V RVL +R + +D A+ FLNP+
Sbjct: 12  AFLGVERSLSGRRWLARPGDE--RLAVTLAQRLGLPELVGRVLASRGIGLDEAESFLNPT 69

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L   DKA  R+V+A+  +E I IFGDYDVDGA S AL+   L+     A 
Sbjct: 70  LRDLLPDPGHLKGMDKAVERLVKAVTGAETIGIFGDYDVDGATSSALLKNALADMGAKAR 129

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   + +   EG  ++ITVDCG+T+++ALQ AT  G+D+IV+DHH  
Sbjct: 130 VYIPDRIKEGYGPNAPALLRLKAEGVGVVITVDCGTTAFEALQTATQAGLDMIVVDHHVG 189

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLL 242
           ++    A A++NPNRLD+ S  GHL A GV FL+ V + R L+           DL+  L
Sbjct: 190 EAALPAALAVINPNRLDETSPHGHLAAVGVAFLLAVGLNRGLKAAGWYQSRPAPDLMRWL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVAL TVCDVVPL+G+NRA VV+GL V  ++GN GL AL +   +     +  LGY++G
Sbjct: 250 DLVALGTVCDVVPLVGVNRALVVQGLKVMAKRGNVGLAALADVAGVKERPDSYTLGYVLG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P +NAGGR+GE+ LG+RL+ ++D+ E   +A +LD  N++R+ +E+ +L  A  +V T+ 
Sbjct: 310 PRVNAGGRVGEAELGTRLMSTEDAAEAAEIARQLDGYNKDRQEIEAVVLLDAIEQVETRP 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
           DD     +++  G+ WHPG++G++A RLKE++GR +  ++  E G+G GSGRS+ G D+G
Sbjct: 370 DD--GRPLLMAAGENWHPGVIGIVAGRLKERYGRVACVVA-LEGGQGKGSGRSVPGLDLG 426

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
             +  A + G+L+ GGGHAMAAG TV R     L DF  +     +      P+ ++DG 
Sbjct: 427 SAIIAARQAGLLLAGGGHAMAAGFTVARDKLNDLSDFLAERLQAQL-EGDLVPLLELDGA 485

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L+A A  I L++ L   GP+G+GNP P FA    ++    VV   H+++       + L+
Sbjct: 486 LDAGAAGIELVETLAQVGPFGSGNPEPRFAISGARIAKADVVGSGHVRLMLTGAGGKRLK 545

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           AIAFR   + +G  L+ S G   H+ G L V+ W+G+   QL + DA+
Sbjct: 546 AIAFRAADSEMGHALLSSAGASFHLAGTLRVDTWQGNSSVQLIIDDAA 593


>gi|304391919|ref|ZP_07373861.1| single-stranded-DNA-specific exonuclease RecJ [Ahrensia sp. R2A130]
 gi|303296148|gb|EFL90506.1| single-stranded-DNA-specific exonuclease RecJ [Ahrensia sp. R2A130]
          Length = 597

 Score =  476 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 290/593 (48%), Positives = 393/593 (66%), Gaps = 2/593 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           D+ FL VE SISG RW   + +    +A A+ ++H+IP++VARVL  R+V+ D A  FL+
Sbjct: 5   DRPFLDVESSISGQRWEERMSRTQAGQAEAMRERHSIPELVARVLAARDVTADEALGFLD 64

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R LMPDP +LT  D AA R+V AI   E + +FGDYDVDGA S AL+  FL +  V 
Sbjct: 65  PKLRDLMPDPSLLTGMDAAADRLVSAIAAKEPVAVFGDYDVDGATSSALLAAFLRNFDVP 124

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             +YIPDRI +GYGPN + + +    GA+L++TVDCGSTS+DAL  A + G+D +V+DHH
Sbjct: 125 VEIYIPDRIFEGYGPNENAIRELAERGAKLLVTVDCGSTSHDALAVAKSLGLDAVVLDHH 184

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFD--LLS 240
           QV  E     ALVNPNR DDLSGQGHLCAAGVVFL LV   R +RQ  K+P +    L+ 
Sbjct: 185 QVGDELPDVIALVNPNRQDDLSGQGHLCAAGVVFLTLVATQRAMRQQGKLPTDKPVDLMQ 244

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVAL TVCDVVPL GLNRA+V +G+ V ++Q N GL AL        P    +LG++
Sbjct: 245 SLDLVALGTVCDVVPLKGLNRAFVTRGIEVMQKQRNVGLAALARVARQDGPAAPWHLGFV 304

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG++ LG+RLL + D  E E +A +LD LN  R+ +E+AML QA  +   
Sbjct: 305 LGPRINAGGRIGDAALGARLLTTSDPTEAEEIAQQLDTLNGERQNIETAMLAQAIDEAEA 364

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +    +  SV+V E D WH G+VGLLA+RLK++F RP+FAI+F+  G+G GSGRSI G D
Sbjct: 365 EIGFSEGPSVLVTESDTWHAGVVGLLASRLKDRFNRPTFAIAFDGRGRGQGSGRSIPGCD 424

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G+ V  AV+EG+L+KGGGHAMAAG+T+ER   G    F ++   + V     +   +ID
Sbjct: 425 LGRTVRAAVDEGLLLKGGGHAMAAGITIERDKLGDFRAFMEERLCDDVATARLSRSVRID 484

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L+A    + + D L +AGP+GAG+  P+ AFP H L+   VV   H++ +  S D   
Sbjct: 485 GALSARGATVEMFDQLAAAGPFGAGHSQPLLAFPRHTLRFSDVVGKGHVRFSIGSADGAE 544

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           L+ I+FR   TPLG+ L+  RGK MH  G L  +++RG++R QLR++D +  +
Sbjct: 545 LRGISFRAVDTPLGDALLDGRGKVMHFAGTLSADFFRGTRRVQLRLVDVALAQ 597


>gi|182678538|ref|YP_001832684.1| single-stranded-DNA-specific exonuclease RecJ [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182634421|gb|ACB95195.1| single-stranded-DNA-specific exonuclease RecJ [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 610

 Score =  475 bits (1221), Expect = e-131,   Method: Composition-based stats.
 Identities = 275/601 (45%), Positives = 376/601 (62%), Gaps = 7/601 (1%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
           + + FL VE S+ G  W   L   G  +ALA+ Q H   D+++RVL  R ++ +  + +L
Sbjct: 9   SSRPFLNVERSVQGRVWRDRLDASGQAQALALAQIHGHGDLLSRVLAGRGITPEDCEAYL 68

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +PS+R LMPDP IL D DKAA R+ +AI   EKI IFGDYDVDGA+S AL+  + + C  
Sbjct: 69  DPSLRRLMPDPTILLDMDKAAVRMARAIMAGEKIAIFGDYDVDGASSSALLADYFTACGT 128

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   ++     GA+L++TVDCG+TS++ L  A   G+D IV+DH
Sbjct: 129 PFQIHIPDRIFEGYGPNVDAIQALAAGGAKLLVTVDCGTTSHNPLGEAAKLGLDPIVLDH 188

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDL 238
           HQ    ++P   +VNPNR DDLSG G LCAAGVVF++LV + R LR+           DL
Sbjct: 189 HQAP-ADLPEAIIVNPNRQDDLSGLGQLCAAGVVFMLLVALNRRLREQGFFTAERREPDL 247

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           L+ LDLVALATV DV PL GLNRA+V KGL V + +   GL+AL +         A +LG
Sbjct: 248 LAFLDLVALATVADVAPLTGLNRAFVTKGLAVMQMRQRAGLRALFDCAGAREAPKAGHLG 307

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           ++IGP INAGGRIG++ LG+RLLI  D  + E +A +LD LN+ R+++E+  LEQA  + 
Sbjct: 308 FLIGPRINAGGRIGDAALGARLLIERDQIKAEEIARRLDTLNRERQVIEAETLEQALLQA 367

Query: 359 LTQ---CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRS 415
             +    DD +  + IV   + WHPGIVGL+A RLK+K+  P+FA++F E G G GSGRS
Sbjct: 368 EAEQGLQDDAKAGAAIVTASEDWHPGIVGLVATRLKDKYRCPAFAVAFNESGIGTGSGRS 427

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           I G D+G  V  AVE G+L+KGGGHAMAAG+T+ R +      F ++     V A  +  
Sbjct: 428 IAGVDLGHAVREAVEAGLLIKGGGHAMAAGITLVRDHLAAFRAFLEEKLTEAVTAGRSGD 487

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES 535
              +D  L AS  N AL+  LE AGP+GAGNP PVF  P H+L    VV   H++   E+
Sbjct: 488 ALFVDAALTASGANPALMASLEKAGPFGAGNPEPVFVLPAHRLMDASVVGNGHVRFRAEA 547

Query: 536 QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
            D   ++ IAFR    PLG+ L+  RG +MH  G L ++ + G +R Q+R+ D +P+   
Sbjct: 548 GDGARIEGIAFRSAAEPLGDALLAGRGTKMHFAGTLMLDRFGGRERVQMRLTDLAPLATQ 607

Query: 596 H 596
            
Sbjct: 608 K 608


>gi|260434121|ref|ZP_05788092.1| single-stranded-DNA-specific exonuclease RecJ [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417949|gb|EEX11208.1| single-stranded-DNA-specific exonuclease RecJ [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 580

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 247/589 (41%), Positives = 344/589 (58%), Gaps = 10/589 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FL VE S++G RWV    +     A  + Q+  +P  + +VL  R V+   A+ FL P 
Sbjct: 2   SFLSVEHSLTGRRWVGPPPEMD-RAAEMLAQQTDLPRPLCQVLARRGVTPAEAESFLAPK 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R +QA+   ++I IF DYDVDG +S AL++ +L    +NA 
Sbjct: 61  LRDLLPDPRELKDMETAAARFLQAVRQKQRIAIFADYDVDGGSSAALLIVWLRQMGLNAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN   M +       LII VDCG+ S+DA+  A   G DVIV+DHH  
Sbjct: 121 LYVPDRIDEGYGPNAPAMAQLAA-THDLIICVDCGTLSHDAIAAAQ--GADVIVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+     +LCAA VVFL+LV   R LR         DL+++LDL
Sbjct: 178 GETLPDCVAVVNPNRQDESGDLAYLCAAAVVFLMLVEAGRQLRAAG--TKGPDLMAMLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+G+NRA V +GL V  R+  PGL AL +   + +   + +LG+++GP 
Sbjct: 236 VALATVADVAPLVGVNRALVQQGLKVMARRQRPGLVALSDVARMDTAPNSYHLGFLLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL +D   E E LA +LD LN  RR +E+A+   A A+   +  D
Sbjct: 296 VNAGGRIGQADLGARLLSTDSPAEAEALAKRLDALNTERRDIENAVRAAALAQAEDRGLD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   GD WHPG+VG++A+RLKE   RP+  I F +  +G GSGRS+ G D+G  
Sbjct: 356 ---APLVWAAGDGWHPGVVGIVASRLKETANRPAIVIGF-DGDEGKGSGRSVSGVDLGAA 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+LVKGGGH MAAGLTV R           +               K+DGVL 
Sbjct: 412 IHRLASEGLLVKGGGHKMAAGLTVMRDQLEPAMARLSELLAKQGAGEGGPADLKLDGVLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  +ALI+ +E AGP+GAG P P FA P+ +++  + V   HL+++        + AI
Sbjct: 472 PGAATVALIEQIEQAGPFGAGAPAPRFALPDLQIRFAKRVGETHLKLSLSDGMGGGIDAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           AF  +  P+G+ L    G R H  G L VN W G +  QLR+ DA+  +
Sbjct: 532 AFGAFDGPMGDRLANHGGARFHFAGRLEVNTWGGRQSVQLRLEDAAEAK 580


>gi|306844173|ref|ZP_07476766.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. BO1]
 gi|306275448|gb|EFM57185.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. BO1]
          Length = 594

 Score =  472 bits (1215), Expect = e-131,   Method: Composition-based stats.
 Identities = 317/590 (53%), Positives = 401/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIERRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSAPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLTLVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G+ +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGRSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254714329|ref|ZP_05176140.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M644/93/1]
 gi|254717228|ref|ZP_05179039.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M13/05/1]
 gi|261219046|ref|ZP_05933327.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M13/05/1]
 gi|261322106|ref|ZP_05961303.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M644/93/1]
 gi|260924135|gb|EEX90703.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M13/05/1]
 gi|261294796|gb|EEX98292.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M644/93/1]
          Length = 594

 Score =  471 bits (1213), Expect = e-130,   Method: Composition-based stats.
 Identities = 318/590 (53%), Positives = 401/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +  D   ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISDGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|83593743|ref|YP_427495.1| RecJ exonuclease [Rhodospirillum rubrum ATCC 11170]
 gi|83576657|gb|ABC23208.1| RecJ exonuclease [Rhodospirillum rubrum ATCC 11170]
          Length = 606

 Score =  471 bits (1212), Expect = e-130,   Method: Composition-based stats.
 Identities = 250/593 (42%), Positives = 361/593 (60%), Gaps = 9/593 (1%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           D AFLGVE S  G RWV   G E   +ALAI+Q+  +P++V RVL  R V ++ A  FL 
Sbjct: 17  DAAFLGVERSRGGRRWVLRPGDE--RQALAISQRLGVPEVVGRVLTGRGVQVEEADGFLT 74

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R L+PDP  L D DKA  R+ +A+ + E I IFGDYDVDGA S ALM RF       
Sbjct: 75  PTLRALLPDPGHLLDMDKAVARLSKAVRDKETIAIFGDYDVDGATSTALMHRFFRSLGAR 134

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDR+++GYGPN   +E    +GA++++TVDCG +++DAL+ A   G+DV+V DHH
Sbjct: 135 VLIHIPDRVLEGYGPNAPALEALAAKGARVVLTVDCGISAFDALRAAKAAGLDVVVCDHH 194

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV----PLNFDL 238
           + ++E   A A+VNP RLD+ S   HL A GV FL+ V I R LR             DL
Sbjct: 195 EARTELPAAVAVVNPKRLDEASPHTHLAAVGVAFLMAVAINRDLRDSGWFAAEQRPPPDL 254

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           ++LLDLVAL TVCD+VPLIG+NRA V +GL V  ++ NPG+ AL E   +   + A +LG
Sbjct: 255 MALLDLVALGTVCDMVPLIGVNRALVQQGLKVIAKRTNPGIAALAEVSGVRDRVDAFHLG 314

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +M+GP +NAGGR+G++ +G+ LL S+D  E    A +LD  N  R+ +E+A+L QA  +V
Sbjct: 315 FMLGPRVNAGGRVGQAGMGAALLSSEDPLECLDFARQLDAFNGARKEIEAAVLHQAIEQV 374

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
             +        ++   G  WHPG+VG++A+RLKE++G P+ A++  + G   GSGRS+ G
Sbjct: 375 --EAAPANDLPLVFASGTDWHPGVVGIVASRLKERYGLPACAVA-LDGGLAKGSGRSVGG 431

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+G++V  A E G+L  GGGHAMAAG ++          F  +   + V AL       
Sbjct: 432 VDLGRVVIAAREAGVLEAGGGHAMAAGFSLRTDRLEEFRQFLGERLKDQVAALALVASLD 491

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +DGVL+    N  L+  L  AGPYG+GNP P FA  N ++  + VV + H++        
Sbjct: 492 LDGVLDVRGANAQLVRALSQAGPYGSGNPEPRFAVANARVGKVDVVGMGHVRCFLNGPSG 551

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            +L+A+AF+   + +G  L+ + G  +HV G L ++ ++G +   L V D +P
Sbjct: 552 GSLKAMAFKAADSEIGHALLTAHGASLHVAGTLRLDSFQGRETVVLVVDDVAP 604


>gi|110633344|ref|YP_673552.1| exonuclease RecJ [Mesorhizobium sp. BNC1]
 gi|110284328|gb|ABG62387.1| exonuclease RecJ [Chelativorans sp. BNC1]
          Length = 594

 Score =  470 bits (1209), Expect = e-130,   Method: Composition-based stats.
 Identities = 307/587 (52%), Positives = 395/587 (67%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           + FLGV  S  G  W   L   G N AL I Q H +P+IVARVL  R V+++ A+ FL P
Sbjct: 6   RYFLGVRQSARGVSWEHRLDSRGENVALGIAQSHGVPEIVARVLAGRGVALEEAERFLTP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           SIR L+PDP  LTD +KAARRI  A++  E++ IFGDYDVDGA S A++ RFL+H  V A
Sbjct: 66  SIRDLLPDPAGLTDMEKAARRIADAVHAGERVAIFGDYDVDGAVSSAILKRFLAHYGVTA 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDR+ +GYGPNP  M + I  GA+LI+TVDCG+ S  ++  A   G +V+V+DHHQ
Sbjct: 126 EIYIPDRLFEGYGPNPDAMRELIRRGAKLIVTVDCGTNSAPSIAAANEMGAEVVVLDHHQ 185

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
           V  +   A A+VNPNR DDLSGQGHLCAAGVVFL LV   RILR++ +     DLLS+LD
Sbjct: 186 VGGDLPEAVAIVNPNREDDLSGQGHLCAAGVVFLALVQTTRILREELRATPPPDLLSMLD 245

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL+G+NRA+V KGL+ AR+   PGL AL     I  P+   +LG+++GP
Sbjct: 246 LVALATVCDVVPLVGVNRAFVAKGLLAARQMRTPGLSALARVARIGEPLNCHHLGFLLGP 305

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG + LGS LL + +  E E +A  LD LNQ R+ ME+AML +A A+   +  
Sbjct: 306 RINAGGRIGNAALGSLLLATVEPGEAESIAATLDRLNQERQAMETAMLAEARAEADAELM 365

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
                +V+V   D WHPGIVGL+A+RLK+   RP+FAI+F+ +G G GSGRSI GFD+G+
Sbjct: 366 SGDGPAVLVTASDTWHPGIVGLIASRLKDHARRPTFAIAFDMNGMGTGSGRSITGFDLGR 425

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  AV EG+LVKGGGHAMAAG+TVER   G L  FF++ A   V  L  +   +ID  L
Sbjct: 426 LVRDAVSEGLLVKGGGHAMAAGITVERKKLGALRAFFEEKAAGAVSLLRQSESLRIDAAL 485

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +A    + L++ LE+AGPYG+G+P PV A P H+L   ++V   H++    S     LQA
Sbjct: 486 SAEGATLELLETLEAAGPYGSGHPAPVLALPRHRLADAKLVGNGHIRADLRSLSGARLQA 545

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR   T LG FL  SRG  +HV G L VN+W GS+  Q R+ DA+
Sbjct: 546 IAFRAAETDLGNFLFASRGASVHVAGTLAVNHWNGSRSVQFRITDAA 592


>gi|17987011|ref|NP_539645.1| single-stranded-DNA-specific exonuclease RECJ [Brucella melitensis
           bv. 1 str. 16M]
 gi|23502146|ref|NP_698273.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis 1330]
 gi|161619221|ref|YP_001593108.1| single-stranded-DNA-specific exonuclease RecJ [Brucella canis ATCC
           23365]
 gi|163843533|ref|YP_001627937.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis ATCC
           23445]
 gi|225852764|ref|YP_002732997.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           ATCC 23457]
 gi|254702006|ref|ZP_05163834.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 5
           str. 513]
 gi|254710333|ref|ZP_05172144.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis B2/94]
 gi|256031827|ref|ZP_05445441.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M292/94/1]
 gi|256044911|ref|ZP_05447815.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256113827|ref|ZP_05454620.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 3 str. Ether]
 gi|256160006|ref|ZP_05457715.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M490/95/1]
 gi|256255227|ref|ZP_05460763.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti B1/94]
 gi|256263751|ref|ZP_05466283.1| phosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369691|ref|YP_003107201.1| single-stranded-DNA-specific exonuclease RecJ [Brucella microti CCM
           4915]
 gi|260565488|ref|ZP_05835972.1| phosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260566210|ref|ZP_05836680.1| phosphoesterase [Brucella suis bv. 4 str. 40]
 gi|261222424|ref|ZP_05936705.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti B1/94]
 gi|261317897|ref|ZP_05957094.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis B2/94]
 gi|261752573|ref|ZP_05996282.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 5
           str. 513]
 gi|265988926|ref|ZP_06101483.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M292/94/1]
 gi|265991339|ref|ZP_06103896.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265995176|ref|ZP_06107733.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 3 str. Ether]
 gi|265998391|ref|ZP_06110948.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M490/95/1]
 gi|17982663|gb|AAL51909.1| single-stranded-DNA-specific exonuclease recj [Brucella melitensis
           bv. 1 str. 16M]
 gi|23348109|gb|AAN30188.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis 1330]
 gi|161336032|gb|ABX62337.1| single-stranded-DNA-specific exonuclease RecJ [Brucella canis ATCC
           23365]
 gi|163674256|gb|ABY38367.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis ATCC
           23445]
 gi|225641129|gb|ACO01043.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           ATCC 23457]
 gi|255999853|gb|ACU48252.1| single-stranded-DNA-specific exonuclease RecJ [Brucella microti CCM
           4915]
 gi|260151556|gb|EEW86650.1| phosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260155728|gb|EEW90808.1| phosphoesterase [Brucella suis bv. 4 str. 40]
 gi|260921008|gb|EEX87661.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti B1/94]
 gi|261297120|gb|EEY00617.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis B2/94]
 gi|261742326|gb|EEY30252.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 5
           str. 513]
 gi|262552859|gb|EEZ08849.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti
           M490/95/1]
 gi|262766289|gb|EEZ12078.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 3 str. Ether]
 gi|263002123|gb|EEZ14698.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263093809|gb|EEZ17814.1| phosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|264661123|gb|EEZ31384.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M292/94/1]
 gi|326409291|gb|ADZ66356.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           M28]
 gi|326539002|gb|ADZ87217.1| single-stranded-DNA-specific exonuclease RecJ [Brucella melitensis
           M5-90]
          Length = 594

 Score =  470 bits (1209), Expect = e-130,   Method: Composition-based stats.
 Identities = 317/590 (53%), Positives = 400/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254704547|ref|ZP_05166375.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 3
           str. 686]
 gi|261755231|ref|ZP_05998940.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 3
           str. 686]
 gi|261744984|gb|EEY32910.1| single-stranded-DNA-specific exonuclease RecJ [Brucella suis bv. 3
           str. 686]
          Length = 594

 Score =  470 bits (1209), Expect = e-130,   Method: Composition-based stats.
 Identities = 317/590 (53%), Positives = 399/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPVFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254719319|ref|ZP_05181130.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. 83/13]
 gi|265984321|ref|ZP_06097056.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. 83/13]
 gi|306839094|ref|ZP_07471911.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. NF
           2653]
 gi|264662913|gb|EEZ33174.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. 83/13]
 gi|306405641|gb|EFM61903.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. NF
           2653]
          Length = 594

 Score =  470 bits (1208), Expect = e-130,   Method: Composition-based stats.
 Identities = 316/590 (53%), Positives = 400/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R L+PDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLLPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAVKGASLIVTVDCGTNSAPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLTLVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARIARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|225627737|ref|ZP_03785774.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti str.
           Cudo]
 gi|260168961|ref|ZP_05755772.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. F5/99]
 gi|261758454|ref|ZP_06002163.1| phosphoesterase [Brucella sp. F5/99]
 gi|225617742|gb|EEH14787.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ceti str.
           Cudo]
 gi|261738438|gb|EEY26434.1| phosphoesterase [Brucella sp. F5/99]
          Length = 594

 Score =  469 bits (1207), Expect = e-130,   Method: Composition-based stats.
 Identities = 316/590 (53%), Positives = 399/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +L Y+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLRYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|297717882|gb|ADI50084.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus Odyssella
           thessalonicensis L13]
          Length = 591

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 228/580 (39%), Positives = 335/580 (57%), Gaps = 9/580 (1%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           S+ G RWV    +     AL + Q H I    A +L+ R ++   A  FL P++R LMPD
Sbjct: 19  SVGGRRWVF--DEVNPREALQLAQNHQISTFAATILLKRGINFQNAASFLQPTLRELMPD 76

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L D      R+V+AI + E I +FGDYDVDGA + AL+ R+     ++  +YIP RI
Sbjct: 77  PSHLKDLSVGVDRVVKAIQSQETIAVFGDYDVDGATATALLKRYFRDIGISLRVYIPQRI 136

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGP    M++   EG   ++ VDCG+T++  L+ A   G+DVIV+DHH  ++   PA
Sbjct: 137 EEGYGPTVPAMQQLAKEGTTTLLMVDCGTTAFTPLEAAVQLGMDVIVLDHHVSQASLPPA 196

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLDLVALAT 249
            A++NPNR+D+ S   +LCAAGV F+ LV ++R LR +         DL   LDLVAL T
Sbjct: 197 TAIINPNRIDENSPLTNLCAAGVSFIFLVALHRQLRLEGWFAQRPEPDLRQYLDLVALGT 256

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGG 309
           VCDV+ L GLNRA+V +GL V  R+ N GL+ L +   +    +A +LG+++GP INAGG
Sbjct: 257 VCDVMTLTGLNRAFVAQGLKVMARRSNHGLRCLADLAGMDDTPSAYHLGFLLGPRINAGG 316

Query: 310 RIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQAS 369
           R+G +  GSRLL + D  E + LA +LD+ N+ R+ +E+ +LE+A  ++ TQ   + +  
Sbjct: 317 RVGRAEYGSRLLSTLDELEAQQLARELDLYNKERQAIETLVLEEAIHQIETQG--LHRQP 374

Query: 370 VIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV 429
           +I+V  + WHPG++G++A RLKE++ RP+  +   +   G GSGRSI G ++G  +  A 
Sbjct: 375 LILVGQEGWHPGVIGIVAGRLKERYNRPACVVG-FDADIGKGSGRSIAGVNLGAAMHAAC 433

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
             G+L  GGGH MAAG TV R  F    +F +    + +      P  +IDG+L  S   
Sbjct: 434 HHGLLTAGGGHLMAAGFTVMRDQFDNFYNFLKDNLKHQL--ETLEPTLEIDGILTPSGAT 491

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVY 549
           + L+  L+   P+G GNP P F     K+     V + H++ T E +D   L+A+AFR  
Sbjct: 492 LDLVHELKRLEPFGNGNPTPKFCIHKAKVTYAEPVGVNHIRCTLEGEDGTRLKAMAFRAL 551

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
            TPLG+ +M    K + V G L V+ W G       + D 
Sbjct: 552 ETPLGDAIMARSNKSIQVAGTLKVDTWNGRCSVTCFIDDV 591


>gi|306840265|ref|ZP_07473039.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. BO2]
 gi|306289792|gb|EFM60974.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. BO2]
          Length = 594

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 317/590 (53%), Positives = 400/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSAPSITAARQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLTLVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVLRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|75675837|ref|YP_318258.1| RecJ exonuclease [Nitrobacter winogradskyi Nb-255]
 gi|74420707|gb|ABA04906.1| exonuclease RecJ [Nitrobacter winogradskyi Nb-255]
          Length = 613

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 276/591 (46%), Positives = 365/591 (61%), Gaps = 3/591 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
             AFLGV  S +G  W   L   G  RALAI Q+H +P+++ARV+  R V ID   DFL+
Sbjct: 13  PDAFLGVSHSATGRLWRDRLDPRGAARALAIAQRHQLPEMLARVIAGRGVDIDAVTDFLD 72

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+IR LMPDP  +T  + AA+RI  A    E + IFGDYDVDGA S AL+   L HC ++
Sbjct: 73  PTIRRLMPDPFTVTQMETAAQRIADAAMRGETVAIFGDYDVDGATSAALLAWHLRHCGLD 132

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   ++     GA L++TVDCG+TS + L  A  +G+ V+VIDHH
Sbjct: 133 PLIHIPDRIFEGYGPNVDAVDALAGRGATLLVTVDCGTTSIEPLAVARQRGMSVVVIDHH 192

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV---PLNFDLL 239
           Q   +     ALVNPNR DDLSG GHL A G+VF+ LV + R LRQ           +LL
Sbjct: 193 QCGDDLPEVEALVNPNRPDDLSGLGHLAAVGLVFITLVALNRELRQRGFWSRERPEPNLL 252

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            +L  VAL TV DV PL GLNRA+V KGL+  RR+ + G  AL++   +S P  A +LG+
Sbjct: 253 DMLHHVALGTVADVAPLTGLNRAFVAKGLIALRRRDHVGHTALMDVARLSGPPEAWHLGF 312

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L
Sbjct: 313 MLGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNAERRVIEQTAEAQAEAEAL 372

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + SVIV   + WHPG+VGL+A+RLK+KF RP+F ++ E  G G GSGRSI G 
Sbjct: 373 ASLGLEDKGSVIVTASEGWHPGVVGLVASRLKDKFARPAFVVALEPGGIGTGSGRSIGGV 432

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK V  AV +G+L+KGGGHAMAAG+T+ +        + +      V          I
Sbjct: 433 DLGKAVRRAVTDGVLLKGGGHAMAAGVTLRKEQLAEFRAYMETALAADVARSRHVRKLFI 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A A     +  L  AGP+GAGNP PV A P+H+L     +  AHL++ F S D  
Sbjct: 493 DGAVSARAATPEFVATLNRAGPFGAGNPEPVVALPSHQLIHADEIGQAHLRLRFRSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +  IAFR  G PLG  L + RG+ +HV G L V+ W+G++R QLRV+D +
Sbjct: 553 IVNGIAFRAVGQPLGNALARMRGQPLHVAGSLAVDRWQGAERVQLRVVDVA 603


>gi|294852605|ref|ZP_06793278.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. NVSL
           07-0026]
 gi|294821194|gb|EFG38193.1| single-stranded-DNA-specific exonuclease RecJ [Brucella sp. NVSL
           07-0026]
          Length = 594

 Score =  467 bits (1201), Expect = e-129,   Method: Composition-based stats.
 Identities = 314/590 (53%), Positives = 397/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I  +VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISYLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++  LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLHNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+   +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNVFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|254461162|ref|ZP_05074578.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium HTCC2083]
 gi|206677751|gb|EDZ42238.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 580

 Score =  467 bits (1201), Expect = e-129,   Method: Composition-based stats.
 Identities = 243/588 (41%), Positives = 340/588 (57%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
            FL VE S++G RWV    +    +  AI Q   +P  +  VL  R V+   A  FL P+
Sbjct: 3   PFLNVERSLTGRRWVGPDLKV-ARQGEAIAQATGLPAPLCNVLAKRGVTPQDADAFLAPT 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+P+P  L D +KA  RI+ A+   +KI IF DYDVDG  S AL++ +L H   +A 
Sbjct: 62  LKDLLPNPRSLRDMEKATARILAAVKARQKIAIFADYDVDGGTSAALIIDWLRHFDQSAT 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M         LII VDCG+ S+  +  A   G DV+V+DHH  
Sbjct: 122 LYIPDRIDEGYGPNDEAMAMLAA-AHDLIICVDCGTLSHGPITAAV--GADVVVLDHHLG 178

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                PA+A+VNPNR D+     HLCAAGVVFL+LV   R LR DN      +LL++LDL
Sbjct: 179 GETLPPAHAVVNPNRADETGDLAHLCAAGVVFLMLVEAGRQLRIDN--ATGPNLLNMLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VAL TV DV PLIG+NRA V +GL V  R+   G+ AL +   + +  ++ +LG+++GP 
Sbjct: 237 VALGTVADVAPLIGVNRALVRQGLTVMARRERTGITALADVSRMDTAPSSYHLGFLLGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL + D  E + +A +LD+LN  RR +E+ +   A  +   +  D
Sbjct: 297 VNAGGRIGKADLGARLLATRDPHEAKAMAERLDMLNTERREIENNVRAAALEQAEERGFD 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
                ++   G+ WH G+VG++A+RLK+   RP+  I F+ D    GSGRSI G D+G  
Sbjct: 357 E---PLVWAAGEGWHAGVVGIVASRLKDAAHRPAIVIGFDGDAG-KGSGRSISGVDLGAA 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG++ KGGGH MAAGL++ R           +               ++DG+L 
Sbjct: 413 IQKLAHEGLIEKGGGHKMAAGLSLSRAQLEPAMARLSELMAKQGAGDAGPADLRLDGMLM 472

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  I LI+ LE AGP+GAG P P FAFP+ +L+  + V   HL+++F       + AI
Sbjct: 473 PGAAQIELIEQLEKAGPFGAGAPAPRFAFPDVELKFTKRVGETHLKISFGDGLGARIDAI 532

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            F    TPLG  L +  GKR H+ G L VN W G +  QLR+ DA+P 
Sbjct: 533 CFGAMDTPLGPALEKHGGKRFHLAGRLEVNSWGGRQNPQLRLEDAAPA 580


>gi|192291166|ref|YP_001991771.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris TIE-1]
 gi|192284915|gb|ACF01296.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris TIE-1]
          Length = 613

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 273/593 (46%), Positives = 364/593 (61%), Gaps = 3/593 (0%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L      +A A+ Q++ +P+++ARVL  R V ID  +DFL+P+
Sbjct: 15  AFLGVTRSATGKAWRDRLDARATAKAQAMVQRYQLPEMLARVLAGRGVEIDQVEDFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  LT  +  A+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRKLMPDPASLTQMEAGAKRIADAASRGEKVAIFGDYDVDGATSSALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +     +GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNIDAIRMLAGKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSL 241
             E     AL+NPNR DDLSG GHL A G+V + LV + R LR            +LL +
Sbjct: 195 GDELPDVDALINPNRPDDLSGLGHLAAVGLVLMTLVAVNRELRHRGFWTTERPEPNLLDM 254

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           L  VAL TV DV PL+GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M+
Sbjct: 255 LHHVALGTVADVAPLVGLNRAFVAKGLIAMRRRDHVGHTALMDVSRLNGPPEAWHLGFML 314

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR +E     QAEA+ +  
Sbjct: 315 GPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERREIEQKAEAQAEAEAMAS 374

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                + +VIV   + WHPG+VGL+A+RLKEKFGRPSFAI+ E  G G GSGRSI G D+
Sbjct: 375 LGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPSFAIALEPGGIGTGSGRSISGVDL 434

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           GK V  AV +G+L+KGGGHAMAAG+T+ +        + +      V          IDG
Sbjct: 435 GKAVRQAVHDGLLLKGGGHAMAAGVTLRKERLAEFRAWLETTLAGDVAKSRHVNELYIDG 494

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            ++A  V   L   L  AGP+GAGNP P+ A P H+L     V  AHL++ F++ D   +
Sbjct: 495 AVSARGVTTELAATLNRAGPFGAGNPEPIVALPAHQLIYADEVGQAHLRLRFKAGDGAIV 554

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
             IAFR  G  LG  L ++RG+ +HV G L V+ W+G++R QLRV+D +  + 
Sbjct: 555 NGIAFRSVGQKLGNALTENRGQTLHVAGSLSVDRWQGAERVQLRVIDVAVPDA 607


>gi|307946821|ref|ZP_07662156.1| single-stranded-DNA-specific exonuclease RecJ [Roseibium sp.
           TrichSKD4]
 gi|307770485|gb|EFO29711.1| single-stranded-DNA-specific exonuclease RecJ [Roseibium sp.
           TrichSKD4]
          Length = 606

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 282/592 (47%), Positives = 387/592 (65%), Gaps = 3/592 (0%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           +  +  LGV+ S +   W   L ++    A+AI+Q+  +PD++ARV+  R V  + A+ F
Sbjct: 9   IPGRLVLGVQKSFNQNAWRDRLSEDEQRHAMAISQRLGVPDVLARVMAARGVLPESAEAF 68

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L PSI+ LMPDP  L D D A  R+  AI + + I IFGDYDVDGA S A++ R+L    
Sbjct: 69  LAPSIKTLMPDPSNLVDMDSAVSRVADAIQSGKNIAIFGDYDVDGATSSAVLARYLRWTG 128

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           ++  ++IPDRI++GYGPN   +E     GA L++TVDCGSTS+DA + A + G++V+VID
Sbjct: 129 IDPVIHIPDRIIEGYGPNGPALEHLKAGGADLLVTVDCGSTSFDAFEVARSVGLNVVVID 188

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDL 238
           HHQV        ALVNPNR DDLSGQ HL A GV FL +V + R LRQ          DL
Sbjct: 189 HHQVGETLPKVAALVNPNRQDDLSGQEHLAAVGVTFLFVVGLNRELRQRGFFNGKAAPDL 248

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           L+LLDLVAL TVCDVVPL GLNRAYV++GL V  ++ NPGL  L++   +   +   +LG
Sbjct: 249 LALLDLVALGTVCDVVPLKGLNRAYVMRGLEVMHQRRNPGLAFLVDVARVVGKVAPYHLG 308

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +++GP INAGGRIG++ LG+RLL S+D      +A +LD LN  R+ ME+ MLEQA+A+ 
Sbjct: 309 FLLGPRINAGGRIGDAALGARLLTSEDHVTAREIAARLDELNTERQAMEAVMLEQADAQA 368

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
            T   + +  +V++   D WHPGIVGL+A+RLK+   RPSFAI+++E GKG GSGRSI G
Sbjct: 369 -TLAIEAKDPAVLLTGSDDWHPGIVGLIASRLKDAHRRPSFAIAYDETGKGTGSGRSIPG 427

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+GK+V  AV+EG+L KGGGHAMAAGLTV +     L ++F       V     +   K
Sbjct: 428 VDLGKVVRKAVDEGLLEKGGGHAMAAGLTVLKDKVEALTEYFDTHLRADVEQTNASRDLK 487

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           IDG L A+  N+ L++MLE AGPYGAG+  PVF FP H++    VV   H++ +  S D 
Sbjct: 488 IDGALTATGANLDLMNMLEKAGPYGAGHSEPVFVFPTHRVSFADVVGKGHVRASLASSDG 547

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             ++AI+F+    P G+ L++ RG+ +HV G L V+ W+G+ R QLR+LD +
Sbjct: 548 AKIKAISFKAEDKPHGKALLEKRGQSVHVAGSLSVDTWQGTPRVQLRILDVA 599


>gi|256061347|ref|ZP_05451491.1| single-stranded-DNA-specific exonuclease RecJ [Brucella neotomae
           5K33]
 gi|261325349|ref|ZP_05964546.1| single-stranded-DNA-specific exonuclease RecJ [Brucella neotomae
           5K33]
 gi|261301329|gb|EEY04826.1| single-stranded-DNA-specific exonuclease RecJ [Brucella neotomae
           5K33]
          Length = 594

 Score =  466 bits (1198), Expect = e-129,   Method: Composition-based stats.
 Identities = 316/590 (53%), Positives = 398/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS+  A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVQGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGP P  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QYSIYIPDRIFEGYGPYPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|209885147|ref|YP_002289004.1| single-stranded-DNA-specific exonuclease RecJ [Oligotropha
           carboxidovorans OM5]
 gi|209873343|gb|ACI93139.1| single-stranded-DNA-specific exonuclease RecJ [Oligotropha
           carboxidovorans OM5]
          Length = 613

 Score =  466 bits (1198), Expect = e-129,   Method: Composition-based stats.
 Identities = 270/602 (44%), Positives = 374/602 (62%), Gaps = 3/602 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
              AFLGV+ S +G  W   L   G  +ALAI Q+H +P+++AR++  R + ID  +DFL
Sbjct: 12  TPHAFLGVKRSATGKLWRDRLDVRGAAQALAIAQRHQLPEMLARIIAGRGIDIDAVEDFL 71

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P+IR L+PDP  +T  + AA+R+  A+   E + IFGDYDVDGA S AL+   L HC +
Sbjct: 72  DPTIRKLLPDPSTVTQMEAAAKRLADAVMRGEMVAIFGDYDVDGATSSALLAWHLRHCGL 131

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
           +  ++IPDRI +GYGPN   +    + GA+L++TVDCG+TS + L  A   G+DV+VIDH
Sbjct: 132 DPLIHIPDRIFEGYGPNVDAIRMLSSRGAKLLVTVDCGTTSLEPLAEARKLGMDVVVIDH 191

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDL 238
           HQ   E     A+VNPNR DDLSG GHL A G+VF+ LV + R LR  N         +L
Sbjct: 192 HQCNDELPTVNAIVNPNRPDDLSGLGHLAAVGLVFVTLVAVNRELRVRNFWTAERPEPNL 251

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           L +L  VAL TV DV PL+GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG
Sbjct: 252 LDMLHHVALGTVADVAPLVGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLG 311

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +M+GP INAGGRIG ++LG +LL+  D  E   +A +LD LN  RRL+E A  +QAEA+ 
Sbjct: 312 FMLGPRINAGGRIGRADLGVQLLLEGDVSEAARIAAELDRLNVERRLIEQAAEQQAEAEA 371

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           L       + +VIV   + WHPG+VGL+A+RLKEKF RP+FA++ E  G G GSGRSI G
Sbjct: 372 LAALGLEDKGAVIVTAAEGWHPGVVGLVASRLKEKFSRPAFAVALEPGGIGTGSGRSIAG 431

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+GK V  AV EG+L+KGGGHAMAAG+T+++        + +      V          
Sbjct: 432 VDLGKAVRGAVSEGLLMKGGGHAMAAGVTLKKDRLAEFRAYLEGVLAEDVARARHLDELF 491

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +DG ++A AV    +  L  AGP+G GNP P+ A P+H+L     V  AHL++  +S D 
Sbjct: 492 VDGAVSARAVTTDFVATLNRAGPFGTGNPEPMMALPSHQLVYADEVGGAHLRVRLKSGDG 551

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFA 598
             +  IAFR  G  LG  L  +RG+ +HV G L ++ W+G++R Q R+ D +  E    A
Sbjct: 552 AFVNGIAFRAVGQKLGNALTDNRGQVVHVAGSLSIDRWQGAERVQFRICDVAVPEREPVA 611

Query: 599 KK 600
            +
Sbjct: 612 IR 613


>gi|62290177|ref|YP_221970.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           1 str. 9-941]
 gi|82700099|ref|YP_414673.1| phosphoesterase [Brucella melitensis biovar Abortus 2308]
 gi|189024412|ref|YP_001935180.1| phosphoesterase, RecJ-like protein [Brucella abortus S19]
 gi|237815686|ref|ZP_04594683.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus
           str. 2308 A]
 gi|254689482|ref|ZP_05152736.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 6 str.
           870]
 gi|254697619|ref|ZP_05159447.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730510|ref|ZP_05189088.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 4 str.
           292]
 gi|256257730|ref|ZP_05463266.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 9 str.
           C68]
 gi|260546721|ref|ZP_05822460.1| phosphoesterase [Brucella abortus NCTC 8038]
 gi|260755005|ref|ZP_05867353.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           6 str. 870]
 gi|260758221|ref|ZP_05870569.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           4 str. 292]
 gi|260762048|ref|ZP_05874391.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260884016|ref|ZP_05895630.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           9 str. C68]
 gi|297248569|ref|ZP_06932287.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           5 str. B3196]
 gi|62196309|gb|AAX74609.1| RecJ, single-stranded-DNA-specific exonuclease RecJ [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616200|emb|CAJ11246.1| Phosphoesterase, RecJ-like:Phosphoesterase, DHHA1:Bacterial RecJ
           exonuclease [Brucella melitensis biovar Abortus 2308]
 gi|189019984|gb|ACD72706.1| Phosphoesterase, RecJ-like protein [Brucella abortus S19]
 gi|237788984|gb|EEP63195.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus
           str. 2308 A]
 gi|260095771|gb|EEW79648.1| phosphoesterase [Brucella abortus NCTC 8038]
 gi|260668539|gb|EEX55479.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           4 str. 292]
 gi|260672480|gb|EEX59301.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260675113|gb|EEX61934.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           6 str. 870]
 gi|260873544|gb|EEX80613.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           9 str. C68]
 gi|297175738|gb|EFH35085.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           5 str. B3196]
          Length = 594

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 316/590 (53%), Positives = 399/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W  S   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNASVSPQIQILDAA 591


>gi|316934340|ref|YP_004109322.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris DX-1]
 gi|315602054|gb|ADU44589.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris DX-1]
          Length = 613

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 273/593 (46%), Positives = 365/593 (61%), Gaps = 3/593 (0%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L      +A A+ Q++ +P+++ARVL  R V ID  +DFL+P+
Sbjct: 15  AFLGVTRSATGKAWRDRLDARATAKAQAMVQRYQLPEMLARVLAGRGVEIDQVEDFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  LT  +  A+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRKLMPDPASLTQMEAGAKRIADAASRGEKVAIFGDYDVDGATSSALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +     +GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNIDAIRMLAGKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV---PLNFDLLSL 241
             E     AL+NPNR DDLSG GHL A G+V + LV + R LR            +LL +
Sbjct: 195 GDELPEVEALINPNRPDDLSGLGHLAAVGLVLMTLVAVNRELRHRGFWSTERPEPNLLDM 254

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M+
Sbjct: 255 LHHVALGTVADVAPLIGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGFML 314

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR +E     QAEA+ L  
Sbjct: 315 GPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERREIEQKAEAQAEAEALAS 374

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                + +VIV   + WHPG+VGL+A+RLKEKFGRPSFAI+ E  G G GSGRSI G D+
Sbjct: 375 LGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPSFAIALEPGGIGTGSGRSISGVDL 434

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           GK V  AV +G+L+KGGGHAMAAG+T+ +        + +    + V          +DG
Sbjct: 435 GKAVRQAVHDGLLLKGGGHAMAAGVTLRKERLAEFRAWLETTLASDVAKSRHVNELYVDG 494

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            ++A  V   L   L  AGP+GAGNP P+ A P H+L     V  +HL++ F++ D   +
Sbjct: 495 AVSARGVTPELAATLNRAGPFGAGNPEPIVALPAHQLVYADEVGQSHLRLRFKAGDGAIV 554

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
             IAFR  G  LG  L ++RG+ +HV G L V+ W+G++R QLRV+D +  + 
Sbjct: 555 NGIAFRSVGQKLGNALAENRGQTLHVAGCLSVDRWQGAERVQLRVIDVAVPDA 607


>gi|254706557|ref|ZP_05168385.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M163/99/10]
 gi|261314016|ref|ZP_05953213.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M163/99/10]
 gi|261303042|gb|EEY06539.1| single-stranded-DNA-specific exonuclease RecJ [Brucella
           pinnipedialis M163/99/10]
          Length = 594

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 316/590 (53%), Positives = 399/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R  S++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGGSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 591


>gi|39935574|ref|NP_947850.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris CGA009]
 gi|39649427|emb|CAE27949.1| putative single-strand DNA-specific exonuclease [Rhodopseudomonas
           palustris CGA009]
          Length = 645

 Score =  465 bits (1197), Expect = e-129,   Method: Composition-based stats.
 Identities = 273/593 (46%), Positives = 363/593 (61%), Gaps = 3/593 (0%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L      +A A+ Q++ +P+++ARVL  R V ID  +DFL P+
Sbjct: 47  AFLGVTRSATGKAWRDRLDARATAKAQAMVQRYQLPEMLARVLAGRGVEIDQVEDFLEPT 106

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR LMPDP  LT  +  A+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++  
Sbjct: 107 IRKLMPDPASLTQMEAGAKRIADAASRGEKVAIFGDYDVDGATSSALLAWHLRHCGLDPL 166

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +     +GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 167 IHIPDRIFEGYGPNIDAIRMLAGKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQC 226

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSL 241
             E     AL+NPNR DDLSG GHL A G+V + LV + R LR            +LL +
Sbjct: 227 GDELPDVDALINPNRPDDLSGLGHLAAVGLVLMTLVAVNRELRHRGFWTTERPEPNLLDM 286

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           L  VAL TV DV PL+GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+M+
Sbjct: 287 LHHVALGTVADVAPLVGLNRAFVAKGLIAMRRRDHVGHTALMDVSRLNGPPEAWHLGFML 346

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR +E     QAEA+ +  
Sbjct: 347 GPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERREIEQKAEAQAEAEAMAS 406

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                + +VIV   + WHPG+VGL+A+RLKEKFGRPSFAI+ E  G G GSGRSI G D+
Sbjct: 407 LGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPSFAIALEPGGIGTGSGRSISGVDL 466

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           GK V  AV +G+L+KGGGHAMAAG+T+ +        + +      V          IDG
Sbjct: 467 GKAVRQAVHDGLLLKGGGHAMAAGVTLRKERLAEFRAWLETTLAGDVAKSRHVNELYIDG 526

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            ++A  V   L   L  AGP+GAGNP P+ A P H+L     V  AHL++ F++ D   +
Sbjct: 527 AVSARGVTTDLAATLNRAGPFGAGNPEPIVALPAHQLIYADEVGQAHLRLRFKAGDGAIV 586

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
             IAFR  G  LG  L ++RG+ +HV G L V+ W+G++R QLRV+D +  + 
Sbjct: 587 NGIAFRSVGQKLGNALTENRGQTLHVAGSLSVDRWQGAERVQLRVIDVAVPDA 639


>gi|300023047|ref|YP_003755658.1| single-stranded-DNA-specific exonuclease RecJ [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524868|gb|ADJ23337.1| single-stranded-DNA-specific exonuclease RecJ [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 616

 Score =  465 bits (1196), Expect = e-128,   Method: Composition-based stats.
 Identities = 286/592 (48%), Positives = 374/592 (63%), Gaps = 6/592 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S  GF+W   L  E  + A AI Q H +P+++ R+L  RNV +D    FL+P+
Sbjct: 19  AFLGVRSSARGFQWRERLRPELKSLATAIGQHHGLPEMIGRILAARNVGLDAVPGFLDPT 78

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ LMPDP +L D DKAA R+  AI   +++ IFGDYDVDGA S AL+ RFLSH  V + 
Sbjct: 79  LKSLMPDPSVLRDMDKAAARLADAIEGKQRVAIFGDYDVDGACSSALLHRFLSHHDVPSR 138

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDR+ +GYGPN   +E  +NEGA+LI+TVDCG+TS++ L  A   G DV+V+DHHQ 
Sbjct: 139 IYIPDRLFEGYGPNVGAIETLVNEGAKLIVTVDCGTTSFEPLAAARKLGADVVVVDHHQA 198

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFDLLSLL 242
                   A+VNPNR DD+SGQG LCAAGVVFLVLV + R LR+          DLL+ L
Sbjct: 199 DERLPDVEAVVNPNRQDDISGQGMLCAAGVVFLVLVAVMRELRRRGFYTSVREPDLLASL 258

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DVVPL+ LNRAYV KGL V R + N GL AL +   +++P T  +LG+++G
Sbjct: 259 DLVALATVADVVPLVALNRAYVKKGLAVMRARENVGLTALADVAGLTTPPTPYHLGFILG 318

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG + LG+ LL + D+ E + +A  L+ LN+ RR +E+ MLE+A A    Q 
Sbjct: 319 PRINAGGRIGNAALGATLLSTSDTVEAQKIAELLNRLNKERRDVEAIMLEEALAIADQQV 378

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE----DGKGIGSGRSIEG 418
            D    ++++V  + WH GIVGL+A+RL E+F RP+  I++E       +G GS RSI G
Sbjct: 379 ADDPARAMVIVASETWHKGIVGLVASRLVERFRRPACVIAWEAEASRPNEGTGSLRSIPG 438

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+G  V  AV  G+LVKGGGHAMAAGLTV R N   L   FQ                 
Sbjct: 439 VDLGAAVRAAVSAGLLVKGGGHAMAAGLTVGRNNLAALEAHFQTQLRTATVTANEAAGLD 498

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           ID  L AS     L+DM+E   P+G GNP+P F FP H+++  +VV  AH ++  E  D 
Sbjct: 499 IDAALVASGATTELMDMIERVSPFGQGNPDPRFVFPAHRVKFAKVVGDAHARVLIEGGDG 558

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             L AIAFR  G PLG+ LM   G  +HV GHL  + W G  R +L++ DA+
Sbjct: 559 ARLDAIAFRAAGQPLGDLLMSGGGMPLHVAGHLRRDTWGGRDRVELQIEDAA 610


>gi|330814098|ref|YP_004358337.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487193|gb|AEA81598.1| single-stranded-DNA-specific exonuclease RecJ [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 584

 Score =  464 bits (1195), Expect = e-128,   Method: Composition-based stats.
 Identities = 225/589 (38%), Positives = 348/589 (59%), Gaps = 11/589 (1%)

Query: 9   VECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLL 68
           ++ S+S   W+     E   +    TQ+  + +++ R+L  RNV  D + DFLNP I+  
Sbjct: 2   IKNSVSDRNWILSKFDEN--KVKKATQELGVSEVLCRLLAIRNVEADQSLDFLNPKIKNS 59

Query: 69  MPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP 128
           MP+P +L   D+A + I++ I     I I+GDYDVDGA+S +++ RFL + + N  ++IP
Sbjct: 60  MPNPFLLKSMDEAVKLIIKHIKEESHICIYGDYDVDGASSTSILARFLRNFTNNFFIFIP 119

Query: 129 DRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE 188
           DRI DGYGPN  + E   ++G +LIITVDCG+TS++ ++YA ++ IDV+VIDHHQ     
Sbjct: 120 DRIQDGYGPNLKIFEDIASKGVKLIITVDCGTTSFEPIEYAKSKNIDVVVIDHHQSTETL 179

Query: 189 IPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP----LNFDLLSLLDL 244
             A A+VNPNR D+ S   +LCAAGV FLVL  I   LR+++          +LL+ LDL
Sbjct: 180 PIANAIVNPNRFDETSNLTYLCAAGVAFLVLSGIVTRLREEDFFKKKNIQEPNLLNYLDL 239

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VAL TVCDVVPL GLNRA+V +GL V +++ N G+K L +  NI+S I+  +LGY+IGP 
Sbjct: 240 VALGTVCDVVPLQGLNRAFVFQGLKVLQKRNNLGIKTLSDVANINSKISTYHLGYIIGPK 299

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG+++ G+ LL+++D +    ++ +L+ LN+ R+ +E  +LE+A      +   
Sbjct: 300 INAGGRIGKADHGANLLLTEDPEIAFKISKELNQLNEKRKNIEGIILEEAINIAKHK--- 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
                V+VV  + WH GI+G++A+RLK+ F +P+F I+  E   G GS RS+ GFDIG  
Sbjct: 357 -DNNPVLVVSSNTWHEGIIGIIASRLKDHFNKPTFVIN-FEGDYGKGSARSLPGFDIGSA 414

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           V  A +  I+ KGGGH MAAG ++ +        F     +             ID VL 
Sbjct: 415 VVKAKQSEIITKGGGHKMAAGFSINQDKADEFEIFLIDLFNKSGCQSSKEKDLYIDSVLA 474

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
           +SAVN    + ++   P+G+ N  P F   N  +    ++  +H++   ++ ++  +  I
Sbjct: 475 SSAVNEKFFNEIDKLAPFGSANREPRFVIENVSITKSLILKESHIKAFCKTSNNSKINLI 534

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           +F    TP+G +L+ ++ K+  + G L +N W G +  Q  + D +   
Sbjct: 535 SFNSVNTPIGSYLLNAKNKKYDIAGRLSLNEWNGKREVQFLLDDLAIST 583


>gi|254466495|ref|ZP_05079906.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium Y4I]
 gi|206687403|gb|EDZ47885.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium Y4I]
          Length = 580

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 242/588 (41%), Positives = 344/588 (58%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S+SG RWV   G E    +  + Q+  +P  V +VL  R V    AK FL P 
Sbjct: 3   SFLGVEQSLSGRRWVG-PGVEVDRASEMMAQQTGLPRSVCQVLARRGVPAMEAKGFLEPK 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   ++I +F DYDVDG +S AL++ +L    + A 
Sbjct: 62  LKELLPDPREMKDMEAAAARFLQAVQRKQRIAVFADYDVDGGSSAALLLVWLRQMGLEAT 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M++       LII VDCG+ S++ +  A  +G DVIV+DHH  
Sbjct: 122 LYIPDRIDEGYGPNVPAMQELAA-AHDLIICVDCGTLSHEPI--AAAKGADVIVLDHHLG 178

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAAGVVFL+LV   R +R+        DL++LLDL
Sbjct: 179 GETLPDCVAVVNPNRQDESGDLGYFCAAGVVFLMLVEAGRQMREAG--AKGPDLMALLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG NRA V +GL V   +  PGL AL +   + S  +  +LG+++GP 
Sbjct: 237 VALATVADVAPLIGANRALVRQGLKVMAARKRPGLVALSDVSRMDSAPSTYHLGFLLGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL +D+  E   LA +LD LN  RR +E+A+   A  +   +  +
Sbjct: 297 VNAGGRIGKADLGARLLSTDNPHEAAALAERLDQLNTERRDIENAVRAAALDQAEARGLE 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE  GRP+  I F+ + +G GSGRS+ G D+G  
Sbjct: 357 ---APLVWAAGEGWHPGVVGIVASRLKEAAGRPAVVIGFDGE-EGKGSGRSVSGVDLGAS 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+LVKGGGH MAAGLTV R       +   +               K+DG L 
Sbjct: 413 IQRLAAEGLLVKGGGHKMAAGLTVMRDKLEPAMERLSELLAKQGAGQGGPADLKLDGALM 472

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + LI  +E AGP+GAG P P +A P+ +++  + V  +HL+++        + AI
Sbjct: 473 PGAATVELIGQIEQAGPFGAGAPAPRYALPDLQVRFAKKVGESHLKLSLSDGMGGGVDAI 532

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            F  + T LG  L++  G R H  G L +N W G +  QLR+ DA+  
Sbjct: 533 CFGAFDTALGPRLLEHGGARFHFAGRLEINTWGGRQSPQLRLEDAAEA 580


>gi|90424310|ref|YP_532680.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris BisB18]
 gi|90106324|gb|ABD88361.1| exonuclease RecJ [Rhodopseudomonas palustris BisB18]
          Length = 613

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 278/590 (47%), Positives = 371/590 (62%), Gaps = 3/590 (0%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGV  S +G  W   L   G  RALAI Q++ +P+++ARVL  RNV ID  +DFL+P+
Sbjct: 15  AFLGVARSATGRVWRDRLDPRGAARALAIAQRYQLPEMLARVLAGRNVEIDAVEDFLDPT 74

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR L+PDP  +T  + AA+R+  A+  +E + IFGDYDVDGA S AL+   L HC ++  
Sbjct: 75  IRRLLPDPYSVTQMEAAAKRLADAVLGAETVAIFGDYDVDGATSAALLAWHLRHCGLDPL 134

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           ++IPDRI +GYGPN   +    + GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ 
Sbjct: 135 IHIPDRIFEGYGPNVDAVRMLASRGATLLITVDCGTTSLEPLAEAKRLGMSVVVIDHHQC 194

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSL 241
             E     ALVNPNR DDLSG GHL A G+VF+ LV + R LR            +LL++
Sbjct: 195 GDELPVVDALVNPNRPDDLSGLGHLAAVGLVFVTLVALNRELRARGFWTLERPQPELLNM 254

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           L  VAL TV DV PL GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+++
Sbjct: 255 LHHVALGTVADVAPLTGLNRAFVAKGLIAMRRRDHVGHTALMDIARLNGPPDAFHLGFLL 314

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L  
Sbjct: 315 GPRINAGGRIGRADLGVRLLLESDISEAAKIAAELDRLNAERRVIEQMAEAQAEAEALAA 374

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                + SVIV   + WHPG+VGL+A+RLKEKF RP+FAI+ E  G G GSGRSI G D+
Sbjct: 375 LGFEDKGSVIVTASEGWHPGVVGLVASRLKEKFSRPAFAIALEPGGIGTGSGRSIPGVDL 434

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           GK V  AV +G+L+KGGGHAMAAG+T+ +        + +      V          IDG
Sbjct: 435 GKAVRQAVSDGLLLKGGGHAMAAGVTLRKEKLAEFRAYIEAALAADVARSRHANELFIDG 494

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            ++A AV   L+  L  AGP+G+GNP PV A P+H+L     V  AHL++ F+S D   +
Sbjct: 495 AVSARAVTPDLVATLNRAGPFGSGNPEPVLALPSHQLVYADEVGQAHLRLRFKSGDGAIV 554

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
             IAFR  G  LG  L ++RG+ +HV G L V+ W+G++R QLRV D + 
Sbjct: 555 NGIAFRSVGQKLGNALQENRGQPLHVAGCLTVDRWQGNERVQLRVTDVAV 604


>gi|150396665|ref|YP_001327132.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           medicae WSM419]
 gi|150028180|gb|ABR60297.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           medicae WSM419]
          Length = 600

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 333/590 (56%), Positives = 435/590 (73%), Gaps = 1/590 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S+SG RWVS L Q G NRALAI+Q H   +++ARVL  R V +D A  FL+P
Sbjct: 10  RAFLGVERSVSGQRWVSRLDQAGQNRALAISQVHGYSELIARVLAGRGVGLDDAGAFLDP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP ILTDC KAA R+  AI   EKI++FGDYDVDGAAS ALM+RFL H  +  
Sbjct: 70  TLRALMPDPDILTDCRKAAERLADAIRRREKIVVFGDYDVDGAASAALMVRFLRHFDLTT 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP  +E+ I+ GA+LI+TVDCGSTS+++   A  +G DV+V+DHHQ
Sbjct: 130 EIYIPDRIFEGYGPNPQAIEQLIDRGAELIVTVDCGSTSHESFAVAAERGTDVVVVDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLL 242
           V S   P +ALVNPNR DDLSGQGHLCAAGVV+LVLV   R+LR        +FDLLSLL
Sbjct: 190 VGSTLPPCHALVNPNREDDLSGQGHLCAAGVVYLVLVNTLRVLRLKGDSRVASFDLLSLL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLV+LATVCDVVPL GLNRAYVVKGL+ AR  GN GL AL+ +  I  P+T  +LG+++G
Sbjct: 250 DLVSLATVCDVVPLKGLNRAYVVKGLIAARHMGNAGLAALLRKAAIGGPVTPYHLGFLLG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD+ E E++A +LD LN++R+ ME+AML +AEA+VL + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDDAAEAEIIAGQLDELNRDRQAMEAAMLAEAEAEVLAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
              + ASVI+   + WHPGIVGL+AAR+KEKF RP+FAI+F+ +G+G GSGRSI GFD+G
Sbjct: 370 GTGEGASVIITARENWHPGIVGLIAARIKEKFRRPAFAIAFDPNGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           ++V  AV+ G+L+KGGGHAMAAGLTVER   G+L  FF++ A   V  L+     K+DG 
Sbjct: 430 RLVRAAVDSGLLIKGGGHAMAAGLTVERGKLGQLRQFFEERAETAVRDLVAVQTLKVDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + A+   + L+D+L+ AGPYG+G+P P+FAFP H+L+  R V   H+++T E QD   ++
Sbjct: 490 MAAAGATLDLVDLLDQAGPYGSGHPQPLFAFPQHRLRDSRQVGANHVKVTLEGQDGRRIE 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            IAFR   TPLG FL+ +RG  +H  G +  + W+G+++ QLR+ DA+  
Sbjct: 550 GIAFRATETPLGAFLLGNRGATVHAAGSVSADLWQGTRKVQLRLTDAAKA 599


>gi|254693969|ref|ZP_05155797.1| Phosphoesterase, RecJ-like protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214260|ref|ZP_05928541.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           3 str. Tulya]
 gi|260915867|gb|EEX82728.1| single-stranded-DNA-specific exonuclease RecJ [Brucella abortus bv.
           3 str. Tulya]
          Length = 594

 Score =  462 bits (1189), Expect = e-128,   Method: Composition-based stats.
 Identities = 315/590 (53%), Positives = 398/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLGV+ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGVKQSATGQKWVDRLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  L D D AA RI  AI   E + IF DYDVDGA S ALM RFL H  V
Sbjct: 63  DPTLRNLMPDPATLNDMDNAAGRIADAIQRRETVAIFSDYDVDGACSSALMARFLKHYGV 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+
Sbjct: 242 MLDLVALATVCDVVPLKGVNRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  AVE+G+LVKGGGHAMAAG+T+ER N G L  + ++ A +IV  L       ID
Sbjct: 422 LGKLVRGAVEKGLLVKGGGHAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   +AL + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVALYEALQKAGPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G  +HV G+L +N+W  S   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGCSVHVAGNLSLNHWNASVSPQIQILDAA 591


>gi|153009250|ref|YP_001370465.1| single-stranded-DNA-specific exonuclease RecJ [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561138|gb|ABS14636.1| single-stranded-DNA-specific exonuclease RecJ [Ochrobactrum
           anthropi ATCC 49188]
          Length = 594

 Score =  462 bits (1188), Expect = e-128,   Method: Composition-based stats.
 Identities = 311/590 (52%), Positives = 401/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLG++ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGIKQSATGQKWVDRLGLREANTALAIAQHHGISDLVARVLAGRGVSVENAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  LTD + AA RI  AI   E + IFGDYDVDGA S ALM RFL H  +
Sbjct: 63  DPTLRNLMPDPATLTDMENAASRIADAILRRETVAIFGDYDVDGACSSALMARFLKHYGI 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M   + +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRDLVAKGATLIVTVDCGTNSASSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR+  K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISQQGHLCAAGVVFLTLVQVTKILRERGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+   +LGY+
Sbjct: 242 LLDLVALATVCDVVPLTGVNRAFVVKGLVVARSQSNVGLAALARVARIGEPLNVFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DDS   + +A++LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDSATADRIAVELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSIMGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  A+E G+LVKGGGHAMAAG+T+ER N G L  + ++ + +IV  L       ID
Sbjct: 422 LGKLVRGAMERGLLVKGGGHAMAAGITIERANLGALRAYLEEESAHIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   ++L + L+ AGPYG+ +P P+ A P+H L  +R V   H+++     D + 
Sbjct: 482 GALAASGATVSLYEALQKAGPYGSAHPQPILALPHHILADVRGVGRDHVRVALRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G+ +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGQSVHVAGNLSLNHWNGSVTPQIQILDAA 591


>gi|84515364|ref|ZP_01002726.1| probable single-stranded DNA-specific exonuclease [Loktanella
           vestfoldensis SKA53]
 gi|84510647|gb|EAQ07102.1| probable single-stranded DNA-specific exonuclease [Loktanella
           vestfoldensis SKA53]
          Length = 586

 Score =  462 bits (1188), Expect = e-127,   Method: Composition-based stats.
 Identities = 255/590 (43%), Positives = 349/590 (59%), Gaps = 10/590 (1%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           D AFLGV  S++G RWV    QE    A A+ Q   +P  + R L  R V    A  FL 
Sbjct: 6   DHAFLGVAASLTGRRWVGPNAQED-RAAEAMVQATNLPPALCRTLARRGVPSQEAALFLA 64

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R L+PDP  L D +KAA R +QA+   E+I +F DYDVDG AS AL++ +L    + 
Sbjct: 65  PTLRDLLPDPRSLRDMEKAATRFLQAVAGRERIAVFADYDVDGGASAALLIVWLRQRGLR 124

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPN   M +       LII VDCG+ S+  +  A     DVIV+DHH
Sbjct: 125 ATLYIPDRIDEGYGPNEPAMAELAA-AHDLIICVDCGTLSHGPIAAAVRA--DVIVLDHH 181

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLL 242
                   AYA+VNPNR D+     HLCAAGVVFL+LV   R LR         DL+++L
Sbjct: 182 LGGETLPAAYAVVNPNRQDESGDLAHLCAAGVVFLMLVEANRQLRDAG--KAGPDLMAML 239

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATV DV PL+G+NRA+V +GL+V  R+   GL AL +   + +  TA +LG+++G
Sbjct: 240 DLVALATVADVAPLVGVNRAFVRQGLVVMARRARVGLTALADVSGLDAAPTAYHLGFLLG 299

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P +NAGGRIG+++LG+RLL SDD  E   LA  LD LN +RR +E A+ + A A+ L + 
Sbjct: 300 PRVNAGGRIGKADLGARLLASDDPAEARDLADMLDQLNTDRRAVEQAVRDVAIAQALARG 359

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
            D     ++   G+ WHPG+VG++AARLKE   RP+  I   EDG G GSGRS+ G D+G
Sbjct: 360 TDG---PLVWAAGEGWHPGVVGIVAARLKEATNRPAVVIGL-EDGIGKGSGRSVSGIDLG 415

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
             +     EG+L+KGGGH MAAGL+V +           +       + +     ++DG+
Sbjct: 416 AAIQRLASEGLLLKGGGHKMAAGLSVAQDRLEPAMARLAELLDKQGASALGPADLRLDGI 475

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L   A  + L+ +L+ AGP+GAG P P FAFP+ ++   + V   HL+++F       + 
Sbjct: 476 LMPGAATVDLVTLLDDAGPFGAGAPAPRFAFPDCQILFAKQVGETHLKISFGDGLGARID 535

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AI F     PLG  L+Q  G R H+ G + VN W+G +  QLR+ DA+P 
Sbjct: 536 AICFGAMDGPLGPALLQHNGTRFHLAGRIEVNVWQGRQSVQLRLEDAAPA 585


>gi|85717365|ref|ZP_01048317.1| RecJ exonuclease [Nitrobacter sp. Nb-311A]
 gi|85695840|gb|EAQ33746.1| RecJ exonuclease [Nitrobacter sp. Nb-311A]
          Length = 613

 Score =  461 bits (1187), Expect = e-127,   Method: Composition-based stats.
 Identities = 276/592 (46%), Positives = 368/592 (62%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
             AFLGV  S +G  W   L Q G  RALAI Q+H +P+++ARV+  R V ID   DFL+
Sbjct: 13  PDAFLGVSHSATGRLWRDRLDQRGAARALAIAQRHQLPEMLARVIAGRGVEIDAIADFLD 72

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+IR LMPDP  +T  + AA+R+  A    E + IFGDYDVDGA S AL+   L HC ++
Sbjct: 73  PTIRRLMPDPSTVTQMETAAKRLADAAMRGETVAIFGDYDVDGATSAALLAWHLRHCGLD 132

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   ++   + GA L++TVDCG+TS + L  A  +G+ V+VIDHH
Sbjct: 133 PLIHIPDRIFEGYGPNVDAIDALADRGATLLVTVDCGTTSIEPLSVARQRGMSVVVIDHH 192

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV---PLNFDLL 239
           Q   +     ALVNPNR DDLSG GHL A G+V + LV + R LR+           +LL
Sbjct: 193 QCGDDLPEVEALVNPNRPDDLSGLGHLAAVGLVLVTLVALNRELRKRGFWSSERPEPNLL 252

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            +L  VAL TV DV PL GLNRA+V KGL+  RR+ + G  AL++   +S P  A +LG+
Sbjct: 253 DMLHHVALGTVADVAPLTGLNRAFVAKGLIALRRRDHVGHTALMDVARLSGPPEAWHLGF 312

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E A   QAEA+ L
Sbjct: 313 MLGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNAERRVIEQAAEAQAEAEAL 372

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + SVIV   + WHPG+VGL+A+RLK+KF RP+F ++ E  G G GSGRSI G 
Sbjct: 373 ASLGLEDKGSVIVTASEGWHPGVVGLVASRLKDKFSRPAFVVALEPGGIGTGSGRSIGGV 432

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK V  AV +G+L+KGGGHAMAAG+T+ +        + +      V          I
Sbjct: 433 DLGKAVRRAVTDGVLLKGGGHAMAAGVTLRKEQLAEFRAYMENTLAADVARSRHVRELFI 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A       + ML  AGP+GAGNP P+ A P+H+L     V  AHL++ F+S D  
Sbjct: 493 DGAVSARTATPEFVTMLNRAGPFGAGNPEPMVALPSHQLIHADEVGQAHLRLRFKSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            +  IAFR  G PLG  L Q RG+ +HV G L V+ W+G++R QLRV+D + 
Sbjct: 553 IVNGIAFRAVGQPLGNALAQMRGQPLHVAGSLAVDRWQGAERVQLRVVDVAV 604


>gi|86750079|ref|YP_486575.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris HaA2]
 gi|86573107|gb|ABD07664.1| exonuclease RecJ [Rhodopseudomonas palustris HaA2]
          Length = 613

 Score =  461 bits (1187), Expect = e-127,   Method: Composition-based stats.
 Identities = 270/591 (45%), Positives = 361/591 (61%), Gaps = 3/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            AFLGV  S +G  W   L   G  +A AI Q++ +P+++ARV+  R + ID   DFL+P
Sbjct: 14  SAFLGVTRSATGKLWRDRLDARGTAKAQAIAQRYQLPEMLARVIAGRGIEIDAVADFLDP 73

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  +T  +  A RI  A    EK+ IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 74  TIRKLMPDPSTVTQMEAGASRIADAATKREKVAIFGDYDVDGATSAALLAWHLRHCGLDP 133

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +    ++GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ
Sbjct: 134 LIHIPDRIFEGYGPNVDAIRMLADKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQ 193

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLS 240
              E     AL+NPNR DDLSG GHL A G+V + LV + R LR            +LL 
Sbjct: 194 TADELPEVDALINPNRPDDLSGLGHLAAVGLVMMTLVAVNRELRHRGFWTLERPEPNLLD 253

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P    +LG+M
Sbjct: 254 MLHHVALGTVADVAPLIGLNRAFVAKGLIALRRRDHVGHTALMDVARLNGPPEVWHLGFM 313

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ + 
Sbjct: 314 LGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNTERRVIEQHAEAQAEAEAIA 373

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKFGRP+FAI+ E  G G GSGRSI G D
Sbjct: 374 ALGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPAFAIALEPGGIGTGSGRSIGGVD 433

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G+ V  AV EGIL+KGGGHAMAAG+T+ +        + +      V          ID
Sbjct: 434 LGRAVRNAVTEGILMKGGGHAMAAGVTLRKERLAEFRGWLETALAADVAKSRHVNELSID 493

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G ++A  +       L  AGP+GAGNP PV A P H+L     V  AHL++ F+S D   
Sbjct: 494 GAVSARGITPEFAATLNRAGPFGAGNPEPVIALPAHQLVYADEVGQAHLRLRFKSGDGAI 553

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           +  IAFR  G  LG+ L ++RG  +HV G L ++ W+G++R Q RV+D + 
Sbjct: 554 VNGIAFRSVGQKLGQALAENRGHPLHVAGSLAIDRWQGAERVQFRVIDVAV 604


>gi|209964606|ref|YP_002297521.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Rhodospirillum centenum SW]
 gi|209958072|gb|ACI98708.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Rhodospirillum centenum SW]
          Length = 601

 Score =  461 bits (1187), Expect = e-127,   Method: Composition-based stats.
 Identities = 249/595 (41%), Positives = 348/595 (58%), Gaps = 10/595 (1%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           + AFLGV  S++G RW +    E    AL   Q   +P+IV R+L  R V++D   DFL 
Sbjct: 8   ESAFLGVHSSVTGRRWRARPVDE--RLALTFAQSRGLPEIVGRLLAARGVTLDAVDDFLA 65

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           PS+R  +PDP +L D D AA RI  A+   E I +FGDYDVDGA S AL+ RFL    V 
Sbjct: 66  PSLRTQLPDPSVLRDMDAAAGRIAHAVRTGEGIAVFGDYDVDGATSSALLARFLRALGVE 125

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   + +  ++G +L++TVDCG+T++D L  A   G+DV+V+DHH
Sbjct: 126 PRIHIPDRIAEGYGPNLPALLRLRDQGVRLVVTVDCGTTAFDVLDGAAEAGLDVVVVDHH 185

Query: 183 QVKSEEIPAYALVNPNRLDDLS--GQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDL 238
           + +       ALVNPNRLD+      G L A GV FL++V + R LR+D          L
Sbjct: 186 KAEPRLPRTVALVNPNRLDEPPGGPLGTLAAVGVTFLLVVAVNRALRRDGFYSGRAEPAL 245

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           L  LDLVAL TVCDVVPL GLNR +V +GL VA R+ NPG++AL +   ++      + G
Sbjct: 246 LDWLDLVALGTVCDVVPLTGLNRVFVAQGLKVAGRRANPGIRALADVAGVTDRFDTYHAG 305

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +++GP +NAGGR+G S+LGSR+L +DD  E   LA +L  LN  RR +E+ +LE+A A V
Sbjct: 306 FIVGPRVNAGGRVGRSDLGSRILSTDDPAEALELARQLHDLNAERRELEAVVLEEALALV 365

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
             +        +++  G+ WHPG++G++A+RLKE+F RP+  ++  E G G  SGRS+ G
Sbjct: 366 --EGVAGDSPELVLAAGEGWHPGVIGIVASRLKERFNRPACVVA-LEGGLGKASGRSVRG 422

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL-ITTPVF 477
            D+G  V  A + G+L+ GGGHAMAAG TVE      L  F ++     +       P  
Sbjct: 423 VDLGAAVIAARQAGLLLAGGGHAMAAGFTVEAARLDDLRAFLRERIGAQLAEAGPLVPTL 482

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            +DG +        L+  LE   PYG GNP P FA  + ++    VV   H++      D
Sbjct: 483 SLDGAIAVRGAGTDLLQHLERLAPYGTGNPEPRFAVTDARIVRADVVGANHVRCILTGPD 542

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
              L+ IAFR     LGE L++S G  +H+ G L  + W G +  QL + DA+P 
Sbjct: 543 GARLKGIAFRALDGALGEALLRSGGMPLHLAGTLRADRWNGQEGVQLFIDDAAPA 597


>gi|99082006|ref|YP_614160.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria sp. TM1040]
 gi|99038286|gb|ABF64898.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria sp. TM1040]
          Length = 603

 Score =  460 bits (1183), Expect = e-127,   Method: Composition-based stats.
 Identities = 242/588 (41%), Positives = 347/588 (59%), Gaps = 9/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RWV   G +    +  + Q+  +P  V +VL  R V    A  FL P 
Sbjct: 25  SFLGVETSLTGRRWVG-PGVDQARASEHLAQETGLPPAVCQVLARRGVPAHEATGFLTPQ 83

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   E+I IF DYDVDG +S AL++ +L      A 
Sbjct: 84  LKDLLPDPRRMKDMETAAARFLQAVERRERIAIFADYDVDGGSSAALLLVYLRQMGQQAT 143

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN + M     +   LII VDCG+ S+  +  A  +G DV+V+DHH  
Sbjct: 144 LYIPDRIDEGYGPNDAAMAALARDH-DLIICVDCGTLSHGPI--AAAKGADVVVLDHHLG 200

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAAGVVFL+LV + R  R    +    DL+++LDL
Sbjct: 201 GETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVEVRRQARDKG-LGAGPDLMAMLDL 259

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG NRA V +GL V  R+  PGL AL +   + +  +  +LG+++GP 
Sbjct: 260 VALATVADVAPLIGANRALVRQGLKVMGRRQRPGLVALADVSRMDAAPSTYHLGFLLGPR 319

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL +DD  E   L+ +LD LN  RR +E+A+   A  +   +  D
Sbjct: 320 VNAGGRIGKADLGARLLSTDDPHEAAALSERLDQLNTERRDIENAVRAAALEQAEARGFD 379

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE  GRP+  I  + + +G GSGRS+ G D+G  
Sbjct: 380 ---APLVWAAGEGWHPGVVGIVASRLKEATGRPAVVIGLDGE-EGKGSGRSVSGIDLGAS 435

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV R           +         +     K+DG+L 
Sbjct: 436 IQKVAMEGLLLKGGGHKMAAGLTVARGQLEPAMARLAELLDKQGAGDLGPADLKLDGMLM 495

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A ++ LI+ +E AGP+GAG P P + FP+  ++  + V  +HL+++F       + AI
Sbjct: 496 PGAASVELIEQIEQAGPFGAGAPAPRYGFPDVAVRFAKRVGESHLKVSFTDGMGGNIDAI 555

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AF  + T LG  L++  G R HV+G L VN W G +  QLR+ DA+  
Sbjct: 556 AFGAFDTNLGPRLLEHGGARFHVSGRLEVNTWGGRQSAQLRLEDAAEA 603


>gi|91976971|ref|YP_569630.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris BisB5]
 gi|91683427|gb|ABE39729.1| exonuclease RecJ [Rhodopseudomonas palustris BisB5]
          Length = 633

 Score =  459 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 271/591 (45%), Positives = 362/591 (61%), Gaps = 3/591 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            AFLGV  S +G  W   L   G  +A AI Q++ +P+++ARV+  R V ID   DFL+P
Sbjct: 34  SAFLGVTRSATGKLWRDRLDPRGTAKAQAIAQRYQLPEMLARVIAGRGVEIDAVPDFLDP 93

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR LMPDP  +T  +  A+RI  A    E + IFGDYDVDGA S AL+   L HC ++ 
Sbjct: 94  TIRKLMPDPSSVTQMEAGAQRIADAAMKRETVAIFGDYDVDGATSAALLTWHLRHCGLDP 153

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +     +GA L+ITVDCG+TS + L  A   G+ V+VIDHHQ
Sbjct: 154 LIHIPDRIFEGYGPNVDAIRGLSEKGATLLITVDCGTTSLEPLAEARRLGMSVVVIDHHQ 213

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLS 240
              E     AL+NPNR DDLSG GHL A G+V + LV + R LR            +LL 
Sbjct: 214 CGDELPEVEALINPNRPDDLSGLGHLAAVGLVMMTLVAVNRELRHRGFWTVELPEPNLLD 273

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P    +LG+M
Sbjct: 274 MLHHVALGTVADVAPLIGLNRAFVAKGLIALRRRDHVGHTALMDVARLNGPPDVFHLGFM 333

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ + 
Sbjct: 334 LGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNTERRVIEQMAEAQAEAEAMA 393

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                 + +VIV   + WHPG+VGL+A+RLKEKFGRP+FAI+ E  G G GSGRSI G D
Sbjct: 394 SLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPAFAIALEPGGIGTGSGRSIGGVD 453

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G+ V  AV EG+L+KGGGHAMAAG+T+ +        + +      V          ID
Sbjct: 454 LGRAVRRAVSEGLLMKGGGHAMAAGVTLRKERLAEFRGWLETALAADVAKSRHINELLID 513

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G ++A  V       L  AGP+GAGNP PV A P H+L     V  AHL++ F+S D   
Sbjct: 514 GAVSARGVTTEFAATLNRAGPFGAGNPEPVIALPAHQLIYADEVGQAHLRLRFKSGDGAI 573

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           +  IAFR  G  LG+ L ++RG+ +HV G L ++ W+G++R QLRV+D + 
Sbjct: 574 VNGIAFRSVGQKLGQALTENRGQSLHVAGSLSIDRWQGAERVQLRVIDVAV 624


>gi|239832155|ref|ZP_04680484.1| single-stranded-DNA-specific exonuclease RecJ [Ochrobactrum
           intermedium LMG 3301]
 gi|239824422|gb|EEQ95990.1| single-stranded-DNA-specific exonuclease RecJ [Ochrobactrum
           intermedium LMG 3301]
          Length = 594

 Score =  459 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 311/590 (52%), Positives = 401/590 (67%), Gaps = 2/590 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            ++ FLG++ S +G +WV  LG    N ALAI Q H I D+VARVL  R VS++ A +F+
Sbjct: 3   TERFFLGIKQSATGQKWVDRLGLREANTALAIAQHHGITDLVARVLAGRGVSVEGAPEFV 62

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R LMPDP  LTD D AA RI  AI   E + IFGDYDVDGA S ALM RFL H  +
Sbjct: 63  DPTLRNLMPDPATLTDMDNAAGRIADAILRRETVAIFGDYDVDGACSSALMSRFLKHYGI 122

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
             ++YIPDRI +GYGPNP  M   + +GA LI+TVDCG+ S  ++  A   G DV+V+DH
Sbjct: 123 QHSIYIPDRIFEGYGPNPDAMRDLVAKGATLIVTVDCGTNSAPSITAAKQAGADVVVLDH 182

Query: 182 HQV-KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HQV       A A+VNPNR DD+S QGHLCAAGVVFL LV + +ILR+  K P   DLLS
Sbjct: 183 HQVGGDLPEDAVAIVNPNREDDISLQGHLCAAGVVFLTLVQVTKILRERGKGP-GPDLLS 241

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVALATVCDVVPL G+NRA+VVKGL+VAR Q N GL AL     I  P+   +LGY+
Sbjct: 242 LLDLVALATVCDVVPLTGVNRAFVVKGLLVARSQSNVGLAALARVSRIGEPLNVFHLGYL 301

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL  DD    + +A++LD LNQ R+ ME+ ML +AEA+   
Sbjct: 302 IGPRINAGGRIGDAGLGARLLTLDDPATADRIAVELDRLNQERQAMEAEMLMEAEAEASL 361

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +      ASVIV   DRWHPGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D
Sbjct: 362 EISGGAGASVIVTASDRWHPGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSIMGLD 421

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK+V  A++ G+LVKGGGHAMAAG+T+ER N G L  + ++ + +IV  L       ID
Sbjct: 422 LGKLVRGAMDRGLLVKGGGHAMAAGITIERGNLGALRAYLEEESAHIVSRLRENQSLSID 481

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L AS   ++L + L+ AGPYG+ +P P+ A P+H L  +R V   H+++T    D + 
Sbjct: 482 GALAASGATVSLYEALQKAGPYGSAHPQPILALPHHILADVRGVGRDHVRVTLRGADGKR 541

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR     LG FL  + G+ +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 VNAIAFRAAEGDLGRFLFNNIGQSVHVAGNLSLNHWNGSVTPQIQILDAA 591


>gi|259416462|ref|ZP_05740382.1| single-stranded-DNA-specific exonuclease RecJ [Silicibacter sp.
           TrichCH4B]
 gi|259347901|gb|EEW59678.1| single-stranded-DNA-specific exonuclease RecJ [Silicibacter sp.
           TrichCH4B]
          Length = 580

 Score =  459 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 240/585 (41%), Positives = 340/585 (58%), Gaps = 9/585 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G  W+   G E       + Q+  +P  V +VL  R V    A  FL P 
Sbjct: 2   SFLGVETSLTGRSWIG-PGVEQARAGEHLAQETGLPPAVCQVLARRGVPAHEATGFLTPQ 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   E+I IF DYDVDG +S AL++ +L      A 
Sbjct: 61  LKELLPDPRRMKDMETAAARFLQAVERRERIAIFADYDVDGGSSAALLLVYLRQMGQQAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M     +   LI+ VDCG+ S+  +  A  +G DV+V+DHH  
Sbjct: 121 LYIPDRIDEGYGPNDEAMAALARDH-DLIVCVDCGTLSHGPI--AAAKGADVVVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAAGVVFL+LV + R  R+   +    DL+++LDL
Sbjct: 178 GETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVEVRRQAREKG-LGAGPDLMAMLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG NRA V +GL V  R+   GL AL +   + S  +  +LG+++GP 
Sbjct: 237 VALATVADVAPLIGANRALVRQGLKVMGRRQRAGLVALADVSRMDSAPSTYHLGFLLGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL +D+  E   LA +LD LN  RR +E+A+   A  +   +  D
Sbjct: 297 VNAGGRIGKADLGARLLSTDNPHEAAALAERLDQLNTERRDIENAVRAAALEQAEERGFD 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE  GRP+  I   +  +G GSGRS+ G D+G  
Sbjct: 357 ---APLVWAAGEGWHPGVVGIVASRLKEATGRPAVVIGL-DGDEGKGSGRSVSGIDLGAS 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV R           +         +     K+DG+L 
Sbjct: 413 IQKVAMEGLLLKGGGHKMAAGLTVARDQLEPAMARLAELLDKQGAGDLGPADLKLDGMLM 472

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + LI+ +E AGP+GAG P P + FP+  ++  + V  +HL+++F       + AI
Sbjct: 473 PGAATVELIEQIEQAGPFGAGAPAPRYGFPDLAVRFAKRVGESHLKVSFTDGMGGNIDAI 532

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF  + T LG  L++  G R HV G L VN W G +  QLR+ DA
Sbjct: 533 AFGAFDTNLGPRLLEHGGARFHVAGRLEVNTWGGRQSAQLRLEDA 577


>gi|114764216|ref|ZP_01443454.1| single-stranded-DNA-specific exonuclease RecJ [Pelagibaca
           bermudensis HTCC2601]
 gi|114543368|gb|EAU46384.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp.
           HTCC2601]
          Length = 581

 Score =  459 bits (1180), Expect = e-127,   Method: Composition-based stats.
 Identities = 246/590 (41%), Positives = 349/590 (59%), Gaps = 10/590 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           ++LGVE S++G RWV   G E   +A A+ Q+  +P  + +VL    V       +L P+
Sbjct: 2   SYLGVEASLTGRRWVG-PGVEQERQAEALAQQSNLPRGLCQVLARLGVEAPEVAGYLAPT 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R++ A+   E+I +F DYDVDG  S AL++ +L    + A 
Sbjct: 61  LRDLLPDPRSLRDMETAATRVLAAVKRRERIAVFADYDVDGGTSAALLLDWLHQLGLGAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   MEK  + G  LII VDCG+ S+  +  A  +G DV+V+DHH  
Sbjct: 121 LYIPDRIDEGYGPNEPAMEKLAS-GHDLIICVDCGTLSHGPI--AAAKGADVVVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+     HLCAA VVFL+LV   R +R+  +     DL+++LDL
Sbjct: 178 GETLPDCVAVVNPNRQDEDGALAHLCAAAVVFLMLVECGRQMREAGQ--RGPDLMAMLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL G+NRA V +GL V  R+  PGL AL +   + +  ++ +LGY++GP 
Sbjct: 236 VALATVADVAPLKGVNRALVRQGLAVMARRARPGLVALSDVARLDTAPSSYHLGYVLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG++++G+RLL S D  E E LA +LD LN  RR +E A+   A A+   +  D
Sbjct: 296 VNAGGRIGQADIGARLLASRDRHESEALAARLDQLNTERREVEEAVRAAALAQAEARGLD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE   RP+  I   +  +G GSGRS+ G D+G  
Sbjct: 356 ---APLVWAAGEGWHPGVVGIVASRLKELTNRPAVVIGL-DGDEGKGSGRSVSGVDLGAS 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     +G+L+KGGGH MAAGLTV R       +   +               K+DG+L 
Sbjct: 412 IQRLAADGLLLKGGGHKMAAGLTVARDGLEAAMERLSELLAKQGAGQGGAADLKLDGLLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A NI L + +E AGP+GAG P P FA P+ ++   + V   HL+++F       + AI
Sbjct: 472 PGAANIELCEQMEQAGPFGAGAPAPRFAMPDVQVGFAKQVGSGHLKVSFGDGLGAKIDAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
            F  +  PLG+ L   RG+R HV G L +N W G +  Q+R+ DA+P EG
Sbjct: 532 CFGAFDGPLGQALCDHRGRRFHVAGRLEINEWNGRRSVQMRLEDAAPAEG 581


>gi|114704297|ref|ZP_01437205.1| single-stranded-DNA-specific exonuclease protein [Fulvimarina
           pelagi HTCC2506]
 gi|114539082|gb|EAU42202.1| single-stranded-DNA-specific exonuclease protein [Fulvimarina
           pelagi HTCC2506]
          Length = 612

 Score =  459 bits (1180), Expect = e-127,   Method: Composition-based stats.
 Identities = 285/589 (48%), Positives = 375/589 (63%), Gaps = 2/589 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
             QAFLGVE S+SG RW + L   G   ALA++QK  I +IVARVL  R V  + A  FL
Sbjct: 22  TGQAFLGVERSLSGRRWRAALDARGEGLALAMSQKQGIDEIVARVLAARGVPGEEAHRFL 81

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP +LTD D AA RI  AI   E++ IFGDYDVDGA+S ALM R+L H  +
Sbjct: 82  APRLRDLMPDPSVLTDMDAAADRIASAIQKRERVAIFGDYDVDGASSSALMWRYLDHFGI 141

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
            A +YIPDR+ +GYGP+   M +  +  A LIITVDCG+ S+D ++ A   G DV+V+DH
Sbjct: 142 GARIYIPDRVTEGYGPSVVAMRELAS-EASLIITVDCGTASFDPIEAAKAAGADVVVLDH 200

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSL 241
           HQ   +   A ALVNPNR DD++G GHLCAAGVVF+ LV I R LR+        D+L  
Sbjct: 201 HQTGPDIPSATALVNPNRQDDVAGLGHLCAAGVVFMTLVAINRALRKRG-YSDLPDILCW 259

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LD+VALATVCDVVPL GLNRA+VV+GL V R   N GL AL     +S PI   +LG+++
Sbjct: 260 LDIVALATVCDVVPLTGLNRAFVVQGLKVMRTMKNVGLAALTRIARLSGPIEPHHLGFLL 319

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LGSRLL   D  E E LA +LD LNQ R+ ME  ML  AE  +L +
Sbjct: 320 GPRINAGGRIGDAALGSRLLCLTDGAEAEALAARLDGLNQERQAMEQVMLRDAEEAILRE 379

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
               +   V+V     WH GIVGL+AARLKE+F RP+FAI+F+  GKG GSGRSI G D+
Sbjct: 380 IGTGEGPPVLVTSSGEWHLGIVGLIAARLKERFRRPAFAIAFDGSGKGSGSGRSIAGVDL 439

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G++V  AV   ++ KGGGHAMAAG+T+ R        F ++ A + V          IDG
Sbjct: 440 GRLVRDAVSHEVIEKGGGHAMAAGITIRRERLSDFRAFIEERALDAVARTRANESLDIDG 499

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            ++AS +   L   +E+AGP+G G+  PVFA  N ++ +  +V  AH++ T         
Sbjct: 500 AISASGLLPDLYRAIEAAGPFGQGHETPVFALGNLRVLNADIVGHAHVRATVGGPSGGRA 559

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             IAF+   TP+GE L++   + +H+ G L ++ +RG ++ +LRV+D +
Sbjct: 560 DVIAFKQAETPIGERLLKRSDRPVHIAGSLSLDRFRGQEQVRLRVIDVA 608


>gi|254512010|ref|ZP_05124077.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacteraceae
           bacterium KLH11]
 gi|221535721|gb|EEE38709.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacteraceae
           bacterium KLH11]
          Length = 580

 Score =  458 bits (1178), Expect = e-126,   Method: Composition-based stats.
 Identities = 249/588 (42%), Positives = 346/588 (58%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+SG RWV   G E    A  + Q+  +P  V +VL  R V    A  FL P 
Sbjct: 2   AFLGVEQSLSGRRWVG-PGVEVERAAEMMVQQTDLPRAVCQVLARRGVPAMEATGFLEPR 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP ++ D ++AA R ++A+ N ++I +F DYDVDG +S AL++ +L    V A 
Sbjct: 61  LKELLPDPRLMKDMEQAATRFLEAVRNRQRIAVFADYDVDGGSSAALLLVWLRQMGVQAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN   M++       LII VDCG+ S++ +  A  +G DVIV+DHH  
Sbjct: 121 LYVPDRIDEGYGPNIPAMQELAA-AHDLIICVDCGTLSHEPI--AAAKGADVIVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAA VVFL+LV   R +R         DL++LLDL
Sbjct: 178 GETLPDCVAVVNPNRQDESGDLGYFCAAAVVFLMLVEAGRQVRAAG--AKGPDLMALLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG NRA V +GL V  R+  PGL AL +   + S  ++ +LG+++GP 
Sbjct: 236 VALATVADVAPLIGANRALVRQGLKVMARRQRPGLVALSDVSRMDSAPSSYHLGFLLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL +D   E E L+ +LD LN  RR +E+A+   A A+   +  D
Sbjct: 296 VNAGGRIGQADLGARLLSTDSITEAEALSQRLDALNTERREIENAVRAAALAQAEERGLD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE   RP+  I F +  +G GSGRSI G D+G  
Sbjct: 356 ---APLVWAAGEGWHPGVVGIVASRLKEAANRPAIVIGF-DGDEGKGSGRSISGVDLGAS 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+LVKGGGH MAAGLTV R           +               K+DG L 
Sbjct: 412 IQRLASEGLLVKGGGHKMAAGLTVMRDQLEPAMARLSELLAKQGAGQSGPADLKLDGTLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
            +A  + LI+ +E AGP+GAG P P +A P+ +++  + V   HL+++     S  L AI
Sbjct: 472 PAAATVDLIEQIEQAGPFGAGAPAPRYALPDLQVRFAKRVGETHLKLSLSDGMSGGLDAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AF  +  PLG+ L    G R H  G L VN W G +  QLR+ DA+  
Sbjct: 532 AFGAFDGPLGDRLSNHGGARFHFAGRLEVNSWGGRQSVQLRLEDAAEA 579


>gi|260426541|ref|ZP_05780520.1| single-stranded-DNA-specific exonuclease RecJ [Citreicella sp.
           SE45]
 gi|260421033|gb|EEX14284.1| single-stranded-DNA-specific exonuclease RecJ [Citreicella sp.
           SE45]
          Length = 579

 Score =  456 bits (1174), Expect = e-126,   Method: Composition-based stats.
 Identities = 242/588 (41%), Positives = 340/588 (57%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           ++LGVE S++G RWV   G E   +A A+ Q+   P  +  VL    V       +L P 
Sbjct: 2   SYLGVESSLNGRRWVG-PGVEQERQAEAMAQQTGQPRALCAVLARLGVEPAEVPGYLEPK 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R ++A+   E+I +F DYDVDG +S AL++ +L      A 
Sbjct: 61  LRELLPDPRGLRDMETAAARFLEAVKRRERIAVFADYDVDGGSSAALLIDWLHQMGREAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M++       LI+ VDCG+ S++ +  A    +  +V+DHH  
Sbjct: 121 LYIPDRIDEGYGPNVPAMQQLAG-AHDLIVCVDCGTLSHEPIAAAAGADV--VVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL+S+LDL
Sbjct: 178 GETLPDCVAVVNPNRQDEDGTLAHLCAAAVVFLMLVECGRQLREAG--ARGPDLMSMLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG+NRA V +GL V  R+  PGL AL +   + +  ++ +LGY++GP 
Sbjct: 236 VALATVADVAPLIGVNRALVRQGLAVMARRQRPGLVALSDVARLDTAPSSYHLGYVLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG++++G+RLL S D  E E LA +LD LN  RR +E A+   A A+   +  D
Sbjct: 296 VNAGGRIGQADIGARLLASRDRHEAEALAERLDRLNTERREVEEAVRASALAQAEARGLD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   GD WHPG+VG++A+RLKE   RP+  I   + G+G GSGRS+ G D+G  
Sbjct: 356 ---APLVWAAGDGWHPGVVGIVASRLKEMTNRPAVVIGL-DGGEGKGSGRSVSGVDLGAS 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           V   V EG+L+KGGGH MAAGLTV             +               ++DG+L 
Sbjct: 412 VQRLVAEGLLLKGGGHKMAAGLTVAEAQLEAAMARLAELLAKQGAGKGGAADLRLDGMLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + L +MLE AGP+GAG P+P FAFP+ ++   + V   HL+++        L AI
Sbjct: 472 PGAATVELCEMLERAGPFGAGAPSPRFAFPDVQVSFAKQVGSGHLKLSLGDGLGARLDAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            F  +  PLG+ L   +G+R  + G L +N W G +  QLR+ DA+P 
Sbjct: 532 CFGAFEGPLGQALTDHKGQRFQMAGRLEINEWNGRRAVQLRLEDAAPA 579


>gi|323136274|ref|ZP_08071356.1| single-stranded-DNA-specific exonuclease RecJ [Methylocystis sp.
           ATCC 49242]
 gi|322398348|gb|EFY00868.1| single-stranded-DNA-specific exonuclease RecJ [Methylocystis sp.
           ATCC 49242]
          Length = 597

 Score =  456 bits (1173), Expect = e-126,   Method: Composition-based stats.
 Identities = 277/590 (46%), Positives = 355/590 (60%), Gaps = 6/590 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFLGVE S+ G  W + L   G   ALA+ Q H + D++ARVL  R VS+     +L+P+
Sbjct: 7   AFLGVERSVLGRPWRARLDASGEALALALAQTHGLDDMLARVLAGRGVSVAEVDRYLDPT 66

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV-NA 123
           IR LMPDP  + D D A  R+ +AI   E+I IFGDYDVDGA S AL++ +         
Sbjct: 67  IRTLMPDPSTVRDMDAAVDRLARAIETGEQIAIFGDYDVDGACSSALLIDYWRAAEAPEP 126

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN   +      GA L++TVDCG+TS++    A   G+DVIV+DHHQ
Sbjct: 127 LLHIPDRIFEGYGPNAEAIRNLAGRGATLLVTVDCGTTSHEPFAVARELGLDVIVLDHHQ 186

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN---FDLLS 240
                +P   +VNPNR DDLSGQG LCAAGVVFL L  + R LR  +    +    DLLS
Sbjct: 187 APE-HLPDAIVVNPNRQDDLSGQGGLCAAGVVFLALAGLLRTLRTRDWWGDHRPAPDLLS 245

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATV DV PL GLNRA+V KGL V R +   GL AL++   +  P  A +LG+ 
Sbjct: 246 SLDLVALATVADVAPLSGLNRAFVAKGLSVMRNRSRTGLAALMDAARMDGPPRAYHLGFA 305

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG++ LG+ LL   D  E   +A +LD LN  R+ +E   LE A A    
Sbjct: 306 LGPRINAGGRIGDAGLGACLLTLSDPVEASRIARELDRLNAERQAIEREALEAAVALAEE 365

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           Q     + S +VVEG  WHPG+VGL+AARLKEKF  PSFAI+F  +    GSGRS+ G D
Sbjct: 366 QFVKTNRLSCLVVEGSDWHPGVVGLIAARLKEKFNLPSFAIAFNGE-TCSGSGRSLSGVD 424

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           IGK V  AVE G+ VKGGGHAMAAG+TV       L +F        V A        ID
Sbjct: 425 IGKTVRRAVELGLAVKGGGHAMAAGITVLADRVAALREFLNDALAEQVEAARGADALVID 484

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
             L+   VN+ L+  +E AGP+G GNP P+F  P  ++    VV   H++    S D  +
Sbjct: 485 AALSGRGVNLDLLRRVERAGPFGQGNPEPLFVLPEQRIVDAAVVGTGHVRARLRSGDGAS 544

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + AIAFR  G+PLGE L+  RG+R HV   L  N +RG +R + R+ D +
Sbjct: 545 VDAIAFRAVGSPLGEALLGGRGERFHVAARLSTNQFRGVERVETRIADLA 594


>gi|90419170|ref|ZP_01227080.1| single-stranded-DNA-specific exonuclease recJ [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336107|gb|EAS49848.1| single-stranded-DNA-specific exonuclease recJ [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 597

 Score =  456 bits (1172), Expect = e-126,   Method: Composition-based stats.
 Identities = 280/590 (47%), Positives = 387/590 (65%), Gaps = 1/590 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           + FL V+ SI G RW++ L +     AL + Q   +PDIV+RVL  R ++   A  FL+P
Sbjct: 6   RTFLDVDRSIGGRRWLNALDERAEGAALKMAQSLGLPDIVSRVLAARGIAEADATGFLDP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
            IR LMPDP  LT  D AA R+  AI   E + IFGDYDVDGAAS AL+ R+L H  ++A
Sbjct: 66  RIRDLMPDPSRLTAMDAAAERLADAIGRRESVAIFGDYDVDGAASSALLWRYLKHFGIDA 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            + IPDRI +GYGPNP+ M +   +GA LI+TVDCG+ S++A++ A  +G+DV+V+DHHQ
Sbjct: 126 AIRIPDRITEGYGPNPAAMRELAADGATLIVTVDCGTGSFEAIEAARAEGVDVVVLDHHQ 185

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN-FDLLSLL 242
              E   A  LVNPNR DDLSG GHLCAAGVVF+ LV + R LR+         D+  LL
Sbjct: 186 TGPELPDANVLVNPNRQDDLSGLGHLCAAGVVFMTLVAVSRELRRRGMAQSKLPDVFGLL 245

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATVCDVVPL+GLNRA+VV+GL VA  Q N GL AL     +S P+   + G+M+G
Sbjct: 246 DLVALATVCDVVPLVGLNRAFVVQGLKVAHAQRNGGLAALGRVSRLSGPMETHHFGFMLG 305

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  DD    + +A +L  LN+ R+ ME  ML +A+A+V  + 
Sbjct: 306 PRINAGGRIGDAALGSRLLCLDDDAACDEVAARLSALNEERQAMEQTMLAEADAEVAAEI 365

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
              +  +V+VV  + WHPGIVGL++ARLKE++ RP+FAI+F+  G+G GSGRSI GFD+G
Sbjct: 366 GSGEGPAVLVVGSNDWHPGIVGLISARLKERYRRPAFAIAFDGSGRGTGSGRSIGGFDLG 425

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           ++V  AV EG+LVKGGGHAMAAG+T+++   G    F ++ A   V AL      K+DG 
Sbjct: 426 RLVREAVIEGLLVKGGGHAMAAGVTIQKDRLGDFRGFLEERAAAAVSALREGDSLKVDGT 485

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           ++A+ +   L   +  AGP+G+G+ +P+FA   H++ S  +V   H++ T    D   + 
Sbjct: 486 VSAAGLTPDLYATIMRAGPFGSGHASPIFALARHRIDSSSIVGNGHVRATLRGADGARVS 545

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AIAF+   T +G+ L+ SR + +H  G L ++ +RG +  + R+LD +  
Sbjct: 546 AIAFKTADTEVGQRLLSSRDRPIHAVGTLSLDRFRGREEVRFRLLDLAEA 595


>gi|118588879|ref|ZP_01546286.1| single-stranded-DNA-specific exonuclease [Stappia aggregata IAM
           12614]
 gi|118438208|gb|EAV44842.1| single-stranded-DNA-specific exonuclease [Stappia aggregata IAM
           12614]
          Length = 605

 Score =  456 bits (1172), Expect = e-126,   Method: Composition-based stats.
 Identities = 282/589 (47%), Positives = 375/589 (63%), Gaps = 3/589 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +  LGV  S +   W   L    +  A+AI+Q H +PD++ARV+  R V  D A  FL+P
Sbjct: 11  RLVLGVARSANDNAWRERLSAADLRTAMAISQVHGLPDVLARVMAARGVLADEATGFLDP 70

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           S++LLMPDP  L D D A  R+  A+    KI IFGDYDVDGA S A+  ++L    ++ 
Sbjct: 71  SLKLLMPDPSSLVDMDAAVARVADAVQAGRKIAIFGDYDVDGATSSAIFAKYLQWLGLDP 130

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI++GYGPN   +E     GA L++T+DCGSTS++A + A    +DV+VIDHHQ
Sbjct: 131 VIHIPDRIIEGYGPNGPAIEHLRQGGADLLVTLDCGSTSFEAFETARQLDLDVVVIDHHQ 190

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFDLLSL 241
           V        ALVNPNR DDLSGQGHL A GV FL LV + R LR+          DL++L
Sbjct: 191 VGETLPAVEALVNPNRQDDLSGQGHLAAVGVTFLFLVGLNRELRRRGVFQGAQQPDLMAL 250

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVAL TVCDVVPL GLNRAYV +GL V  ++ N GL AL +   +S      +LG++I
Sbjct: 251 LDLVALGTVCDVVPLQGLNRAYVTRGLAVMHQRRNYGLTALADTARVSGKPAPYHLGFLI 310

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LG+RLL ++D  E   +A +LD LN  R+ ME+ MLEQA+A+    
Sbjct: 311 GPRINAGGRIGDAALGARLLTTEDPHEARAIAERLDQLNTERQAMEAVMLEQADAEA-EM 369

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
               +  +V++   D WHPGIVGL+A+RLKE + RPSFAI+F+E GKG GSGRSI G D+
Sbjct: 370 AIQARDPAVLLTGSDDWHPGIVGLIASRLKEAYRRPSFAIAFDETGKGTGSGRSIPGVDL 429

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           GK V  AV+ G+L KGGGHAMAAGLTV       L  +F     + V         KID 
Sbjct: 430 GKAVRGAVDLGLLEKGGGHAMAAGLTVLSEKRADLEAYFNDVLKDDVETASANRELKIDA 489

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            L A+  N+ L+++LE AGPYGAG+  PVFAFP H++    VV   H++ +  S D   L
Sbjct: 490 ALTATGANLDLLELLEKAGPYGAGHAEPVFAFPAHRISFADVVGKGHVRASITSGDGTAL 549

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +AI F+    P G+ L+Q RG+ +HV G L ++ W+G+ + QLR+LD +
Sbjct: 550 KAICFKADDKPHGQMLLQGRGQSLHVAGTLSIDTWQGTPKVQLRILDVA 598


>gi|158423475|ref|YP_001524767.1| RecJ exonuclease [Azorhizobium caulinodans ORS 571]
 gi|158330364|dbj|BAF87849.1| RecJ exonuclease [Azorhizobium caulinodans ORS 571]
          Length = 606

 Score =  455 bits (1170), Expect = e-125,   Method: Composition-based stats.
 Identities = 277/596 (46%), Positives = 369/596 (61%), Gaps = 5/596 (0%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           + ++ FL V  S +G  W   L       ALAI Q+H +PD+VAR+L  R V ID    F
Sbjct: 11  LTNRPFLSVARSATGRTWRDRLDVRASQMALAIAQRHFVPDLVARILAGRGVDIDDVPAF 70

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L+P+I+ L+PDP  LTD   A  R+  A+   E++ +FGDYDVDGA S AL++  L    
Sbjct: 71  LDPTIKALLPDPDTLTDMGGAVERVAAAVTRGEQVAVFGDYDVDGATSTALLVDVLRAAG 130

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           ++   +IPDRI +GYGPN + +E+    G  L+ITVDCG+TS + L  A   G+DV+VID
Sbjct: 131 LDPFFHIPDRIFEGYGPNVNAIEQLAARGVTLLITVDCGTTSTEPLAAARRLGLDVVVID 190

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFD 237
           HHQ       A A+VNPNR DDLSG GHLCA G+VF+ +V + R LR+           D
Sbjct: 191 HHQAGEHLPDANAIVNPNREDDLSGLGHLCAVGLVFVTVVGLVRKLREMGHWTGDRPAPD 250

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           LL+ LDLVAL TV DVVPL GLNRA+V KGL+  RR+  PGL AL++   +  P    +L
Sbjct: 251 LLAALDLVALGTVADVVPLKGLNRAFVTKGLIALRRRQRPGLTALMDVSRLDGPPRPWHL 310

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAML-EQAEA 356
           G+++GP INAGGRIG++ LG+RLL++ D  E   +A +LD LN  R+ +E  +L +    
Sbjct: 311 GFLLGPRINAGGRIGDATLGTRLLLTQDPAEARAIAAELDRLNTERQAVEQGILADAEAE 370

Query: 357 KVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSI 416
                      AS +VV G  WHPG+VGL+A+RLKE+F RP+FAI+F  +  G GSGRSI
Sbjct: 371 AQAAMGIAGDGASTVVVSGQGWHPGVVGLVASRLKERFNRPAFAIAFTGE-TGTGSGRSI 429

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPV 476
           +G D+GK V  AVE G+LVKGGGHAMAAGLTVE+   G L  F +      V        
Sbjct: 430 QGVDLGKAVRAAVEAGLLVKGGGHAMAAGLTVEKARLGDLRAFLENALAPDVAKAAGEGT 489

Query: 477 FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ 536
             IDG L AS    AL+D +  AGP+GAGNP PVFAFP+H+L         H++    + 
Sbjct: 490 LTIDGALTASGATPALLDQVAKAGPFGAGNPEPVFAFPSHRLTYAETFGNGHVRARLVAG 549

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           D  TL+A+AFR    PLG  ++ +RG+ +HV G L +++W+G  R  LRV D + V
Sbjct: 550 DGTTLKAVAFRCAEEPLGRAILNARGRNLHVAGGLDMDHWQGEARVSLRVRDVAEV 605


>gi|240139513|ref|YP_002963988.1| putative single-strand DNA-specific exonuclease RecJ
           [Methylobacterium extorquens AM1]
 gi|240009485|gb|ACS40711.1| putative single-strand DNA-specific exonuclease RecJ
           [Methylobacterium extorquens AM1]
          Length = 611

 Score =  454 bits (1169), Expect = e-125,   Method: Composition-based stats.
 Identities = 263/592 (44%), Positives = 355/592 (59%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGIN-RALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            + FL V  S  G  W    G  G+   A+ +TQ + +PD++ARVLV R V    A  +L
Sbjct: 18  PRPFLDVTASALGRPWRERCGDPGLQALAVTMTQAYGLPDLLARVLVGRGVRPAEADAYL 77

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP +L D + A  R+  A+   E + IFGDYDVDGA+S AL+  +L    V
Sbjct: 78  APRLRDLMPDPSVLVDMEAAVERLAYAVRARETVAIFGDYDVDGASSAALLADYLRALGV 137

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DH
Sbjct: 138 PVRIHIPDRITEGYGPNVGAVTTLREEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDH 197

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLL 239
           H    E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR+D          L 
Sbjct: 198 HGAPEELPQTRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRRDGVFATSAEPRLT 257

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDLVALATV DVVPL GLNRA+VV+GL V R +G PGL AL++   +S P  A +LG+
Sbjct: 258 DFLDLVALATVADVVPLTGLNRAFVVQGLAVMRGRGRPGLAALLDAAGLSEPPEAWHLGF 317

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIG++ LG+RLL + D  E   +A +LD LN+ R+ +E+  + +AEA++ 
Sbjct: 318 LVGPRINAGGRIGDAGLGARLLTTADPMEARRIADELDRLNRERQAIEAQAVAEAEAEMD 377

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                     V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G 
Sbjct: 378 AHLTRDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGA 437

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G  V  AVE G+ VKGGGHAMAAG+T+         +         V          I
Sbjct: 438 DLGGAVRSAVEAGLAVKGGGHAMAAGVTLPPGGLAAFGESLTHDLVETVGRARAAEALLI 497

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A      L+ +++ AGP+G G P PV A P H++    +V   H++    S D +
Sbjct: 498 DGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRIVDAGIVGNGHVRARLVSGDGQ 557

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 558 AVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|13471056|ref|NP_102625.1| single-strand DNA-specific exonuclease [Mesorhizobium loti
           MAFF303099]
 gi|14021800|dbj|BAB48411.1| single-strand DNA-specific exonuclease [Mesorhizobium loti
           MAFF303099]
          Length = 592

 Score =  454 bits (1168), Expect = e-125,   Method: Composition-based stats.
 Identities = 307/587 (52%), Positives = 387/587 (65%), Gaps = 1/587 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           + FL +  S +G  W   L +     ALAI Q H +PDIVARVL  R V+ D  + FL P
Sbjct: 5   RLFLDIRQSATGLSWEHRLTERQDMVALAIAQGHGVPDIVARVLAGRGVTADETERFLEP 64

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR L+P+P  LTD DKAA RI  A+   EK+ IFGDYDVDGAAS AL+ RFL+H S+ +
Sbjct: 65  TIRDLLPNPASLTDMDKAATRIAAAVMAREKVAIFGDYDVDGAASSALLKRFLAHFSIPS 124

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP  M + ++ GA LI+TVDCG+ S  ++  A   G DV+V+DHHQ
Sbjct: 125 EIYIPDRIFEGYGPNPDAMRELVSRGATLIVTVDCGTNSAISVDAANEAGADVVVLDHHQ 184

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
           V      A A+VNPNR DDLSGQGHLCAAGVVFL LV   +ILR  + V    DLLSLLD
Sbjct: 185 VGGALPAAIAVVNPNRDDDLSGQGHLCAAGVVFLALVQTAKILRGLSDVAP-PDLLSLLD 243

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATVCDVVPL G+NRA+VVKGL +AR+Q N GL AL     I  PI+  +L Y+IGP
Sbjct: 244 LVALATVCDVVPLTGVNRAFVVKGLQMARQQKNEGLAALARVSRIGEPISTFHLAYLIGP 303

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LGSRLL +DD  E   +A  LD LNQ R+LME  ML  A A+   +  
Sbjct: 304 RINAGGRIGDAALGSRLLATDDPVEARTIAETLDRLNQERQLMEQEMLAAARAEADAELA 363

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
                +++V   + WHPGIVGLLA+RLK+   RP+FAI+F   G G GSGRS+ GFD+G+
Sbjct: 364 GGSGPAIVVTASNNWHPGIVGLLASRLKDHARRPAFAIAFNAVGIGTGSGRSVSGFDLGR 423

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  A + G++VKGGGH MAAG+TVER   G L  FF++ A   V  L       IDG L
Sbjct: 424 LVREAADAGLIVKGGGHGMAAGITVERARLGELRAFFEERAAADVFRLQDEESLAIDGAL 483

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            A    ++L+D LE AGP+GAG+  PVF  P H+L   R V   H++   +S     + A
Sbjct: 484 AAEGATLSLLDALEKAGPFGAGHVAPVFVLPRHRLADARPVGTNHIRCELQSDAGGRIPA 543

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR   T LGEFL ++RGK +HV G L  NYW G++  Q R++DA+
Sbjct: 544 IAFRAVDTVLGEFLFKNRGKSVHVAGSLSGNYWNGNRTVQFRIVDAA 590


>gi|310816884|ref|YP_003964848.1| single-stranded-DNA-specific exonuclease RecJ [Ketogulonicigenium
           vulgare Y25]
 gi|308755619|gb|ADO43548.1| single-stranded-DNA-specific exonuclease RecJ [Ketogulonicigenium
           vulgare Y25]
          Length = 581

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 258/588 (43%), Positives = 345/588 (58%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGV  S++G  WV    +       A++Q+  +   +A +L  R +  D A+ FL P 
Sbjct: 2   SFLGVTDSVTGRAWVGPDLETD-RLTEALSQQLGLSRPLAALLAQRGIDADGAEGFLTPR 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R LMPDP  L D +KAA R+V A+   ++I IFGDYDVDG AS AL++ +L +  + A 
Sbjct: 61  LRDLMPDPRSLRDMEKAAARLVLAVQTRQRIAIFGDYDVDGGASSALLIDWLRNFGLQAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M         LII VDCG+ S++AL  AT    DVIV+DHH  
Sbjct: 121 LYIPDRIDEGYGPNVPAMADLAARH-DLIICVDCGTLSHEALGAATAA--DVIVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                PA A+VNPNR D+     +LCAAGVVFL LV   R LR         DL SLLDL
Sbjct: 178 GETLPPALAVVNPNRQDESGDLTYLCAAGVVFLALVEANRQLRAGGL--QGPDLTSLLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+GLNRA V +GL V  R+  PGL AL +   I S  ++ +LGY++GP 
Sbjct: 236 VALATVADVAPLVGLNRALVRQGLAVMGRRARPGLVALADVARIDSAPSSYHLGYILGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG ++LG+RLL + D  E   +A +LD LN  RR +ESA+ + A A+   +  +
Sbjct: 296 VNAGGRIGRADLGARLLATTDPHEAAAMAAQLDALNTERRAIESAVRDAAIAQAEARGLE 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++    + WHPG+VG++AAR+KE   RPS  I F + G G GSGRS+ G D+G  
Sbjct: 356 ---APLVWAASEGWHPGVVGIVAARIKEATNRPSVVIGF-DGGIGKGSGRSVSGVDLGAA 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV R N         +               +ID +L 
Sbjct: 412 IQRVAAEGLLLKGGGHKMAAGLTVTRENLEPAMARLSELLARQGAGAGGPSDLRIDALLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  +A+I+ LE AGP+GA  P P FA P+  +Q ++ V   HL++T        L AI
Sbjct: 472 PGAATVAMIEQLEQAGPFGASAPAPRFALPDVVVQYVKPVGSDHLKVTLGDGLGARLDAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AF    +PLG  L  S  +R+HV G L VN+W+G    QLR+ DA+  
Sbjct: 532 AFNAAQSPLGHLLTHSGSQRVHVVGRLEVNHWQGRASAQLRIEDAAKA 579


>gi|84502743|ref|ZP_01000862.1| probable single-stranded DNA-specific exonuclease [Oceanicola
           batsensis HTCC2597]
 gi|84389138|gb|EAQ01936.1| probable single-stranded DNA-specific exonuclease [Oceanicola
           batsensis HTCC2597]
          Length = 582

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 243/588 (41%), Positives = 336/588 (57%), Gaps = 10/588 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V  S++G RWV     E    A A+ Q       + +VL  R V+ + A  FL P++
Sbjct: 3   FLNVASSLTGRRWVG-PSVELDRAAEALAQARGFDRAICQVLARRGVTAEAADLFLAPAL 61

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R L+PDP  L D + AA R +QA+   E+I IF DYDVDG +S AL++ +L      A +
Sbjct: 62  RDLLPDPRRLRDMEPAAARFLQAVKRRERIAIFADYDVDGGSSAALLIDWLRQMGREATL 121

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           Y+PDRI +GYGPN   M+        LI+ VDCG+ S+D +      G DV+++DHH   
Sbjct: 122 YVPDRIDEGYGPNVPAMQAL-GRTHDLIVCVDCGTLSHDPVA---AAGCDVVILDHHLGG 177

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLV 245
                  A VNPNR D+     HLCAA VVFL+LV   R  R +       DL+++LDLV
Sbjct: 178 ETLPDCVACVNPNRQDEDGALAHLCAAAVVFLMLVEANRQARAEG-ATSLPDLMAMLDLV 236

Query: 246 ALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSI 305
           ALATV DV PL G+NRA+V +GL +  R+  PGL AL +   + S  TA +LGY++GP I
Sbjct: 237 ALATVADVAPLTGVNRAFVRQGLAIMARRERPGLAALADVARMDSAPTAYHLGYLLGPRI 296

Query: 306 NAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI 365
           NAGGRIG+++LG+RLL + D  E + LA +L+ LN  RR +E+A+   A A+   +  D 
Sbjct: 297 NAGGRIGKADLGARLLAATDRHEAQALADRLNELNAERREIEAAVTAAAMAQAEERGLD- 355

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMV 425
             A ++   G+ WHPG+VG++A+RLKE   RP+  I   +  +G GSGRS+ G D+G  V
Sbjct: 356 --APLVWASGEGWHPGVVGIVASRLKEATNRPAVVIGL-DGDEGKGSGRSVAGVDLGASV 412

Query: 426 SFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNA 485
                EG+L+KGGGH MAAGLTV R       +                   ++DG+L  
Sbjct: 413 QRLAAEGLLIKGGGHRMAAGLTVARDAIPEAMERLGALLAKQGAGTGGAADLRLDGLLMP 472

Query: 486 SAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIA 545
            A  + LI  +E+AGP+GAG P P F FP+  +   + V  +HL++ F       L AIA
Sbjct: 473 GAATVPLIQQIETAGPFGAGAPAPRFVFPDVAVSFAKRVGESHLKLRFGDGMGAALDAIA 532

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           F  Y  PLG  L    G R+H+ G L +N W G +  QLR+ DA+P +
Sbjct: 533 FGAYEGPLGTALSDRSGARVHLAGRLELNSWGGRQSVQLRIEDAAPAD 580


>gi|254475596|ref|ZP_05088982.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria sp. R11]
 gi|214029839|gb|EEB70674.1| single-stranded-DNA-specific exonuclease RecJ [Ruegeria sp. R11]
          Length = 580

 Score =  453 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 231/588 (39%), Positives = 339/588 (57%), Gaps = 9/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RW+          A  + Q+  +P  V +VL  R V    A+ FL P 
Sbjct: 2   SFLGVETSLTGRRWIGPDLD-TARAAEMMEQQIGLPPAVCQVLARRGVPAHEAQGFLTPQ 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   ++I +F DYDVDG +S AL++ +L    + A 
Sbjct: 61  LKELLPDPRRMKDMEIAAARFLQAVEKRQRIAVFADYDVDGGSSAALLLVWLQQAGLGAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN   M     +   LI+ VDCG+ S+  +  A   G DVIV+DHH  
Sbjct: 121 LYVPDRIDEGYGPNDEAMAALARDH-DLIVCVDCGTLSHGPI--AAAMGADVIVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAAGVVFL+LV + R +R    +    DL++LLDL
Sbjct: 178 GETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVEVRRQMRDKG-LGTGPDLMALLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+  NRA V +GL V   +  PGL AL +   + S  +  +LG+++GP 
Sbjct: 237 VALATVADVAPLVDANRALVRQGLKVMAARQRPGLVALADVSRMDSAPSTYHLGFLLGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL + +  E E +A +LD LN  RR +E+A+   A  +   +  D
Sbjct: 297 VNAGGRIGKADLGARLLATTNPAEAEAIAARLDELNTERREIENAVRAAALEQAEARGFD 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE  GRP+  I   +  +G GSGRS+ G D+G  
Sbjct: 357 ---APLVWAAGEGWHPGVVGIVASRLKEATGRPAVVIGL-DGDEGKGSGRSVSGIDLGAS 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+ VKGGGH MAAGLTV R       +   +         +     K+DG+L 
Sbjct: 413 IQRVAAEGLFVKGGGHKMAAGLTVSRDKLEPAMERLAELLAKQGAGDLGPADLKLDGMLM 472

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + LI+ ++ AGP+GAG P P + FP+ +++  + +  +HL+++     S  + AI
Sbjct: 473 PGAATVPLIEQIDQAGPFGAGAPAPRYGFPDLQVRFAKRIGESHLKLSLSDGLSSGIDAI 532

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            F  + T LG  L+   G R H  G L +N W G +  QLR+ DA+  
Sbjct: 533 CFGAFDTALGPRLLDHGGARFHFAGRLEINTWGGRQSVQLRLEDAAEA 580


>gi|319783896|ref|YP_004143372.1| single-stranded-DNA-specific exonuclease RecJ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169784|gb|ADV13322.1| single-stranded-DNA-specific exonuclease RecJ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 594

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 309/587 (52%), Positives = 390/587 (66%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           + FL V  S+SG  W   L +     ALAI Q + +PDIVARVL  R V+ +  + FL+P
Sbjct: 6   RLFLDVRQSVSGVSWEHRLTERQDMIALAIAQGYGVPDIVARVLAGRGVTAEQTERFLDP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR L+PDP  LTD D+AA RI  A+   EK+ IFGDYDVDGAAS AL+ RFL+H SV +
Sbjct: 66  TIRDLLPDPASLTDMDRAAARIAAAVMAREKVAIFGDYDVDGAASSALLKRFLTHFSVPS 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP  M + ++ GA LI+TVDCG+ S  ++  A   G DV+V+DHHQ
Sbjct: 126 EIYIPDRIFEGYGPNPDAMRELVSRGATLIVTVDCGTNSAASIDAANEAGADVVVLDHHQ 185

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
           V      A A+VNPNR DDLSGQGHLCAAGVVFL LV   RILR         DLLSLLD
Sbjct: 186 VGGALPAAIAVVNPNRDDDLSGQGHLCAAGVVFLALVQTARILRSRMADATPPDLLSLLD 245

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           +VALATVCDVVPL G+NRA+VVKGL +AR+Q N GL AL     I  PI+  +L Y+IGP
Sbjct: 246 IVALATVCDVVPLTGVNRAFVVKGLQMARQQKNEGLAALARVSRIGEPISTFHLAYLIGP 305

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LGSRLL +DD  E   +A  LD LNQ R+LME  ML  A A+   +  
Sbjct: 306 RINAGGRIGDAALGSRLLATDDPVEARTIAETLDRLNQERQLMEQEMLAAARAEADAELA 365

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
                +++V   + WHPGIVGLLA+RLK+   RP+FAI+F  +G G GSGRS+ GFD+G+
Sbjct: 366 GGNGPAIVVTASNSWHPGIVGLLASRLKDHARRPAFAIAFNANGIGTGSGRSVSGFDLGR 425

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  A   G++VKGGGH MAAG+TVER   G L  FF++ A   V  L       IDG L
Sbjct: 426 LVREAAIAGLIVKGGGHGMAAGITVERARLGELRAFFEERAAADVFRLQGEESLAIDGAL 485

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            A    ++L+D LE AGP+GAG+  PVFA P H+L   R V   H+++  +S+    +QA
Sbjct: 486 AAEGATLSLLDALEQAGPFGAGHVAPVFALPRHRLADARPVGTNHIRVELQSESGGRIQA 545

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR   T LGEFL ++RGK +HV G L  NYW G++  Q R+ DA+
Sbjct: 546 IAFRAVDTALGEFLFKNRGKTIHVAGSLSGNYWNGNRTVQFRITDAA 592


>gi|254486182|ref|ZP_05099387.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           GAI101]
 gi|214043051|gb|EEB83689.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           GAI101]
          Length = 579

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 247/588 (42%), Positives = 347/588 (59%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGV+ S++G RWV   G E    +  + Q+ ++P  + +VL  R V    A+ FL PS
Sbjct: 2   SFLGVDASLTGRRWVG-PGVEVERASEVLGQQTSLPPALCQVLARRGVGPAEAEGFLAPS 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D +KAA R + A+   ++I +F DYDVDG +S AL++ +L     +A 
Sbjct: 61  LRDLLPDPRSLRDMEKAATRFLAAVKARQRIAVFADYDVDGGSSAALLLVWLRDMGCSAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN   M         LI+ VDCG+ S+  +  A   G +VIV+DHH  
Sbjct: 121 LYVPDRIDEGYGPNDEAMAALAA-KHDLIVCVDCGTLSHGPIAAAV--GAEVIVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                 A+A+VNPNR D+     HLCAAGVVFL+LV   R LR+        DL++LLDL
Sbjct: 178 AETLPDAHAVVNPNRQDEDGALAHLCAAGVVFLMLVEAGRQLREAG--AKGPDLMALLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG+NRA+V +GL V  R+   GL AL +   + +  ++ +LG+++GP 
Sbjct: 236 VALATVADVAPLIGVNRAFVRQGLRVMARRDRLGLAALADAARMDTAPSSYHLGFLLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG+++LG+RLL   D  E   LA +LD LN  RR +E+A+   A  +   +  D
Sbjct: 296 INAGGRIGQADLGARLLACSDPHEAAALAERLDTLNTERRDVEAAVRAAALDQAEVRGFD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   GD WHPG+VG++A+RLKE   RPS  I F EDG G GSGRS+ G D+G  
Sbjct: 356 ---APLVWASGDGWHPGVVGIVASRLKEASNRPSIVIGF-EDGIGKGSGRSVSGIDLGAP 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV             +        L      ++DG+L 
Sbjct: 412 IQRLAAEGLLIKGGGHKMAAGLTVAEDKLEAAMARLSELLAKQGAHLGGAADLRLDGMLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
            +A  + L + +E AGP+GAG P P +AF + +++    V  +HL+++F       L AI
Sbjct: 472 PAAATVELAEQIEQAGPFGAGAPAPRYAFADMQIRYANRVGESHLKISFGDGSGTKLDAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AF  +  P+G  L    G R H+ G L +N WRG +  QLR+ DA+P 
Sbjct: 532 AFGAFDGPMGPALENHGGARFHLAGRLDINSWRGRQSVQLRLEDAAPA 579


>gi|254449696|ref|ZP_05063133.1| single-stranded-DNA-specific exonuclease RecJ [Octadecabacter
           antarcticus 238]
 gi|198264102|gb|EDY88372.1| single-stranded-DNA-specific exonuclease RecJ [Octadecabacter
           antarcticus 238]
          Length = 588

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 250/589 (42%), Positives = 340/589 (57%), Gaps = 10/589 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFL V  S +G RWV     E    A A+ Q  A+P  V R LV R ++   A  FL P+
Sbjct: 10  AFLDVAQSTTGRRWVG-PSVEDDRLAEAMAQDTALPLPVCRTLVRRGITAQDAASFLAPT 68

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R LMPDP  L D + AA RIV A  + +KI IF DYDVDG  S AL++ +L    V   
Sbjct: 69  LRDLMPDPRSLRDMEPAAARIVAAANSGQKIAIFADYDVDGGTSAALLIDWLRGFGVTPT 128

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN   M     +   LII VDCG+ S+  ++    +G DV+V+DHH  
Sbjct: 129 LYVPDRIDEGYGPNDDAMSTLARDH-DLIICVDCGTLSHGPIE--AAKGADVVVLDHHLG 185

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                PA A+VNPNR D+     HLCAAGVVFLVLV   R LR         DL+SLLDL
Sbjct: 186 GETLPPALAVVNPNRQDEAGDLAHLCAAGVVFLVLVEANRQLRDAG--SKTPDLMSLLDL 243

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VAL TV DV PLIG+NRA+V +GL V  R+   GL  L +   + +  ++ +LG+++GP 
Sbjct: 244 VALGTVADVAPLIGVNRAFVRQGLTVMARRQRVGLVTLADVARMDTAPSSYHLGFLLGPR 303

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG+++LG+RLL + D ++ + +A +LD LN  RR +E+ + E A  +   +  D
Sbjct: 304 INAGGRIGKADLGARLLATIDPRQAQSMAERLDELNTERREIENQVREMAIEQAEQRGTD 363

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
                ++   G+ WHPG+VG++AARLKE   RP+  I   +   G GSGRS+ G D+G  
Sbjct: 364 ---RPLVWAAGEGWHPGVVGIVAARLKEASNRPAIVIGL-DGDIGKGSGRSVFGIDLGAA 419

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV R       D   +         I     ++DG+L 
Sbjct: 420 IQRCAAEGLLIKGGGHKMAAGLTVARDKVDAAMDRLSELLAKQGANDIGPADLRVDGLLM 479

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + LI+++E AGP+GAG P P F FP+  +   +VV   HL++TF    S  + AI
Sbjct: 480 PGAATVDLINIMEQAGPFGAGAPAPRFVFPDCAINFTKVVGANHLKVTFGDGISARIDAI 539

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            F     P+G  L    G R H+ G L +N W+G +  QLR+ DA+P  
Sbjct: 540 CFGAMDGPIGPMLRDHGGARFHLAGRLEINTWQGRQSPQLRLEDAAPAT 588


>gi|254441408|ref|ZP_05054901.1| single-stranded-DNA-specific exonuclease RecJ [Octadecabacter
           antarcticus 307]
 gi|198251486|gb|EDY75801.1| single-stranded-DNA-specific exonuclease RecJ [Octadecabacter
           antarcticus 307]
          Length = 589

 Score =  453 bits (1164), Expect = e-125,   Method: Composition-based stats.
 Identities = 253/589 (42%), Positives = 341/589 (57%), Gaps = 10/589 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFL V  S +G RWV     E    A A+ Q  A+P  V R LV R V    A  FL P
Sbjct: 10  RAFLDVAQSATGRRWVG-PSVEDDRLAEAMAQDTALPLPVCRTLVRRGVVAQDAAAFLAP 68

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP  L D + AA RIV A +  ++I IF DYDVDG  S AL++ +L    V  
Sbjct: 69  TLRDLMPDPRSLRDMEPAAARIVAAAHGRQRIAIFADYDVDGGTSAALLIDWLRGFGVTP 128

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +Y+PDRI +GYGPN + M     +   LII VDCG+ S+  +  A  +G DV+V+DHH 
Sbjct: 129 TLYVPDRIDEGYGPNDNAMFALARDH-DLIICVDCGTLSHGPI--AAAKGADVVVLDHHL 185

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
                 PA A+VNPNR D+     HLCAAGVVFLVLV   R LR         DL++LLD
Sbjct: 186 GGEMLPPALAVVNPNRQDETGDLAHLCAAGVVFLVLVEANRQLRDAG--SKTPDLMALLD 243

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TV DV PLIG+NRA+V +GL V  R+   GL AL +   + +  ++ +LG+++GP
Sbjct: 244 LVALGTVADVAPLIGVNRAFVRQGLTVMARRQRVGLVALADVARMDTAPSSYHLGFLLGP 303

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            +NAGGRIG+++LG+RLL S D  E + +A +LD LN  RR +E+ + E A  +   +  
Sbjct: 304 RVNAGGRIGKADLGARLLASTDPHEAQSMAQRLDELNTERREIENQVREMAIEQAEQRGT 363

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           D     ++   G+ WHPG+VG++AARLKE   RP+  I   +   G GSGRS+ G D+G 
Sbjct: 364 D---RPLVWAAGEGWHPGVVGIVAARLKEASNRPAIVIGL-DGDTGKGSGRSVSGIDLGA 419

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +     EG+L+KGGGH MAAGLTV R       +   +         I     K+DGVL
Sbjct: 420 AIQRCTAEGLLIKGGGHKMAAGLTVARDKVDAAMERLSELLAKQGAGDIGPADLKVDGVL 479

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
              A  + LI+++E AGP+GAG P P F FP+  +   +VV   HL++TF    S  + A
Sbjct: 480 MPGAATVDLIEIMEQAGPFGAGAPAPRFVFPDCTINFTKVVGANHLKVTFGDGISGRVDA 539

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           I F     P+G  L    G R H+ G L +N W+G +  QLR+ DA+P 
Sbjct: 540 ICFGAMDGPIGPMLRDHGGARFHLAGRLEINTWQGRQSPQLRLEDAAPA 588


>gi|254561927|ref|YP_003069022.1| single-strand DNA-specific exonuclease RecJ [Methylobacterium
           extorquens DM4]
 gi|254269205|emb|CAX25171.1| putative single-strand DNA-specific exonuclease RecJ
           [Methylobacterium extorquens DM4]
          Length = 611

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 263/592 (44%), Positives = 355/592 (59%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGIN-RALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            + FL V  S  G  W    G  G+   A+ +TQ + +PD++ARVLV R V    A  +L
Sbjct: 18  PRPFLDVTASALGRPWRERCGDPGLQALAVTMTQAYGLPDLLARVLVGRGVRPAEADAYL 77

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP +L D + A  R+  A+   E + IFGDYDVDGA+S AL+  +L    V
Sbjct: 78  APRLRDLMPDPSVLVDMEAAVERLAHAVRGREAVAIFGDYDVDGASSAALLADYLRALGV 137

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DH
Sbjct: 138 PVRIHIPDRITEGYGPNVGAVTMLREEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDH 197

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLL 239
           H    E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR+D          L 
Sbjct: 198 HGAPEELPQTRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRRDGVFATSAEPRLT 257

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDLVALATV DVVPL GLNRA+VV+GL V R +G PGL AL++   +S P  A +LG+
Sbjct: 258 DFLDLVALATVADVVPLTGLNRAFVVQGLAVMRGRGRPGLAALLDAAGLSEPPEAWHLGF 317

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIGE+ LG+RLL + D  E   +A +LD LN+ R+ +E+  + +AEA++ 
Sbjct: 318 LVGPRINAGGRIGEAGLGARLLTTADPMEARRIADELDRLNRERQAIEAQAVAEAEAEMD 377

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                     V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G 
Sbjct: 378 AHLTRDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGA 437

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G  V  AVE G+ +KGGGHAMAAG+T+         +         V          I
Sbjct: 438 DLGGAVRGAVEAGLAIKGGGHAMAAGVTLPPGGLAAFGESLTHDLVEAVGRARAAEALLI 497

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A      L+ +++ AGP+G G P PV A P H++    +V   H++    S D +
Sbjct: 498 DGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRIVDAGIVGNGHVRARLVSGDGQ 557

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 558 AVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|163852181|ref|YP_001640224.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           extorquens PA1]
 gi|163663786|gb|ABY31153.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           extorquens PA1]
          Length = 611

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 264/592 (44%), Positives = 355/592 (59%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGIN-RALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            + FL V  S  G  W    G  G+   A+ +TQ + +PD++ARVLV R V    A  +L
Sbjct: 18  PRPFLDVTASALGRPWRERCGDPGLQALAVTMTQAYGLPDLLARVLVGRGVRPAEADAYL 77

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP +L D + A  R+  A+   E + IFGDYDVDGA+S AL+  +L    V
Sbjct: 78  APRLRDLMPDPSVLVDMEAAVERLAYAVRAREAVAIFGDYDVDGASSAALLAGYLRALGV 137

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DH
Sbjct: 138 PVRIHIPDRITEGYGPNVGAVTMLREEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDH 197

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLL 239
           H    E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR+D          L 
Sbjct: 198 HGAPEELPQTRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRRDGVFATSTEPRLT 257

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDLVALATV DVVPL GLNRA+VV+GL V R +G PGL AL++   +S P  A +LG+
Sbjct: 258 DFLDLVALATVADVVPLTGLNRAFVVQGLAVMRGRGRPGLAALLDAAGLSEPPEAWHLGF 317

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIG++ LG+RLL + D  E   +A +LD LN+ R+ +E+  + +AEA++ 
Sbjct: 318 LVGPRINAGGRIGDAGLGARLLTTTDPMEARRIADELDRLNRERQAIEAQAVAEAEAEMD 377

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                     V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G 
Sbjct: 378 AHLTRDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGA 437

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G  V  AVE G+ VKGGGHAMAAG+T+         D         V          I
Sbjct: 438 DLGGAVRGAVEAGLAVKGGGHAMAAGVTLPPGGLAAFGDSLTHDLVEAVGRARAAEALLI 497

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A      L+ +++ AGP+G G P PV A P H++    +V   H++    S D +
Sbjct: 498 DGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRIVDAGIVGNGHVRARLVSGDGQ 557

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 558 AVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|188582130|ref|YP_001925575.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           populi BJ001]
 gi|179345628|gb|ACB81040.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           populi BJ001]
          Length = 611

 Score =  452 bits (1162), Expect = e-124,   Method: Composition-based stats.
 Identities = 262/592 (44%), Positives = 359/592 (60%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGIN-RALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            + FL V  S+ G  W    G  G    A  +TQ + +PD++ARVLV R V    A+ +L
Sbjct: 18  PRPFLDVTASVLGRPWCERCGDPGQQALATTMTQAYGLPDLLARVLVGRGVGPAEAEAYL 77

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P +R LMPDP +L D + A  R+  A+ + E + IFGDYDVDGA+S AL+  +L    V
Sbjct: 78  SPRLRDLMPDPSVLVDMEAAVDRLAHAVRSREAVAIFGDYDVDGASSAALLADYLRALGV 137

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DH
Sbjct: 138 PVRIHIPDRITEGYGPNVGAVTALRGEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDH 197

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLL 239
           H    E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR +          L 
Sbjct: 198 HGAPEELPATRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRGEGVFASAAEPRLT 257

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDLVALATV DVVPL+GLNRA+V++GL V R +G PGL AL++   +S P  A +LG+
Sbjct: 258 DFLDLVALATVADVVPLVGLNRAFVMQGLAVMRARGRPGLAALLDAAGLSEPPEAWHLGF 317

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIG++ LG+RLL + DS E   +A +LD LN+ R+ +E+  + +AEA++ 
Sbjct: 318 LVGPRINAGGRIGDAGLGARLLTTADSMEARRIADELDRLNRERQAIEAQAVAEAEAEMD 377

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            +        V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G 
Sbjct: 378 ARLAGDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGA 437

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G  V  AV  G+ VKGGGHAMAAG+T+         +   +     V          I
Sbjct: 438 DLGGAVRDAVAAGLAVKGGGHAMAAGVTLPPGGLAAFGESLARDLTEAVGQARAAEALLI 497

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A      L+ +++ AGP+G G P PV A P H++    VV   H++    S D +
Sbjct: 498 DGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRVVDAGVVGNGHVRARLVSGDGQ 557

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 558 AVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|154248669|ref|YP_001419627.1| single-stranded-DNA-specific exonuclease RecJ [Xanthobacter
           autotrophicus Py2]
 gi|154162754|gb|ABS69970.1| single-stranded-DNA-specific exonuclease RecJ [Xanthobacter
           autotrophicus Py2]
          Length = 626

 Score =  452 bits (1162), Expect = e-124,   Method: Composition-based stats.
 Identities = 276/593 (46%), Positives = 371/593 (62%), Gaps = 4/593 (0%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           + ++ FL V  S +G  W   L   G   ALA+ Q+  I +++ARVL  R+V +D  + +
Sbjct: 32  LPNRLFLDVARSATGRTWRERLDVRGAQTALAMAQRTGISELLARVLAGRDVPLDGVEQY 91

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L+PSIR L+PDP  LTD   A  R+ +A+ + E++ +FGDYDVDGA + ALM+  L    
Sbjct: 92  LDPSIRTLLPDPDTLTDMGAAVARLSRAVTSGEQVAVFGDYDVDGACATALMVGVLRAAG 151

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           ++   +IPDRI +GYGPN   +E+    G  L++TVDCG+TS + L  A   G+D +VID
Sbjct: 152 LDPLFHIPDRIFEGYGPNVPAIEQLAARGVTLLVTVDCGTTSMEPLAAARRLGMDTVVID 211

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV---PLNFD 237
           HHQ       A A+VNPNR DDLSG GH+CAAG+ F+  V + R LRQ+          D
Sbjct: 212 HHQSGERLPDAAAIVNPNREDDLSGLGHVCAAGLAFITAVGLVRALRQNGHFNTARPAPD 271

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           LL  LDLVALATV DVVPL GLNRA+V KGL+  RR+G  GL AL++   +  P    +L
Sbjct: 272 LLDTLDLVALATVADVVPLKGLNRAFVTKGLLAMRRRGRIGLTALMDAARLDGPPRPFHL 331

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAK 357
           G++IGP INAGGRIGE+ LG++LL++ D  E   +A +LD LN  R+ +E A+L  AEA+
Sbjct: 332 GFLIGPRINAGGRIGEATLGAKLLLTQDPAEARQIAAELDRLNGERQEVERAILAAAEAE 391

Query: 358 VLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIE 417
                    + SVIVV GD WHPG+VGL+A+RLKE+F RP+FAI+F  +  G GSGRS+ 
Sbjct: 392 AEAALGLSDEGSVIVVSGDGWHPGVVGLVASRLKERFQRPAFAIAFNGE-TGTGSGRSLP 450

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVF 477
           G DIG+ V  A+E G+LVKGGGHAMAAGLTVER   G L   F++     V         
Sbjct: 451 GVDIGRAVRAALEAGLLVKGGGHAMAAGLTVERARLGALRAAFEERLAADVARARAEGTL 510

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            IDG L A      L++M+  AGP+GAGN  PVFAFP H++  +      H++    S D
Sbjct: 511 SIDGALTARGATTDLVEMVSRAGPFGAGNGEPVFAFPGHRISYVESFGAGHVRARISSPD 570

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             TL+A AFR    PLG  L+ +RG+ +HV G L ++ W+G  R  LR+ D +
Sbjct: 571 GTTLKATAFRCAEEPLGRALLAARGRPLHVAGSLELDTWQGETRVALRMRDVA 623


>gi|126727763|ref|ZP_01743594.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium HTCC2150]
 gi|126703019|gb|EBA02121.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium HTCC2150]
          Length = 582

 Score =  451 bits (1161), Expect = e-124,   Method: Composition-based stats.
 Identities = 235/585 (40%), Positives = 341/585 (58%), Gaps = 10/585 (1%)

Query: 9   VECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLL 68
           VE S++G RWV L     +  A A+ Q+  +   ++R+L  R V+ D +  FL PS+R L
Sbjct: 5   VENSLTGRRWVGLGTD-TVRAAEALAQQTGLSLPLSRILARRGVAADESTSFLAPSLRDL 63

Query: 69  MPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIP 128
           MPDP  + D +KAA R + A+  ++KI IF DYDVDG +S AL++ +L    + A +Y+P
Sbjct: 64  MPDPRSMLDMEKAAGRFLAAVKANQKIAIFADYDVDGGSSAALLVWWLRDFGIQATVYVP 123

Query: 129 DRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEE 188
           DRI +GYGPN + M +       L+I VDCG+ S+  +     +G DVIV+DHH      
Sbjct: 124 DRIDEGYGPNDAAMAELAA-THDLVICVDCGTLSHGPI--QATKGADVIVLDHHLGGETL 180

Query: 189 IPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALA 248
             A A+VNPNR D+     HLCAAGVVFL+LV   R  R       + DL++LLDLVALA
Sbjct: 181 PDALAVVNPNRQDETGDLAHLCAAGVVFLMLVEANRQRRVLG--EKSPDLMALLDLVALA 238

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAG 308
           TV DV PLIG+NRA+V +GL +   +  PGL AL +   + S  T+ +LG+++GP +NAG
Sbjct: 239 TVADVAPLIGVNRAFVRQGLKIMAARQRPGLVALADVARMDSAPTSYHLGFLLGPRVNAG 298

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GRIG ++LG+RLL +D+  E   +A +LD LN  RR +E+ + E A  +  ++      A
Sbjct: 299 GRIGAADLGARLLSTDNPHEAGAMAERLDQLNSERRAIENQVREGALEQAQSRDLA---A 355

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
            +I    D WHPG+VG++A+RLKE   RPS  I F E  +G GSGRS+ G D+G  +   
Sbjct: 356 PLIWAADDGWHPGVVGIVASRLKESTNRPSVVIGF-EGDEGKGSGRSVSGVDLGASIQKL 414

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
           V EG+L KGGGH MAAGL++ R       +   +         +       D +L  +A 
Sbjct: 415 VAEGLLTKGGGHKMAAGLSLTRAQLEPAMERLGELLAKQGAGELGPRDLHYDSILMPTAA 474

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRV 548
              LI+ +E+AGP+GA    P F FP+ ++   + V  +HL+ +F  +    L  IAF  
Sbjct: 475 TTDLIEQIENAGPFGASAAAPRFVFPDQRITFAKPVGESHLRFSFGDETGTRLDGIAFGA 534

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           + + +G  L  +     H+ G L +N W G ++ QLR+ DA+P +
Sbjct: 535 FDSEIGNSLQNAGHNLFHLAGRLELNTWGGRQKVQLRLEDAAPAD 579


>gi|114570056|ref|YP_756736.1| single-stranded-DNA-specific exonuclease RecJ [Maricaulis maris
           MCS10]
 gi|114340518|gb|ABI65798.1| exonuclease RecJ [Maricaulis maris MCS10]
          Length = 603

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 233/595 (39%), Positives = 337/595 (56%), Gaps = 10/595 (1%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
               LGV  S+SG RW      +G      + ++ +IPD +ARV+  R V+ D A  FL+
Sbjct: 12  SSPLLGVSRSLSGKRWRLREADDG--AVAMMARQQSIPDALARVMAARGVAPDQAAAFLS 69

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P +R   PDP    D DKAA  +  AI     + +F DYDVDGA S A ++R+  H    
Sbjct: 70  PRLRDSFPDPSDFADMDKAAGLVWDAIEAERPMAVFADYDVDGATSAAQLIRYFRHFDRT 129

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +Y+PDR+ +GYGP+ +  +     GA+L+ITVDCG+ +  AL +A + G+DVIVIDHH
Sbjct: 130 AEIYVPDRVEEGYGPSGTAFDTLKARGAELVITVDCGAAARIALTHAASIGLDVIVIDHH 189

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLS 240
            +  +  PA ALVNPNR DD SG GHL AAGV F+ L  + R  R+   +  +    LL 
Sbjct: 190 LMDDDMPPAAALVNPNRPDDRSGCGHLAAAGVTFVFLAALNREGRRRGTITPDNEPSLLD 249

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            +DL AL T+CDVVPL G+NRA   +GL       + GL+ L E   +    +  + G++
Sbjct: 250 WIDLAALGTICDVVPLTGVNRAITAQGLKAMSGWRHLGLRCLAETSGVDGEASTYHAGFL 309

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGR+G ++LG+ LL ++D      +A +LD LN  RR +E+ +LE A A++  
Sbjct: 310 IGPRINAGGRVGRADLGATLLTTEDETLARRIAGELDGLNSERRAIEADVLEAASAQLDG 369

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDG---KGIGSGRSIE 417
           Q  D    ++++  G+ WHPG++G++A RLKE+F +P   I  + +     G GSGRS+ 
Sbjct: 370 QSAD---RAILIAAGEGWHPGVIGVVAGRLKERFDKPVIVIGIDREARPPVGKGSGRSVP 426

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVF 477
           G ++G  ++ A E G+L  GGGHAMA GL+++      L  F  +     + A       
Sbjct: 427 GVNLGGAIAAAREAGLLTSGGGHAMAGGLSMDPDRITELVAFLDERLAPELAAAADDMAL 486

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
           K DGVL AS V++ L  MLE A P+G GN  P FA P+ ++   + V   H++ T    D
Sbjct: 487 KADGVLTASGVSLDLARMLERAAPFGQGNAEPRFALPDMRVSFAKRVGTDHVRFTLSDPD 546

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
              +  I FR   TP+GE L+ +     H  G L ++ W+G +R QL + D S  
Sbjct: 547 GRRVDGICFRCADTPIGEALLAAGPGLFHAFGRLKLDAWQGRERVQLHLEDLSTA 601


>gi|328544275|ref|YP_004304384.1| Single-stranded-DNA-specific exonuclease RecJ [polymorphum gilvum
           SL003B-26A1]
 gi|326414017|gb|ADZ71080.1| Single-stranded-DNA-specific exonuclease RecJ [Polymorphum gilvum
           SL003B-26A1]
          Length = 602

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 286/591 (48%), Positives = 376/591 (63%), Gaps = 3/591 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
             +  LGV  S SG  W           ALAI Q+  +PD++ARVL  R+V+   A+ FL
Sbjct: 6   TARPVLGVTRSASGQVWRERQTPAQGLAALAIAQRLDLPDVLARVLAARDVTAADAEGFL 65

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P+++ LMPDP  L D D+A  R+  A+    +I IFGDYDVDGA S A++ R+L    +
Sbjct: 66  DPTLKALMPDPSRLVDMDRAVARVADAVEAGTRIAIFGDYDVDGATSSAVLARYLRRLGL 125

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
           +  ++IPDRI++GYGPN   +E     GA L++TVDCGSTS++A   A   G+DV+VIDH
Sbjct: 126 DPAIHIPDRIIEGYGPNGPAIEALRAAGAGLLVTVDCGSTSFEAFDVARRLGLDVVVIDH 185

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLL 239
           HQ   E     ALVNPNR DDLSGQGHL A GV FL LV + R LR+          DLL
Sbjct: 186 HQCGVELPAVSALVNPNRQDDLSGQGHLAAVGVTFLFLVGLNRELRRRGTFRRGGEPDLL 245

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            LLDLVAL TVCDVVPL GLNRAYV KGL+    + NPGL +L +   +     A +LG+
Sbjct: 246 GLLDLVALGTVCDVVPLKGLNRAYVAKGLIAMHGRLNPGLASLADVARVGGKPAAYHLGF 305

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIG++ LG+RLL  DD QE   LA  LD LN  R+ ME+ MLE+ +A+ +
Sbjct: 306 LLGPRINAGGRIGDAALGARLLTCDDPQEARGLAETLDRLNAERQAMEAVMLEEGDAQAV 365

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            Q  D    +V+V     WHPGIVGL+A+RLKE   RP+FAI+++E GKG GSGRSI G 
Sbjct: 366 VQI-DTHDPAVLVTGSPGWHPGIVGLIASRLKEAHRRPAFAIAYDETGKGTGSGRSISGV 424

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G+ V  AV+EG+L KGGGHAMAAGLTV R     L  +F +   + V     T   KI
Sbjct: 425 DLGRAVRRAVDEGLLEKGGGHAMAAGLTVRREREADLVAYFNETLKDDVEVASATRELKI 484

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           D  L A+   + L+ +L+ AGPYGAG+P PVF FP H++    VV   H++ T  + D  
Sbjct: 485 DAALTAAGATLELMSLLDKAGPYGAGHPEPVFVFPAHRISYADVVGKGHVRATIAAPDGS 544

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +L+ I+F+    P GE L+ +RG+ MHV G L V+ W+G+ R QLR+LD +
Sbjct: 545 SLKGISFKAAERPHGEALLAARGRPMHVAGSLSVDTWQGAPRVQLRILDVA 595


>gi|163742989|ref|ZP_02150372.1| single-stranded-DNA-specific exonuclease RecJ [Phaeobacter
           gallaeciensis 2.10]
 gi|161383672|gb|EDQ08058.1| single-stranded-DNA-specific exonuclease RecJ [Phaeobacter
           gallaeciensis 2.10]
          Length = 580

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 240/588 (40%), Positives = 344/588 (58%), Gaps = 9/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S+SG RW+     E    A  + Q+ A+P  V +VL  R V    A  FL P 
Sbjct: 2   SFLGVETSLSGRRWIG-PDVEVARAAEMMEQQTALPAAVCQVLARRGVPSHEASGFLTPQ 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   E+I +F DYDVDG +S AL++ +L+   ++A 
Sbjct: 61  LKELLPDPRRMKDMEPAAARFLQAVERRERIAVFADYDVDGGSSAALLLVWLNQVGLSAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN + M         LI+ VDCG+ S+  +  A  +G DVIV+DHH  
Sbjct: 121 LYVPDRIDEGYGPNDAAMAALAR-EHDLIVCVDCGTLSHGPI--AAAKGADVIVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAAGVVFL+LV + R +R    +    DL++LLDL
Sbjct: 178 GETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVELRRQMRDKG-LGTGPDLMALLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLI  NRA V +GL V   +  PGL AL +   + S  +  +LG+++GP 
Sbjct: 237 VALATVADVAPLIEANRALVRQGLKVMATRQRPGLVALADVSRMDSAPSTYHLGFLLGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL + D  E E +A +LD LN  RR +E+A+   A  +   +  D
Sbjct: 297 VNAGGRIGKADLGARLLATSDPAEAEAIAARLDELNTERRDIENAVRAAALEQAEARGLD 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE  GRP+  I   +  +G GSGRS+ G D+G  
Sbjct: 357 ---APLVWAAGEGWHPGVVGIVASRLKEAAGRPAIVIGL-DGDEGKGSGRSVSGIDLGAS 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +  A  EG+L+KGGGH MAAGLTV R           +         +     K+DG+L 
Sbjct: 413 IQRAAAEGLLIKGGGHKMAAGLTVAREQLEPAMARLSELLAKQGAGDLGPSDLKLDGMLM 472

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + LI+ +E AGP+GAG P P + FP+ +++  + V  +HL+++     S  + AI
Sbjct: 473 PGAATVPLIEQIEQAGPFGAGAPAPRYGFPDLQVRFAKRVGESHLKLSLSDGLSSGIDAI 532

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            F  + T LG  L+   G R H  G L +N W G +  QLR+ DA+  
Sbjct: 533 CFGAFDTALGSRLLDHGGARFHFAGRLEINTWGGRQSVQLRLEDAAEA 580


>gi|89055493|ref|YP_510944.1| single-stranded-DNA-specific exonuclease RecJ [Jannaschia sp. CCS1]
 gi|88865042|gb|ABD55919.1| exonuclease RecJ [Jannaschia sp. CCS1]
          Length = 582

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 243/589 (41%), Positives = 340/589 (57%), Gaps = 11/589 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RW+     +    A  + Q+  +   VA +L  R V  D    FL P+
Sbjct: 4   SFLGVEASLTGRRWIG-PSDDVERLAQTLIQRADLDPAVAAILARRGVQPDDVASFLAPA 62

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP+ L D   AA R+V+A    ++I IF DYDVDG +S AL++ +L      A 
Sbjct: 63  LRDLLPDPMSLKDMAPAATRLVEAARKGKRIAIFADYDVDGGSSAALLIWWLRALGRQAT 122

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M      G  LII VDCG+ S+  +  A  +G DV+V+DHH  
Sbjct: 123 LYIPDRIDEGYGPNDEAMAALAR-GHDLIICVDCGTLSHGPI--AAAKGADVMVLDHHLA 179

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
            +E     A+VNPNR D+    GHLCAAGVVFLVLV   R +R+        DL+ LLDL
Sbjct: 180 TAELPECVAVVNPNRQDEDGASGHLCAAGVVFLVLVDANRRMREAG--EQGPDLMGLLDL 237

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG+NRA VV+GL V  R+  PGL AL +   +    T+ +LG+++GP 
Sbjct: 238 VALATVADVAPLIGVNRALVVQGLKVMARRQRPGLVALSDVGRLDRAPTSYHLGFVLGPR 297

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG ++LG+R L +DD  E   LA +LD LN +RR +E  + E A  +   +  +
Sbjct: 298 VNAGGRIGAADLGARCLSTDDMAEAVKLAAQLDTLNTDRREIEQRVREAALVQAEARGLE 357

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++    D WHPG+VG++A+RLK+   RP+  I F+ D    GSGRS+ G D+G  
Sbjct: 358 ---APLVWAAEDGWHPGVVGIVASRLKDHTRRPAIVIGFDGDDG-KGSGRSMAGVDLGAS 413

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG++ KGGGH MAAGL++ R       +   +               ++DG + 
Sbjct: 414 IQKLAAEGLIQKGGGHKMAAGLSLSRAQLEPAMERLTELLAKQGAGTGGPADLRLDGTIM 473

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
            SA    LI+ +E+AGPYGAG P P FA P  +++  R V   HL++T       T+ AI
Sbjct: 474 TSAATPELIEKIEAAGPYGAGAPAPRFALPALRIRHTRPVGETHLKLTLGDGGPVTIDAI 533

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            F    + L E L    G+ +HV G + +N+W+G  R QLR+ DA+  +
Sbjct: 534 CFDAVRSGLDE-LQAHNGRSVHVAGRVELNHWQGRTRVQLRLDDAAWAD 581


>gi|255037797|ref|YP_003088418.1| single-stranded-DNA-specific exonuclease RecJ [Dyadobacter
           fermentans DSM 18053]
 gi|254950553|gb|ACT95253.1| single-stranded-DNA-specific exonuclease RecJ [Dyadobacter
           fermentans DSM 18053]
          Length = 570

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 179/579 (30%), Positives = 281/579 (48%), Gaps = 18/579 (3%)

Query: 16  FRWVSLLG--QEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDP 72
            RW+       E    A ++ +   +   +A +LV R +   D ++DF  P IR L  DP
Sbjct: 4   KRWIHHPPFTSEQEQVAQSLAESLKVSPSLATLLVQRGILDFDQSRDFFRPDIRHLH-DP 62

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D +KA  R+++AI ++EKI+++GDYDVDG  SVAL   FL     N + YIPDR  
Sbjct: 63  FLMADMEKAVERLIKAIDSNEKILVYGDYDVDGTTSVALFYGFLKRIYPNLDYYIPDRYE 122

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   +E     G  LI+T+DCG  S D +  A  +GID I+ DHH+   E  PA 
Sbjct: 123 EGYGVSWQGVEWAHANGYTLIVTLDCGVKSVDKVTAALEKGIDFIICDHHRPGDELPPAA 182

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+++P R D L     L   GV F +L           +V     L   LDL+ ++   D
Sbjct: 183 AVLDPKREDCLYPYKELTGCGVGFKLLQAFCVK-----QVLDPETLYDYLDLLVVSIASD 237

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           +VP+ G NR     GL     Q   G+KALI+   ++  +   N+ + +GP INA GRI 
Sbjct: 238 IVPITGENRVLAFYGLQRLNAQPRTGIKALIQISGMTGALDITNVVFGLGPRINAAGRIK 297

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            +    RLL+S+  +E    A +++  N  RR  +S++ EQA   +         A   V
Sbjct: 298 HAKEAVRLLLSEIEEEAISFAEEINKHNSERRNFDSSITEQALFMIENDEW-FSNAKSTV 356

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WH G++G++A+R  EK+ RP+  ++    GK  GS RS+ GFD+ + +       
Sbjct: 357 LYKEDWHKGVIGIVASRCIEKYHRPTIILT-HSHGKAAGSARSVPGFDVYEAIEEC--AD 413

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L + GGH  AAGLT+   N       F +   + +      P+  +D +L   A+    
Sbjct: 414 LLEQYGGHTFAAGLTLPLDNVEAFKMRFNEIVSSRIQPDQLVPMINVDMLLELEAITPKF 473

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSETLQAIAFRVYGT 551
            ++L   GP+G GN  PVF   N  L     ++   H++   +  +S    A+ F +   
Sbjct: 474 YNILRQMGPFGPGNMTPVFESRNMTLVGRPMLMKEKHIKFDVKQNNSAVFTAVGFGMGHF 533

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
               +     G+   +   L  N++R  K  QL + D  
Sbjct: 534 ----YPDIVNGRPFSICYCLEENHFRDKKTLQLSLKDIK 568


>gi|163746061|ref|ZP_02153420.1| single-stranded-DNA-specific exonuclease RecJ [Oceanibulbus
           indolifex HEL-45]
 gi|161380806|gb|EDQ05216.1| single-stranded-DNA-specific exonuclease RecJ [Oceanibulbus
           indolifex HEL-45]
          Length = 579

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 248/586 (42%), Positives = 340/586 (58%), Gaps = 10/586 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RW+     E       + Q+  +PD V +VL  R V    A  FL P+
Sbjct: 2   SFLGVETSLTGRRWIG-PDVELTRATELLVQRAGLPDPVCQVLARRGVVDTEAAGFLAPA 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R ++A++  E+I IF DYDVDG +S AL++ +L      A 
Sbjct: 61  LRDLLPDPRSLRDMEAAATRFLEALHKRERIAIFADYDVDGGSSAALLLVWLRDMGHRAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M         LI+ VDCG+ S+  +  A  +G DVIV+DHH  
Sbjct: 121 LYIPDRIDEGYGPNDEAMSALAA-EHDLIVCVDCGTLSHGPI--AAAKGADVIVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                 A A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL+S+LDL
Sbjct: 178 GETLPDALAVVNPNRQDEDGTLAHLCAAAVVFLMLVEAGRQLRE--TSRKGPDLMSMLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           V LATV DV PLIG+NRA+V +GL V  R+  PGL AL +   + +  TA +LG+++GP 
Sbjct: 236 VGLATVADVAPLIGVNRAFVRQGLKVMARRARPGLAALADVARMDTAPTAYHLGFLLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG+++LG+RLL + D  E   LA +LD LN +RR +E+A+   A A+   +  D
Sbjct: 296 INAGGRIGQADLGARLLATADPNEAAALAERLDQLNTDRREVEAAVRASAMAQAEDRGFD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
                +    G  WHPG+VG++A+RLKE   RPS  I   EDG G GSGRSI G D+G  
Sbjct: 356 G---PLAWAAGPGWHPGVVGIVASRLKEASNRPSIVIGV-EDGIGKGSGRSISGIDLGAP 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV             +        L       + G++ 
Sbjct: 412 IQRLAAEGLLMKGGGHKMAAGLTVAEDKIEAAMKRLGELLSKQGAHLAGPADLNLCGMMM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + L +M++ AGP+GAG P P +AF + +++  + V   HL+++F       L+AI
Sbjct: 472 PGAATVELAEMVDQAGPFGAGAPAPRYAFADMQIRFAKRVGENHLKVSFGDGLGANLEAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           AF  Y  PLG  L    G R H+ G L +N +RG +  QLR+ DA+
Sbjct: 532 AFGAYDGPLGPALENHGGARFHLAGRLDINNFRGRRSVQLRLEDAA 577


>gi|114797921|ref|YP_760668.1| single-stranded-DNA-specific exonuclease RecJ [Hyphomonas neptunium
           ATCC 15444]
 gi|114738095|gb|ABI76220.1| single-stranded-DNA-specific exonuclease RecJ [Hyphomonas neptunium
           ATCC 15444]
          Length = 597

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 222/590 (37%), Positives = 326/590 (55%), Gaps = 9/590 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
            FLGVE S  G RW   L          +    A  D+VAR+L  R V+ + A  +L P+
Sbjct: 11  PFLGVERSAGGRRW--RLADVDETMVRRLMPAAAGSDLVARLLAGRGVTPETAPSYLAPT 68

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L PDP +  D DKAA  I+ AI   +++ +F DYDVDG  S A++ R+         
Sbjct: 69  LRDLFPDPSLFADMDKAAGIILDAIVAGKRVCVFADYDVDGGTSSAILARYFRAWGRELG 128

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDR+ +GYGP+P        +G  L+ITVDCG+ +  AL  A +  + V+V+DHH +
Sbjct: 129 LYVPDRLEEGYGPSPEAFRWLKAQGYDLVITVDCGAAAVRALDEAVSIDLPVVVLDHHLM 188

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLL 242
                   ALVNPNR D  SGQGHL AAGVVF+    + R+ RQ N  P     D+L  L
Sbjct: 189 SGHLPETAALVNPNRPDCTSGQGHLAAAGVVFVFAAAMNRLARQRNIAPPAGLPDILPYL 248

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DL AL T+CD+ PL G+NRA+V +GL +  R  N GL+AL +   I    +  +  +++G
Sbjct: 249 DLCALGTLCDMSPLTGVNRAFVRQGLTIMSRGENVGLRALADVSGIGEIDSVYHATFLLG 308

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P +NAGGR+G+  L ++LL +DD  E   LA +L  LN  RR +E+A+ ++A A+     
Sbjct: 309 PRLNAGGRVGDPWLAAKLLATDDRGEAIALAERLHTLNDERRAVEAAIQDEATAQAERAL 368

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE--DGKGIGSGRSIEGFD 420
                  +I+  G+ WHPG++G++A RLK++F  P+  I + E       GSGRS+ G +
Sbjct: 369 AANPDRGIIIAAGEGWHPGVIGIVAGRLKDRFHLPTIIIGWGEGLGPVAKGSGRSVTGVN 428

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  +S A  EGI++ GGGHAMA GL++E        D+                   ID
Sbjct: 429 LGDAISAAAREGIILSGGGHAMAGGLSLEPHQIAAFDDWMVAHMAQFTAERDAALDLHID 488

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
            VL+  +    L D++ + GP+G G P PVFA  +     +R +   HL+ T E+     
Sbjct: 489 AVLSPGSATTDLYDLIAALGPFGMGAPEPVFAMTDVMPTGVRRIGANHLRFTAENNTGR- 547

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           ++ IA+RV   P+G+ L    G+R+ + G L  + W G +R QL +LDA+
Sbjct: 548 IECIAWRVADEPMGDLLR--TGQRVGLAGRLKSDQWNGRRRVQLEILDAA 595


>gi|114771174|ref|ZP_01448594.1| single-stranded-DNA-specific exonuclease RecJ [alpha
           proteobacterium HTCC2255]
 gi|114548099|gb|EAU50986.1| single-stranded-DNA-specific exonuclease RecJ [alpha
           proteobacterium HTCC2255]
          Length = 582

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 231/588 (39%), Positives = 335/588 (56%), Gaps = 10/588 (1%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            +  FL VE SISG RW          +A  I Q+      +A VL    V  +  K+++
Sbjct: 1   MNDIFLDVESSISGRRWTGPNISVD-RQAEMILQETNFSSAMANVLARLGVEANQVKNYI 59

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            PS+R LMP+PL + D +KAA RI  A+ N E+I IF DYDVDGA S AL+  +L+    
Sbjct: 60  KPSLRDLMPNPLKILDMEKAASRINIAVNNHERIAIFADYDVDGATSGALLHDWLTQLGN 119

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              +Y+PDRI +GYGPN   ME   N    LII VDCG+ S++ +        D+I++DH
Sbjct: 120 IPTLYVPDRIEEGYGPNIVAMETLAN-VHDLIICVDCGTLSHETIN--KITNTDIIILDH 176

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSL 241
           H        AYA+VNPNR D+     +LCAAGVVFL LV    I R +N      DLL++
Sbjct: 177 HLGGETLPNAYAVVNPNRQDEKGDLYYLCAAGVVFLTLVAANSIRRNNN--KSTPDLLNM 234

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVAL TV DV PLIG NRA V +GL V  ++   G+ AL +   +++  +  +LGY++
Sbjct: 235 LDLVALGTVADVAPLIGFNRALVRQGLKVMAKRERIGITALSDIAKMNNAPSPYHLGYLL 294

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGR+G+++LG RLL   +  E   +A KL+ LN  RR +E+ +  QA  +V   
Sbjct: 295 GPRINAGGRVGKADLGIRLLTCKNFDEANSIADKLNQLNDERRSIEATVQIQALEQVEKM 354

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                 +++    G+ WHPG+VG++A+R+KE   +P+  I  +E  +G GSGRSI G D+
Sbjct: 355 ---DSNSALAWAAGEGWHPGVVGIVASRIKEITNKPTVVIGLDEH-EGKGSGRSISGIDL 410

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G  ++    E ++++GGGH MAAGL++ER           +   N       T   ++DG
Sbjct: 411 GSSIATLQRENLIIRGGGHKMAAGLSLEREKLEIAMSRLNELLANQGSKSFQTRELQLDG 470

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            L+  A+ I L++ LE+AGP+GAG P P FA P  ++   +    +HL++        ++
Sbjct: 471 ALSLPAITIELLEQLETAGPFGAGAPGPKFALPFMRITFAKRAGESHLRLRLVDDSGASI 530

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
            AIAF  + + LG+ L   +G+  HV G L ++ W G  R +L + DA
Sbjct: 531 DAIAFGAFKSDLGKTLENHKGQIFHVAGRLEIDTWNGRMRPKLNLEDA 578


>gi|163738625|ref|ZP_02146039.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Phaeobacter
           gallaeciensis BS107]
 gi|161387953|gb|EDQ12308.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Phaeobacter
           gallaeciensis BS107]
          Length = 580

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 240/588 (40%), Positives = 344/588 (58%), Gaps = 9/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S+SG RW+     E    A  + Q+ A+P  V +VL  R V    A  FL P 
Sbjct: 2   SFLGVETSLSGRRWIG-PDVEVARAAEMMEQQTALPAAVCQVLARRGVPSHEASGFLTPQ 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R +QA+   E+I +F DYDVDG +S AL++ +L+   ++A 
Sbjct: 61  LKELLPDPRRMKDMEPAAARFLQAVERCERIAVFADYDVDGGSSAALLLVWLNQVGLSAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN + M         LI+ VDCG+ S+  +  A  +G DVIV+DHH  
Sbjct: 121 LYVPDRIDEGYGPNDAAMAALAR-EHDLIVCVDCGTLSHGPI--AAAKGADVIVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAAGVVFL+LV + R +R    +    DL++LLDL
Sbjct: 178 GETLPDCVAVVNPNRQDEDGDLGYFCAAGVVFLMLVELRRQMRDKG-LGTGPDLMALLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLI  NRA V +GL V   +  PGL AL +   + S  +  +LG+++GP 
Sbjct: 237 VALATVADVAPLIEANRALVRQGLKVMATRQRPGLVALADVSRMDSAPSTYHLGFLLGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL + D  E E +A +LD LN  RR +E+A+   A  +   +  D
Sbjct: 297 VNAGGRIGKADLGARLLATSDPAEAEAIAARLDELNTERRDIENAVRAAALEQAEARGLD 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE  GRP+  I   +  +G GSGRS+ G D+G  
Sbjct: 357 ---APLVWAAGEGWHPGVVGIVASRLKEAAGRPAIVIGL-DGDEGKGSGRSVSGIDLGAS 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +  A  EG+L+KGGGH MAAGLTV R           +         +     K+DG+L 
Sbjct: 413 IQRAAAEGLLIKGGGHKMAAGLTVARDQLEPAMARLSELLAKQGAGDLGPSDLKLDGMLM 472

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + LI+ +E AGP+GAG P P + FP+ +++  + V  +HL+++     S  + AI
Sbjct: 473 PGAATVPLIEQIEQAGPFGAGAPAPRYGFPDLQVRFAKRVGESHLKLSLSDGLSSGIDAI 532

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            F  + T LG  L+   G R H  G L +N W G +  QLR+ DA+  
Sbjct: 533 CFGAFDTALGSRLLDHGGARFHFAGRLEINTWGGRQSVQLRLEDAAEA 580


>gi|83951463|ref|ZP_00960195.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius
           nubinhibens ISM]
 gi|83836469|gb|EAP75766.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius
           nubinhibens ISM]
          Length = 579

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 234/586 (39%), Positives = 342/586 (58%), Gaps = 10/586 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLG+  S++G RW+    +     A A+ Q   +P  + ++L  R V    A+ FL P 
Sbjct: 2   SFLGIAQSLTGRRWIGPTTEID-RLAEAMAQTTDLPRALCQILARRGVEPQEAESFLTPQ 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR L+PDP  L D + AA+R + A+   E+I IF DYDVDG +S AL++ +L      A 
Sbjct: 61  IRDLLPDPRGLKDMEAAAQRFLLAVQRGERIAIFADYDVDGGSSAALLIDWLRQMGRAAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN + M +  +    LII VDCG+ S+  +  A  +  DV+++DHH  
Sbjct: 121 LYVPDRIDEGYGPNDAAMAELAS-THDLIICVDCGTLSHGPV--AAAKDADVVILDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                 A A+VNPNR D+     HLCAA VVFL+LV   R LR+  +     DL+++LDL
Sbjct: 178 GETLPEAVAVVNPNRQDEDGALAHLCAAAVVFLMLVEAGRQLREAGQ--KGPDLMAMLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PLIG+NRA+V +GL V  R+  PGL AL +   +  P  A +LG+++GP 
Sbjct: 236 VALATVADVAPLIGVNRAFVRQGLRVMARRERPGLVALADAARLDRPPAAYHLGFVLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL +D+  E   LA +L+ LN+ RR +E+ +   A  +   +  D
Sbjct: 296 VNAGGRIGQADLGARLLSTDNPAEARALADRLEELNRERRDVEAQVRAAALDQAEARGLD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   GD WHPG+VG++A+RLKE   RP+  I   +  +G GSGRSI G D+G  
Sbjct: 356 ---APLVWAAGDGWHPGVVGIVASRLKEAANRPAIVIG-FDGDEGKGSGRSISGVDLGAS 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV R           +               ++DG+L 
Sbjct: 412 IQKLAAEGLLIKGGGHKMAAGLTVARDQLDAAMARLSELLDKQGAGAAGAADLRLDGLLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A    LID ++ AGP+GAG   P + F + ++   + +  +HL++ F      +L+AI
Sbjct: 472 PGAATPELIDQIDGAGPFGAGASAPRYVFSDMQISFAKRIGESHLKLRFGDGMGASLEAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +F  +  PLG  L +  G R H+ G L +N+W G +  QLR+ DA+
Sbjct: 532 SFAAFDGPLGPVLSEHGGARFHLAGRLEINHWGGRQSVQLRLEDAA 577


>gi|73667504|ref|YP_303520.1| RecJ exonuclease [Ehrlichia canis str. Jake]
 gi|72394645|gb|AAZ68922.1| exonuclease RecJ [Ehrlichia canis str. Jake]
          Length = 584

 Score =  449 bits (1154), Expect = e-124,   Method: Composition-based stats.
 Identities = 229/579 (39%), Positives = 335/579 (57%), Gaps = 15/579 (2%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           ++G  W        +   L I QK  + +I ARVL  R +SI+   DFL P+++  +PDP
Sbjct: 14  VTGALW--KPHNVNLRDILTIKQKFCLSEIAARVLSTRKISIEEIHDFLYPTLKASLPDP 71

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             L D DKA  RI +AIYN EKI++FGDYDVDGA S AL+ ++L+   V   +YIPDRI 
Sbjct: 72  FHLLDMDKAVNRICEAIYNKEKIVVFGDYDVDGATSSALIKQYLTQIGVPTTIYIPDRIC 131

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN   + K    G  L ITVDCG+ +++ +  A +  +DVIVIDHH   +    A 
Sbjct: 132 EGYGPNTQALLKLKEIGNSLCITVDCGTIAHEPISAAKSVNLDVIVIDHHIGMNTLPDAI 191

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATV 250
           A++NPNRLD+ S   +L   GV FL+L+ + + L++      N   +L++ LDLVAL TV
Sbjct: 192 AVINPNRLDENSPYTYLAGVGVSFLMLIALNKTLKEKGFFTNNTEPNLINYLDLVALGTV 251

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
           CDV+P+IGLNRA+V +GL +   + N GLK L + + +        LG+ IGP INAGGR
Sbjct: 252 CDVMPIIGLNRAFVKQGLKIIATRQNIGLKVLSDVIGLEEKPNVYQLGFSIGPHINAGGR 311

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G ++LG+RLL S++ +E   ++ KL   N  R+ +E     +A  +  T          
Sbjct: 312 VGNASLGARLLSSNNEEEALEISEKLQNFNLERKELEHQSFNEAVEQAETLMSTNTN--- 368

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           +++    WHPGI+G++A RLK+KF  PS  IS   +G G  S RSI   D+G  +  A  
Sbjct: 369 LIIVAGNWHPGIIGIVAGRLKDKFFLPSIVIS-LNNGIGKASARSIPDVDLGAAILSAKL 427

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           EGI+ +GGGHAMAAG ++       L +F  +  HNI        VFK+DGV+ ASA+N+
Sbjct: 428 EGIITEGGGHAMAAGFSINEDKIKTLYEFLSQRFHNINK----QKVFKVDGVITASAINL 483

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYG 550
            L   L+   P+G GNP P F   N K+++  ++  +H++      +   ++ I FR   
Sbjct: 484 TLWKELQFLEPFGIGNPEPKFILTNIKIKNPEIIGDSHIRC-LIYDNKTFIKGICFRCVD 542

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           T LG  L++     + + G + VNYWRG++  Q  + DA
Sbjct: 543 TELGLALLERTA--VMLLGKISVNYWRGNENIQFIIEDA 579


>gi|299133805|ref|ZP_07026999.1| single-stranded-DNA-specific exonuclease RecJ [Afipia sp. 1NLS2]
 gi|298591641|gb|EFI51842.1| single-stranded-DNA-specific exonuclease RecJ [Afipia sp. 1NLS2]
          Length = 613

 Score =  449 bits (1154), Expect = e-124,   Method: Composition-based stats.
 Identities = 273/602 (45%), Positives = 375/602 (62%), Gaps = 3/602 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
              AFLGV  S +G  W   L   G  +ALAI Q++ +P+++AR++  R + ID  +DFL
Sbjct: 12  TPHAFLGVARSATGKLWRDRLDARGAAQALAIVQRYQLPEMLARIIAGRGIDIDAVEDFL 71

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P+IR L+PDP  +T  + AA+RI  A    E + IFGDYDVDGA S AL+   L HC +
Sbjct: 72  DPTIRKLLPDPSTVTQMEAAAKRIADAATRGEMVAIFGDYDVDGATSAALLAWHLRHCGL 131

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
           +  ++IPDRI +GYGPN   +      GA+L++TVDCG+TS + L  A   G+DV+VIDH
Sbjct: 132 DPLIHIPDRIFEGYGPNVEAIRSLSLRGAKLLVTVDCGTTSLEPLAEARKLGMDVVVIDH 191

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDL 238
           HQ   E     ALVNPNR DDLSG GHL A G+VF+ LV + R LR  N         +L
Sbjct: 192 HQCGDELPVVNALVNPNRPDDLSGLGHLAAVGLVFVTLVAVNRELRVRNFWTAERPEPNL 251

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           L +L  VAL TV DV PL+GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG
Sbjct: 252 LDMLHHVALGTVADVAPLLGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLG 311

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RRL+E A  +QAEA+ 
Sbjct: 312 FMLGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNVERRLIEQAAEQQAEAEA 371

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           L       + SVIV   + WHPG+VGL+A+RLKEKF RP+FA++ E  G G GSGRSI G
Sbjct: 372 LASLGLEDKGSVIVTASEGWHPGVVGLVASRLKEKFSRPAFAVALEPGGIGTGSGRSIAG 431

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+GK V  AV EG+L+KGGGHAMAAG+T+++        + ++     V          
Sbjct: 432 VDLGKAVREAVSEGLLMKGGGHAMAAGVTLKKDRLAEFRAYLEQRLAEDVAKARHVDELF 491

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           IDG ++A AV    ++ L  AGP+G GNP P+ A P+H+L     V  AH+++  +S D 
Sbjct: 492 IDGAVSARAVTTDFVETLNRAGPFGTGNPEPMIALPSHQLVYADEVGGAHMRVRLKSGDG 551

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFA 598
             +  IAFR  G  LG  L ++RG+ +HV G L ++ W+G++R QLR+ D +  E    +
Sbjct: 552 AMVNGIAFRSVGQKLGNALAENRGQVVHVAGSLSIDRWQGAERVQLRISDIAVPEREPVS 611

Query: 599 KK 600
            +
Sbjct: 612 IR 613


>gi|126729046|ref|ZP_01744860.1| single-stranded-DNA-specific exonuclease RecJ [Sagittula stellata
           E-37]
 gi|126710036|gb|EBA09088.1| single-stranded-DNA-specific exonuclease RecJ [Sagittula stellata
           E-37]
          Length = 581

 Score =  448 bits (1153), Expect = e-123,   Method: Composition-based stats.
 Identities = 241/588 (40%), Positives = 342/588 (58%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           A+LGV+ S+SG RWV     E   +A  + Q+  +   +  +L    V  + A+ +L P 
Sbjct: 2   AYLGVKNSLSGRRWVG-PDVETERQAELLAQQTGLARPLCAILARLGVPPEEAQPYLEPR 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D + AA R ++A+   E+I +F DYDVDG +S AL++ +L      A 
Sbjct: 61  LRDLLPDPRSLKDMETAATRFLKAVSGRERIAVFADYDVDGGSSAALLIDWLRQMGRPAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPNP+ M     +   LI+ VDCG+ S+DA+  A  +G DV+V+DHH  
Sbjct: 121 LYVPDRIDEGYGPNPTAMAALARDH-DLIVCVDCGTLSHDAI--AAAKGADVVVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL+ +LDL
Sbjct: 178 GETLPACVAVVNPNRQDEDGELAHLCAAAVVFLMLVEAGRQLREAG--ARGPDLMKMLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL G+NRA V +GL V  R+   GL AL +   +     + +LG+++GP 
Sbjct: 236 VALATVADVAPLRGVNRALVQQGLKVMGRRERVGLVALSDVARLERAPESYHLGFVLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL SD+  E + +A +L+ LN  RR +E+A+   A A+   +  D
Sbjct: 296 VNAGGRIGQADLGARLLASDNPAEAQAMAERLEALNAERREIEAAVRAAALAQAEARGLD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A +I   G+ WHPG+VG++A+RLKE  GRPS  I  +   +G GSGRS+ G D+G  
Sbjct: 356 ---APLIWAAGEGWHPGVVGIVASRLKEHTGRPSIVIGLDGA-EGKGSGRSVAGVDLGAS 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           V     EG+L+KGGGH MAAGLTV R           +               ++DGVL 
Sbjct: 412 VQRLAAEGLLIKGGGHRMAAGLTVARDRLEEAMARLSELLEKQGAGSGGASDLRVDGVLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + L++ LE AGP+G G P P F  P+ +L   +VV   HL++T        L+AI
Sbjct: 472 PGAAQVDLVEDLERAGPFGQGAPGPRFVVPDVRLSFAKVVGAGHLKITCGDGLGARLEAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            F     PLG+ L+  +G+R H+ G L VN W+G    Q+R+ DA+P 
Sbjct: 532 CFNAMDGPLGQTLLNHQGRRFHLAGKLDVNTWQGRHTVQMRLDDAAPA 579


>gi|88607079|ref|YP_505704.1| single-stranded-DNA-specific exonuclease RecJ [Anaplasma
           phagocytophilum HZ]
 gi|88598142|gb|ABD43612.1| single-stranded-DNA-specific exonuclease RecJ [Anaplasma
           phagocytophilum HZ]
          Length = 585

 Score =  448 bits (1153), Expect = e-123,   Method: Composition-based stats.
 Identities = 215/580 (37%), Positives = 328/580 (56%), Gaps = 13/580 (2%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           +SG  W            L I QK  + +IVA VL  + + +D  +DFL P+++LL+PDP
Sbjct: 15  VSGAVWKV--HNATYRDVLTIKQKFGLSEIVAHVLAIKRIPLDDIRDFLFPTLKLLLPDP 72

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             L D  KA  RI++AIY  E+I+IFGDYDVDGA S A++ R+       A +YIPDR+ 
Sbjct: 73  FHLLDMGKAVDRILKAIYEKERIVIFGDYDVDGATSSAMLKRYFKSIGATAEVYIPDRLK 132

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPNP  + K   +G  L ITVDCG+ +++ +  A   G+DVIV+DHH        A 
Sbjct: 133 EGYGPNPEALIKLRKKGCSLCITVDCGTVAHEPISVARAAGLDVIVVDHHIGSPTLPDAT 192

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLLSLLDLVALATV 250
           A++NPNRLD+ S   +L   G  F++L+ + + LRQ          +L++ LDLVAL TV
Sbjct: 193 AIINPNRLDETSTYTYLSGVGTSFMLLIALNKTLRQAGYFQQENEPNLMNYLDLVALGTV 252

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
           CDV+P++ LNRA+V +GL V   +GN GL+ L + + I    +  +LG+ IGP INAGGR
Sbjct: 253 CDVMPMLKLNRAFVKQGLKVMSERGNMGLRTLADAIGIEEKPSVYHLGFCIGPHINAGGR 312

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           IG S+LG+RLL S+D+ E   +   L  LN  R+ +E+  L +A A+     D+ +    
Sbjct: 313 IGNSSLGARLLSSNDAIECNKIVTMLLDLNNERKEIENRSLAEALAQAELLVDEGKN--- 369

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           I++    WH G++G++A R+KE+F  P+  IS  +   G  S RS+ G DIG  V  A  
Sbjct: 370 IIMVTGNWHVGVIGIIAGRIKERFFLPTIVIS-LDGDMGKASARSVAGIDIGAAVLSAKF 428

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           E ++ +GGGH MAAG +V R     L      F       +         G+L+ + ++ 
Sbjct: 429 EKLIPEGGGHEMAAGFSVHRSQIEPLYK----FFLERFKDVNIQKALHASGILSTAGISS 484

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYG 550
           AL   L+   P+G GNP P F   N ++++  ++  +H++   +     +++ + F+  G
Sbjct: 485 ALCRELQLLEPFGPGNPEPKFVLRNVRIKNPAIIGESHIKCLIDDGSGASVRGMCFKCVG 544

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           T L   L+Q  G  +H+ G + +N WRG++  Q  + D +
Sbjct: 545 TELALGLLQG-GIAVHLLGKVSMNQWRGNEYVQFIIDDLA 583


>gi|148263783|ref|YP_001230489.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter
           uraniireducens Rf4]
 gi|146397283|gb|ABQ25916.1| exonuclease RecJ [Geobacter uraniireducens Rf4]
          Length = 573

 Score =  448 bits (1152), Expect = e-123,   Method: Composition-based stats.
 Identities = 188/580 (32%), Positives = 287/580 (49%), Gaps = 18/580 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRN-VSIDYAKDFLNPSIRLLMPDPLI 74
            RW              + +      ++AR+LVNR  +    A  FL  S+     DP +
Sbjct: 7   KRWKVR--DCDPVDVERLVKGGVASPLLARLLVNRAVIEPAAASRFLTSSLAQFH-DPFL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L   ++A  R+  A+   EK+ + GDYDVDG  SVAL++ F     ++A  YIPDR+VDG
Sbjct: 64  LLGMERAVDRLAAAVKKGEKVCVHGDYDVDGITSVALLLSFFRSIGLDAIYYIPDRLVDG 123

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   + +    GAQ+++TVDCG T+       +  GID+IV DHH        AYA+
Sbjct: 124 YGLSADGVARAATLGAQVMVTVDCGITAVAEATLCSAAGIDLIVTDHHMPGDSLPEAYAV 183

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLDLVALATVCD 252
           +NP +         L   GV F +++ +   LR++         +L   LDLVAL TV D
Sbjct: 184 INPLQPGCTFPFKSLAGVGVAFNLMIALRSRLREEGFFAGKEEPNLREYLDLVALGTVAD 243

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           VVPL   NR  V  GL        PG++AL +   ++  +    +G+ + P +NA GR+ 
Sbjct: 244 VVPLTDENRILVKHGLRELTNSQRPGVQALKDVAGVNGDVGCGAVGFRLAPRLNAAGRLE 303

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            + +G  LL+  D ++ E LA  LD  N  R+ +E  +L  A A V  +   ++    IV
Sbjct: 304 NAAMGVELLLCGDRKKAEPLAAALDASNAERQAVEREILNDALAMV-KETPALRNRKSIV 362

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WHPG++G++A+RL + F RP+  I+ ++ G G GSGRSI  F +   ++      
Sbjct: 363 LASEAWHPGVIGIVASRLVDMFHRPTILIALKD-GNGKGSGRSIANFHLHDALNVCF--D 419

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
            L+K GGH  AAGL++           F + A  ++ A   TP+  IDG L AS +   L
Sbjct: 420 HLIKFGGHKHAAGLSIAEETLEAFVARFDEVAAGLLTAEDLTPLLLIDGELEASEITSEL 479

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
           +D LE+  P+G GNP PVF   + ++   R +   HL+M   +    +  AI F + G  
Sbjct: 480 VDGLETMKPFGMGNPEPVFLLRDAEVSDCRTLKETHLKMRL-NAGCRSFDAIGFSLAGR- 537

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
                  ++G R+ V     +N W G    QL + D    
Sbjct: 538 ------AAQGDRLDVVFTPAINVWNGRSSLQLTIKDLRKA 571


>gi|126738787|ref|ZP_01754483.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           SK209-2-6]
 gi|126719968|gb|EBA16675.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           SK209-2-6]
          Length = 581

 Score =  448 bits (1152), Expect = e-123,   Method: Composition-based stats.
 Identities = 237/588 (40%), Positives = 342/588 (58%), Gaps = 9/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RW    G +    A  + Q+  +P  + +VL  R V    A  FL P 
Sbjct: 3   SFLGVETSLTGRRWTG-PGVDLERAAEHMQQQTGLPAPLCQVLARRGVPPHEAMGFLTPQ 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R ++A+   ++I IF DYDVDG +S AL++ +L    + + 
Sbjct: 62  LKELLPDPRRMKDMEAAAARFLEAVEKRQRIAIFADYDVDGGSSAALLIVWLRAMGLQST 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN + M     +   LII VDCG+ S+  +  A  +G DV+V+DHH  
Sbjct: 122 LYIPDRIDEGYGPNEAAMAGLARDH-DLIICVDCGTLSHGPI--AAAKGADVVVLDHHLG 178

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAAGVVFL+LV   R  R    +    DLLSLLDL
Sbjct: 179 GETLPDCVAVVNPNRQDEEGDLGYFCAAGVVFLMLVETRRQARGKG-LGAGPDLLSLLDL 237

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL G NRA V +GL V   +  PGL AL +   + +  +A +LG+++GP 
Sbjct: 238 VALATVADVAPLTGANRALVRQGLKVMAGRQRPGLVALADVSRMDTAPSAYHLGFLLGPR 297

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL +D+  E   LA +LD LN  RR +E+A+   A  +   +  D
Sbjct: 298 VNAGGRIGKADLGARLLATDNPHEAAALAERLDQLNSERRDIENAVRAAALEQAEARGFD 357

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE  GRP+  I   + G+G GSGRS+ G D+G  
Sbjct: 358 ---APLVWAAGEGWHPGVVGIVASRLKEATGRPAVVIGLND-GEGKGSGRSVTGIDLGAA 413

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLT+   N     +   +         +     K++G+L 
Sbjct: 414 IQRTAAEGLLLKGGGHKMAAGLTLAEENLEPAMERLAELLAKQGAGDLGPSDLKLEGMLM 473

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + LI+ +E AGP+GAG P P +A P+ +++  + V  +HL+++        + AI
Sbjct: 474 PGAATVDLIEQIEQAGPFGAGAPAPRYALPSLEVRFAKQVGESHLKLSLSDGLGGKIDAI 533

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            F  + TPLG  L+   G R H  G L VN W G +  QLR+ DA+  
Sbjct: 534 CFGAFDTPLGSRLLNHGGARFHFAGRLEVNTWGGRQSAQLRLEDAAEA 581


>gi|89069140|ref|ZP_01156513.1| probable single-stranded DNA-specific exonuclease [Oceanicola
           granulosus HTCC2516]
 gi|89045313|gb|EAR51379.1| probable single-stranded DNA-specific exonuclease [Oceanicola
           granulosus HTCC2516]
          Length = 591

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 248/589 (42%), Positives = 342/589 (58%), Gaps = 10/589 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFL V  S++G RWV            A+ Q   + D VARVLV  NV+ + A  +L+P
Sbjct: 13  EAFLSVATSVTGRRWVGPAPGAD-RLTEALVQATGLADPVARVLVRLNVAPETATAYLSP 71

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R L+PDPL L D   AA R +QA+  +E+I IF DYDVDG AS AL++ +L      A
Sbjct: 72  ALRDLLPDPLTLRDMHAAAARFLQAVARNERIAIFADYDVDGGASAALLLTWLRAMGRRA 131

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M         LI+ VDCG+ S++ +  A   G DV+++DHH 
Sbjct: 132 TLYIPDRIDEGYGPNVPAMRALAR-EHDLIVCVDCGTLSHEPVAAAE--GADVVILDHHL 188

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
                  A A+VNPNR D+    GHLCAA VVFL+LV   R LR+        +LL  LD
Sbjct: 189 GGETLPAALAVVNPNRQDEDGALGHLCAAAVVFLMLVEAGRQLREQG--AKGPNLLEFLD 246

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PLIG+NRA V +GL V  ++  PGL AL +   + +  T+  LGY+ GP
Sbjct: 247 LVALATVADVAPLIGVNRALVRQGLAVMAQRRRPGLVALADVARLDTAPTSYTLGYVFGP 306

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            +NAGGRIG ++LG+RLL +DD  E   LA +LD LN  RR +E+A+ + A  +   +  
Sbjct: 307 RVNAGGRIGAADLGARLLATDDPHEAAALAQRLDALNTERREIEAAVRDAALEQAEGRGL 366

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           D     ++   G+ WHPG+VG++AARLKE  GRP+  I   +  +G GSGRS+ G D+G 
Sbjct: 367 DG---PLVWAAGEGWHPGVVGIVAARLKEATGRPAVVIGL-DGDEGKGSGRSVGGIDLGA 422

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +     EG+L+KGGGH MAAGLTV R           +         +     ++DG+L
Sbjct: 423 AIHKVAGEGLLLKGGGHRMAAGLTVARDRLEPAMTRLSELLARQGAGRLGPADLRLDGLL 482

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
              A  + L + LE  GP+G G P P FAFP  ++   R V   HL++ F+      + A
Sbjct: 483 MPGAATVELCESLERCGPFGQGAPAPRFAFPGVRITQAREVGTGHLKVRFDDGFGGGIDA 542

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           IAF     P+G+ L+Q  G R H+ G L +N W+G +R Q+++ DA+P 
Sbjct: 543 IAFNALEGPMGQCLVQHGGARFHLAGRLEINVWQGRQRVQVKLEDAAPA 591


>gi|84687257|ref|ZP_01015137.1| single-stranded-DNA-specific exonuclease RecJ [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664690|gb|EAQ11174.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacterales
           bacterium HTCC2654]
          Length = 582

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 237/586 (40%), Positives = 340/586 (58%), Gaps = 8/586 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFL V+ S++G RW    G E   +A A+ Q   +P  V  VL  R V  D A  FL P+
Sbjct: 3   AFLDVDNSLTGRRWTG-PGVELERQAEALVQATGLPAPVCAVLARRGVQADEAAGFLAPT 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR  +PDP  + D D+AA R++ A+  +E++ +F DYDVDG +S AL++ ++     +  
Sbjct: 62  IRDTLPDPRSMRDMDRAAARLLAAVDKNERVAVFADYDVDGGSSAALLIDWMRRMGRDIT 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   ME        LI+ VDCG+ S++ +  A  +G +V+V+DHH  
Sbjct: 122 LYIPDRIDEGYGPNVPAMEALAE-THSLIVCVDCGTLSHEPIAAANAKGAEVVVLDHHLG 180

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                PA A+VNPNR D++   G+LCAAGVVFL+LV   R LR+        DL+ +LDL
Sbjct: 181 GETLPPALAVVNPNRQDEVDAPGYLCAAGVVFLMLVEAGRQLREAG--RRGPDLMGMLDL 238

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+G NRA V +GL +  ++G PG+ AL +   ++      +LG+++GP 
Sbjct: 239 VALATVADVAPLVGANRALVTQGLKIMAQRGRPGMVALADVARMNEAPRPYHLGFLMGPR 298

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL   D  E   LA +LD LN  RR +E  +   A  +   +  D
Sbjct: 299 VNAGGRIGKADLGARLLACTDPAEAGALAARLDQLNTERREIEEQVRLAALDQAEARGLD 358

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++    D WHPG+VG++A+RLK+   RP+  I F +  +G GSGRS+ G D+G  
Sbjct: 359 ---APLVWAAADGWHPGVVGIVASRLKDAAHRPAIVIGF-DGDEGKGSGRSVSGVDLGAS 414

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG++ KGGGH MAAGL++ R           +                +DG+L 
Sbjct: 415 IQKLAAEGLIEKGGGHKMAAGLSLSRAQLEPAMARLSELLARQGAGAGGPRDLAVDGILM 474

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
             A  + LID +E+AGP+GAG P P FAFP+ ++   + V   HL+++F       + AI
Sbjct: 475 PGAATVDLIDEIEAAGPFGAGAPAPRFAFPDVQISFAKRVGDRHLKVSFGDGLGAKIDAI 534

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           AF  Y  PLG  L    G R H+ G L +N+W+G    QLR+ DA+
Sbjct: 535 AFGAYDGPLGPALEGHGGARFHLAGRLEINHWQGRSIPQLRLEDAA 580


>gi|227821964|ref|YP_002825935.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium fredii
           NGR234]
 gi|227340964|gb|ACP25182.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium fredii
           NGR234]
          Length = 600

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 339/591 (57%), Positives = 436/591 (73%), Gaps = 1/591 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
           ++AFLGVE SISG RWVS L Q G NRALAI+Q H   +++ARVL  R V +D A  FL+
Sbjct: 9   ERAFLGVERSISGQRWVSRLDQAGQNRALAISQVHGYSELIARVLAGRGVGLDDAAQFLD 68

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R LMPDP +LTDC KAA R+  AI + EK+ IFGDYDVDGAAS ALM+RFL H  + 
Sbjct: 69  PTLRALMPDPDVLTDCRKAAERLAHAIRHGEKVAIFGDYDVDGAASSALMLRFLRHFDIR 128

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPNP  +E+ I  GA LI++VDCGSTS+++L  A  +G+DV+VIDHH
Sbjct: 129 AEIYIPDRIFEGYGPNPQAIEQLIENGAGLIVSVDCGSTSHESLAVAAERGVDVVVIDHH 188

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN-KVPLNFDLLSL 241
           QV +   P +ALVNPNR DDLSGQGHLCAAGVV+LVLV   R+LR        +FDLL+L
Sbjct: 189 QVGATLPPCHALVNPNREDDLSGQGHLCAAGVVYLVLVNTLRVLRLAGVPRAASFDLLAL 248

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATVCDVVPL GLNRAYVVKGL+ AR  GN GL AL+ +  I  P+T  +LG++I
Sbjct: 249 LDLVALATVCDVVPLKGLNRAYVVKGLIAARHMGNNGLAALLRKAAIGGPVTPYHLGFLI 308

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LGSRLL  DD+   E++A +LD LN+ R+ ME+AML +AEA+VL +
Sbjct: 309 GPRINAGGRIGDAALGSRLLTLDDATAAEVIASQLDELNRERQAMEAAMLAEAEAEVLAE 368

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
               + A+VI+   + WHPGIVGL+AAR+KEKF RP+FAI+F+ +G+G GSGRSI GFD+
Sbjct: 369 YGTGEGATVIITARENWHPGIVGLIAARIKEKFRRPAFAIAFDPNGRGTGSGRSIPGFDM 428

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G++V  AV++G+LVKGGGHAMAAGLTVER   GRL  FF++ A + V  L+     K+DG
Sbjct: 429 GRLVRAAVDDGLLVKGGGHAMAAGLTVERAKLGRLRQFFEERAESAVRDLVAVETLKLDG 488

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            L A+   + L+D+L+ AGPYG+ +P PVFAFP H+L+  R V   H+++T E  D   +
Sbjct: 489 ALAAAGATLDLVDLLDQAGPYGSAHPQPVFAFPQHRLRDSRQVGANHIKVTLEGHDGSRV 548

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
             IAFR   TPLG+FL+ SRG  +HV G +  + W+G++R QLRV DA+  
Sbjct: 549 DGIAFRATETPLGDFLLGSRGSTVHVAGSVSADLWQGTRRVQLRVTDAAKA 599


>gi|149914303|ref|ZP_01902834.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           AzwK-3b]
 gi|149811822|gb|EDM71655.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           AzwK-3b]
          Length = 580

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 242/589 (41%), Positives = 346/589 (58%), Gaps = 10/589 (1%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
             +LG+  S++G RW+   G E   RA A+ Q   +P  + + L    V    A+ +L P
Sbjct: 2   DTYLGIAQSLTGRRWIG-PGAEVERRAEAMAQSTGLPRPLCQTLARLGVPETEAEPYLEP 60

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           S+R L+PDP  L D + AA R + A+   E+I IF DYDVDG +S AL++ +L    + A
Sbjct: 61  SLRDLLPDPRSLRDMETAAGRFIAAVRARERIAIFADYDVDGGSSAALLIDWLRQMGLAA 120

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPN   M +       LII VDCG+ S+DA+  A   G DV+++DHH 
Sbjct: 121 TLYIPDRIDEGYGPNEPAMAELAA-AHDLIICVDCGTLSHDAIAAAR--GADVVILDHHL 177

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
                 PA A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL+++LD
Sbjct: 178 GGETLPPALAVVNPNRQDETGDLAHLCAAAVVFLMLVEAGRQLRERG--ETRPDLMAMLD 235

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVALATV DV PL G+NRA+V +GL +   +  PGL AL +   + +  +A +LG+++GP
Sbjct: 236 LVALATVADVAPLRGVNRAFVRQGLRIMAHRDRPGLVALSDVARLDTAPSAYHLGFVMGP 295

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            +NAGGRIG+++LG+RLL + D  E   LA +LD LN  RR +E+ +   A A+   +  
Sbjct: 296 RVNAGGRIGKADLGARLLATRDISEARSLAERLDQLNSERRDIEAGVRAAALAQAEARGL 355

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
           D   A ++   G+ WHPG+VG++A+RLKE   RP+  I   +  +G GSGRSI G D+G 
Sbjct: 356 D---APLVWAAGEGWHPGVVGIVASRLKELTNRPAIVIGM-DGDEGKGSGRSISGVDLGA 411

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            +     EG+L+KGGGH MAAGLTV R       +   +               ++DGVL
Sbjct: 412 SIQRLAAEGLLIKGGGHRMAAGLTVARDRLEAAMERLSELLDRQGSGAAGPADLRLDGVL 471

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
              A  + L++ +E+AGP+GAG P P + FP+ ++   + V  AHL++ F    S  L A
Sbjct: 472 MPGAATVELVERIEAAGPFGAGAPGPRYVFPDMQIGFAKRVGDAHLKLRFGDGLSGQLDA 531

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           IAF  + +PLG+ LM   G R H+ G + +N W G +  QL++ DA+P 
Sbjct: 532 IAFGAFDSPLGQALMSHGGARFHLAGRIGINEWGGRRSPQLQLEDAAPA 580


>gi|85705202|ref|ZP_01036301.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp. 217]
 gi|85670075|gb|EAQ24937.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp. 217]
          Length = 582

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 241/592 (40%), Positives = 346/592 (58%), Gaps = 11/592 (1%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
              AFLGVE S++G RW+   G E    A A+ Q   +P  + + L    V+ + A+ +L
Sbjct: 1   MGPAFLGVEQSLTGRRWIG-PGVETDRLAEAMAQTTTLPRPLCQTLARLGVAEEDAEAYL 59

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P++R L+PDP  L D ++AA R ++A+   E+I +F DYDVDG  S AL++ +L     
Sbjct: 60  SPALRDLLPDPRSLRDMERAAARFLKAVKTGERIAVFADYDVDGGTSAALLIDWLRQMQA 119

Query: 122 N-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
               +YIPDRI +GYGPN   M         LI+ VDCG+ S++A+  A  +G DV+V+D
Sbjct: 120 PTPTLYIPDRIDEGYGPNVPAMTDLAARH-DLILCVDCGTLSHEAI--AAAKGADVVVLD 176

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HH       PA A+VNPNR D+     HLCAAGVVFL+LV   R LR         DL++
Sbjct: 177 HHLGGETLPPALAVVNPNRQDESGDLAHLCAAGVVFLMLVEAGRQLRAGG--TQGPDLMA 234

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVALATV DV PLIG+NRA+V +GL +  R+  PGL AL +   + +   A +LG++
Sbjct: 235 LLDLVALATVADVAPLIGVNRAFVRQGLRIMARRDRPGLVALADVARMDTAPNAYHLGFL 294

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP +NAGGRIG+++LG+RLL  D++ E   LA +LD LN  RR +E+ +   A A+   
Sbjct: 295 LGPRVNAGGRIGKADLGARLLACDNASEARALAERLDHLNTERRDVEALVRAAALAQAEE 354

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +  D   A ++   G+ WHPG+VG++A+RLKE   RP+  I   +  +G GSGRS+ G D
Sbjct: 355 RGLD---APLVWAAGEGWHPGVVGIVASRLKEVSNRPAIVIGL-DGDEGKGSGRSVSGVD 410

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  +     EG+L+KGGGH MAAGLTV R           +               ++D
Sbjct: 411 LGVAIQRLASEGLLIKGGGHKMAAGLTVARERLEAAMARLSELLAKQGAGQNGPADLRLD 470

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G+L   A  + L+  ++SAGP+GAG P P + FP+ ++   + ++ AHL++ F      +
Sbjct: 471 GLLMPGAATVDLVAQIDSAGPFGAGAPGPRYVFPDCQITFAKALSGAHLKLRFGDGMGAS 530

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           L AI F     PLG  L+   G R H+ G L +N W G +  QLR+ DA+P 
Sbjct: 531 LDAICFGALDGPLGPALLAHGGARFHLAGRLDINSWGGRQTVQLRLEDAAPA 582


>gi|88658434|ref|YP_507899.1| single-stranded-DNA-specific exonuclease RecJ [Ehrlichia
           chaffeensis str. Arkansas]
 gi|88599891|gb|ABD45360.1| single-stranded-DNA-specific exonuclease RecJ [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 589

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 231/579 (39%), Positives = 335/579 (57%), Gaps = 15/579 (2%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           ++G  W            L ITQK  I +IVARVL  R V+I+   DFL P++R  +PDP
Sbjct: 14  VTGALW--KPYNVNFRDVLTITQKLGISEIVARVLSTRKVNIEEINDFLYPTLRSSLPDP 71

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             L D DKA +RI  AIYN E+I+IFGDYDVDGA S AL+ ++L+   V   +YIPDRI 
Sbjct: 72  FHLLDMDKAIQRICHAIYNKERIVIFGDYDVDGATSSALIKQYLTQIGVPTTIYIPDRIC 131

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN   + K    G  L ITVDCG+ +++ +  A +  +DVIVIDHH   +    A 
Sbjct: 132 EGYGPNTQALLKLQEIGHSLCITVDCGTIAHEPISVAKSVNLDVIVIDHHMGLNTLPDAI 191

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATV 250
           A++NPNRLD+ S   +L   GV FL+LV + + L++      N   +L++ LDLVAL TV
Sbjct: 192 AVINPNRLDENSPYTYLAGVGVSFLMLVALNKTLKEKGFFTNNNEPNLINYLDLVALGTV 251

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
           CDV+P+IGLNRA+V +GL +   + N GLK L + + +        LG+ IGP INAGGR
Sbjct: 252 CDVMPIIGLNRAFVKQGLKIMATRQNIGLKVLSDVIGLEDKPNTYQLGFNIGPHINAGGR 311

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G ++LG+RLL S+  +E   ++ KL   N  R+ +E     +A  +             
Sbjct: 312 VGNASLGARLLSSNSEEEALEISEKLQNFNLERKELEHRSFNEAVEQAEALISTNTN--- 368

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           +++    WHPGI+G++A RLK+KF  PS  IS  + G G  S RSI   D+G  +  A  
Sbjct: 369 LIIVAGNWHPGIIGIVAGRLKDKFFLPSIVIS-LDKGIGKASARSIPDVDLGAAILSAKL 427

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           EGI+ +GGGHAMAAG +++      L +F  +  HNI        VFK+DG++ A+AVN+
Sbjct: 428 EGIITEGGGHAMAAGFSIQEDKIKTLNEFLSQRFHNINK----QKVFKVDGIITAAAVNL 483

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYG 550
            L   L+   P+G GNP P F   N K+++  ++  +H++      +   ++ I FR   
Sbjct: 484 TLWKELQFLEPFGIGNPEPRFILTNIKIKNPEIIGDSHIRC-LIHDNKTFIKGICFRCTD 542

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           T LG  L++     + + G + VNYW+G++  Q  + DA
Sbjct: 543 TELGLALLERTA--IMLLGKISVNYWKGNENIQFIIEDA 579


>gi|52081241|ref|YP_080032.1| RecJ exonuclease [Bacillus licheniformis ATCC 14580]
 gi|52786621|ref|YP_092450.1| YrvE [Bacillus licheniformis ATCC 14580]
 gi|52004452|gb|AAU24394.1| RecJ exonuclease [Bacillus licheniformis ATCC 14580]
 gi|52349123|gb|AAU41757.1| YrvE [Bacillus licheniformis ATCC 14580]
          Length = 782

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 189/593 (31%), Positives = 281/593 (47%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW          +   +  +  I  + A +LV R     D A  FL  +      D
Sbjct: 3   ASKMRWDVQT--PDKEKVEQLAGRLGITPLAASLLVMRGYDTADKASSFLYGNDARFH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L D +KA RRI QAI + EKIMI+GDYD DG  S  ++++ L  CS  A+ YIPDR 
Sbjct: 60  PYLLKDMEKAVRRIKQAISDQEKIMIYGDYDADGVTSTTVLLQMLKKCSAQADFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN +        G  LIITVD G       + A   GID+I+ DHH+       A
Sbjct: 120 KEGYGPNEAAFRGIKESGYSLIITVDTGIAGVHEAEVAKELGIDLIITDHHEPGPVLPDA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P +         L   GV F +   +   L +D           LLDL A+ T+ 
Sbjct: 180 YAIIHPKQPGCGYPFKELAGVGVAFKLAHALNGELPED-----------LLDLCAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPI-TAENLGYMIGPSINAGGR 310
           D+VPL   NR    +G+   R+   PGLKAL +           E +G+ I P +NA GR
Sbjct: 229 DLVPLHDENRQIAKRGMEQFRKTKRPGLKALAKIAGAEIHNADEETIGFQIAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL ++D +E E LA  ++ LN+ R+ + + M E+A   +  +  D     V
Sbjct: 289 IEQADPAVYLLNTEDEREAEELAEDINALNKERQKIVNQMTEEAVQMIEEEGLDQ---PV 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L E+F RP+  +   EE G   GS RSI+GFD+ + +S   
Sbjct: 346 IVVARPGWNPGVVGIVASKLVERFYRPAIVLGVDEEKGIAKGSARSIKGFDLFQNLSEC- 404

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L +   + A  ++      PV  +D       ++
Sbjct: 405 -RDILPHFGGHPMAAGMTLNLEDVSALRERINRQAEAVLTEADFIPVQDVDLCCRLEDIS 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  +    P+G GNP P     + K+   R +     HL++     D   L  I F 
Sbjct: 464 VDSIAEMNLLAPFGTGNPKPFVLVSDVKIDDARKIGANKNHLKLVLAD-DGNKLDCIGFY 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G ++ + G L +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGDIEEG----IVPGAKISIVGELSINEWNNRKKPQLMIKDAAVNEWQLFDLR 571


>gi|149202133|ref|ZP_01879106.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp.
           TM1035]
 gi|149144231|gb|EDM32262.1| single-stranded-DNA-specific exonuclease RecJ [Roseovarius sp.
           TM1035]
          Length = 582

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 244/592 (41%), Positives = 348/592 (58%), Gaps = 11/592 (1%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
              AFLGVE S++  RWV   G E    A A+ Q  A+P  + + L    V  D A+ +L
Sbjct: 1   MQSAFLGVESSLTSRRWVG-PGVEADRLAEAMAQATALPRPLCQTLARLGVPEDAAEAYL 59

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P++R L+PDP  L D ++AA R ++A+   E+I IF DYDVDG  S AL++ +L     
Sbjct: 60  TPTLRDLLPDPRALRDMEQAAARFLKALRGGERIAIFADYDVDGGTSAALLIDWLRQMRA 119

Query: 122 N-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
               +YIPDRI +GYGPN   M         LI+ VDCG+ S++A+  AT  G DV+V+D
Sbjct: 120 PSPTLYIPDRIDEGYGPNVPAMSDLAARH-DLIVCVDCGTLSHEAIAAAT--GADVVVLD 176

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HH       PA+A+VNPNR D+     HLCAAGVVFL+LV   R LR         DL++
Sbjct: 177 HHLGGETLPPAHAVVNPNRQDESGDLAHLCAAGVVFLMLVEAGRQLRDSG--AQGPDLMA 234

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATV DV PLIG+NRA+V +GL V   +  PGL AL +   + +   A +LG++
Sbjct: 235 MLDLVALATVADVAPLIGVNRAFVRQGLRVMATRARPGLVALADVARMDTAPNAYHLGFL 294

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP +NAGGRIG+++LG+RLL  D+  E   +A +LD LN  RR +E+ + + A A+   
Sbjct: 295 LGPRVNAGGRIGKADLGARLLACDNPAEARAMAERLDQLNTERREVEAQVRDAALAQAEA 354

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +  D   A ++   G+ WHPG+VG++A+RLKE+  RP+  I   +  +G GSGRS+ G D
Sbjct: 355 RGLD---APLVWAAGEGWHPGVVGIVASRLKERANRPAIVIGL-DGDEGKGSGRSVSGVD 410

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  +     EG+L+KGGGH MAAGLTV R           +        +      ++D
Sbjct: 411 LGAAIQRLASEGLLIKGGGHKMAAGLTVARERLEAAMARLSELLAKQGAGVGGAADLRLD 470

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G+L   A  + L++ +E+AGP+GAG P P + FP+ ++   + ++ AHL++ F      +
Sbjct: 471 GLLMPGAAAVELVEQIEAAGPFGAGAPGPRYVFPDCQITFAKALSGAHLKLRFGDGMGAS 530

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           L AIAF     PLG  L+   G R H+ G L +N W G +  QLR+ DA+P 
Sbjct: 531 LDAIAFGALDGPLGPALLNHGGARFHLAGRLDLNSWGGRQTVQLRLEDAAPA 582


>gi|319644792|ref|ZP_07999025.1| YrvE protein [Bacillus sp. BT1B_CT2]
 gi|317392601|gb|EFV73395.1| YrvE protein [Bacillus sp. BT1B_CT2]
          Length = 782

 Score =  445 bits (1145), Expect = e-123,   Method: Composition-based stats.
 Identities = 188/593 (31%), Positives = 282/593 (47%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW          +   +  +  I  + A +LV R     D A  FL  +      D
Sbjct: 3   ASKMRWDVQT--PDKEKVEQLAGRLGITPLAASLLVMRGYDTADKASSFLYGNDARFH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L D +KA RRI QAI + EKIMI+GDYD DG  S  ++++ L  CS  A+ YIPDR 
Sbjct: 60  PYLLKDMEKAVRRIKQAISDQEKIMIYGDYDADGVTSTTVLLQMLKKCSAQADFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN +        G  LIITVD G       + A   GID+I+ DHH+       A
Sbjct: 120 KEGYGPNEAAFRGIKESGYSLIITVDTGIAGVHEAEVAKELGIDLIITDHHEPGPVLPDA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P +         L   GV F +   +   L +D           LLDL A+ T+ 
Sbjct: 180 YAIIHPKQPGCGYPFKELAGVGVAFKLAHALNGELPED-----------LLDLCAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPI-TAENLGYMIGPSINAGGR 310
           D+VPL   NR    +G+   R+   PGLKAL +           E +G+ I P +NA GR
Sbjct: 229 DLVPLHDENRQIAKRGMEQFRKTKRPGLKALAKIAGAEIHNADEETIGFQIAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL ++D +E E LA  ++ LN+ R+ + + M E+A   +  +  D     V
Sbjct: 289 IEQADPAVNLLNTEDEREAEELAEDINALNKERQKIVNQMTEEAVQMIEEEGLDQ---PV 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L E+F RP+  +  +E+ G   GS RSI+GFD+ + +S   
Sbjct: 346 IVVARPGWNPGVVGIVASKLVERFYRPAIVLGIDEEKGIAKGSARSIKGFDLFQNLSEC- 404

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L +   + A  ++      PV  +D       ++
Sbjct: 405 -RDILPHFGGHPMAAGMTLNLEDVSALRERINRQAEAVLTEADFIPVQDVDLCCRLEDIS 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  +    P+G GNP P     + K+   R +     HL++     D   L  I F 
Sbjct: 464 VDSIAEMNLLAPFGTGNPKPFVLVSDVKIDDARKIGANKNHLKLVLAD-DGNKLDCIGFY 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G ++ + G L +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGDIEEG----IVPGAKISIVGELSINEWNNRKKPQLMIKDAAVNEWQLFDLR 571


>gi|157803729|ref|YP_001492278.1| transcription termination factor Rho [Rickettsia canadensis str.
           McKiel]
 gi|157784992|gb|ABV73493.1| transcription termination factor Rho [Rickettsia canadensis str.
           McKiel]
          Length = 585

 Score =  445 bits (1144), Expect = e-122,   Method: Composition-based stats.
 Identities = 222/595 (37%), Positives = 334/595 (56%), Gaps = 19/595 (3%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           M  +A      SI+G  W   +  E I   + + +   I D++AR++  R  ++   ++F
Sbjct: 1   MKPRA------SINGKIWQQKVINEDI--VMELCRSFKISDLLARIVSLRVNNLAEVENF 52

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L P I+ L+PDP  L D  KA  R V+AI N++KI IF DYDVDGA S AL+       +
Sbjct: 53  LIPKIKNLLPDPFHLLDMAKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNIFRDLN 112

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           +  ++Y+PDRI +GYGP P  ++K  +   +L+ITVDCG+ +++AL+YA +  +DVIVID
Sbjct: 113 IICDIYVPDRIAEGYGPTPFAIQKIKDNSTELLITVDCGTMAHEALKYAKDISLDVIVID 172

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFDL 238
           HH        A A++NPNR+D+ S   HL A GV FL    I   L+Q N        +L
Sbjct: 173 HHIATEILPDAVAIINPNRIDEKSEYKHLAAVGVAFLFATAILSNLKQQNYFTKSPQPNL 232

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           ++ LDLVAL TVCD+V L G+NRA+V  GL V +++ N G+K L + V ++      +LG
Sbjct: 233 INYLDLVALGTVCDMVKLTGINRAFVASGLKVMQQRQNIGIKTLYDIVGLNEIPKCYHLG 292

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +++GP INAGGR+G+S+LG+ LL +  S E   LA +L+  N  R+L+E  M+E+A    
Sbjct: 293 FILGPRINAGGRVGKSSLGANLLSTSCSNEASKLAEELEKHNNERKLIELLMIEEAMEIA 352

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
            TQ    Q +S++ +  + WHPG++G++A RLKEKF +P   ++  + G G  S RSI G
Sbjct: 353 WTQ----QDSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVVALND-GIGKASCRSITG 407

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D G  +  A   G+L+ GGGH MAAG TV       L +F        +  L      +
Sbjct: 408 IDFGAEIINAKNHGLLIAGGGHTMAAGFTVTAEKLQELQEFLNNAFRTSINKLENYKQVE 467

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF----E 534
            D  L+ +++N+ L++ L S  P+G GN  P+F F N  +    +V   H++       +
Sbjct: 468 YDLDLSLNSINLHLMEELSSIEPFGQGNHEPIFKFDNLFVLKAYIVGSKHIKALLVHNTQ 527

Query: 535 SQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
              S+ L AIAF   GT   E L+  + K +   G L  + W+ +   QL + D 
Sbjct: 528 GSGSKALSAIAFNSVGTAFEEVLLSPKAKNIAAIGTLRTSNWQDNYTIQLIIKDI 582


>gi|146340534|ref|YP_001205582.1| putative single-stranded-DNA-specific exonuclease recJ
           [Bradyrhizobium sp. ORS278]
 gi|146193340|emb|CAL77356.1| putative single-stranded-DNA-specific exonuclease recJ
           [Bradyrhizobium sp. ORS278]
          Length = 613

 Score =  445 bits (1144), Expect = e-122,   Method: Composition-based stats.
 Identities = 281/592 (47%), Positives = 375/592 (63%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            QAFLGV  S++   W   L   G  RALAI Q++ +P+++ARVL  R+V++D  +DFL+
Sbjct: 13  PQAFLGVRLSLTNKLWRDRLDTRGAARALAIVQRYQLPEMLARVLAGRDVALDAVQDFLD 72

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+IR LMPDP  +T  + AA+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++
Sbjct: 73  PTIRKLMPDPFTVTQMEAAAQRIADAAVKGEKVAIFGDYDVDGATSAALLAWHLRHCGLD 132

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +    N+GA L++TVDCG+TS + L  A   G+ V+VIDHH
Sbjct: 133 PLIHIPDRIFEGYGPNTDAIRALANKGATLLVTVDCGTTSLEPLAEARRLGMSVVVIDHH 192

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV---PLNFDLL 239
           Q   E     ALVNPNR DDLSG G+L A G+ F+ LV + R LR            DLL
Sbjct: 193 QCGEELPEVEALVNPNRPDDLSGLGYLAAVGLTFVTLVAVNRELRSRGFWSGTRPEPDLL 252

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           S+L  VAL TV DV PLI LNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+
Sbjct: 253 SMLHHVALGTVADVAPLIALNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGF 312

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L
Sbjct: 313 MLGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNTERRVIEQQAEAQAEAEAL 372

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + +VIV   + WHPG+VGL+A+RLKEKF RP+FAI+ E  G G GSGRSI G 
Sbjct: 373 ASLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFARPAFAIALEPGGIGTGSGRSIPGV 432

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK V  AVE+G+L+KGGGHAMAAG+T+ +        + +      V          I
Sbjct: 433 DLGKAVRHAVEQGLLMKGGGHAMAAGVTLRKERLAEFRAYLENALAADVAEARHVNEILI 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A A    L++ L  AGP+G+GNP P+ A P+H+L     V  AHL++ F+S D  
Sbjct: 493 DGAISARAATPELVNTLNRAGPFGSGNPEPIVALPSHQLVYADEVGQAHLKLRFKSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           T+ AIAFR  G  LG  L+Q RG+ +HV G L V+ ++G +R QLRVLD + 
Sbjct: 553 TVNAIAFRSVGQRLGNALVQHRGQVLHVAGTLTVDRYQGVERVQLRVLDVAV 604


>gi|125973861|ref|YP_001037771.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum ATCC 27405]
 gi|256004315|ref|ZP_05429297.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum DSM 2360]
 gi|281418022|ref|ZP_06249042.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum JW20]
 gi|125714086|gb|ABN52578.1| exonuclease RecJ [Clostridium thermocellum ATCC 27405]
 gi|255991749|gb|EEU01849.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum DSM 2360]
 gi|281409424|gb|EFB39682.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum JW20]
 gi|316939941|gb|ADU73975.1| single-stranded-DNA-specific exonuclease RecJ [Clostridium
           thermocellum DSM 1313]
          Length = 827

 Score =  444 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 195/577 (33%), Positives = 306/577 (53%), Gaps = 23/577 (3%)

Query: 27  INRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLILTDCDKAARRI 85
             +   +++K  I  ++A + ++R V      KDFLNPS+  L  DP  L D +KA  RI
Sbjct: 14  DEKVEKLSKKAGISKLLAGIFLSRGVDDPDYIKDFLNPSLDKLH-DPFELRDMEKAVDRI 72

Query: 86  VQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKF 145
           V+A+  +EKI+I+GDYDVDG  S +++  F    + +   YIPDR+ +GYG + +  EK 
Sbjct: 73  VKALRQNEKILIYGDYDVDGITSTSILYDFFRRQNADVCYYIPDRLNEGYGISMAAAEKM 132

Query: 146 INEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSG 205
                 L+ITVDCG T+++ ++Y T+  ID+I+ DHH+ +     A A+VNP+R D    
Sbjct: 133 PEMDVDLVITVDCGITAFEEVKYITDNNIDIIITDHHECRESVPDALAVVNPHRFDCAYP 192

Query: 206 QGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVV 265
              L   GV + +L  + + +               LDLVAL TV DVVPL+G NR  V 
Sbjct: 193 FKELAGVGVAYKLLEALSKKMNIPGFE------RQYLDLVALGTVADVVPLLGENRIIVK 246

Query: 266 KGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGESNLGSRLLISD 324
            GL +  +  N GL++LI+   I +  I    +G+++ P INA GRIG+++   RLL +D
Sbjct: 247 YGLPMIEKTSNVGLRSLIKVAGIENKEINTFLVGFVLAPRINAAGRIGDASRAVRLLTTD 306

Query: 325 DSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVG 384
           + +E   +A +LD  N  R+  E  ++E+A   + T   D+Q+  VIVV G+RWH G++G
Sbjct: 307 NEEEALEIAKELDEQNIFRKQNELEIMEEAVNIIET-GIDLQREKVIVVAGERWHHGVIG 365

Query: 385 LLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAA 444
           ++++++ E++ RPS  IS + +G   GS RSIEGF++    +      +L K GGH  AA
Sbjct: 366 IVSSKITERYYRPSVLISVDGEG-AKGSARSIEGFNL--FEALVHCGKVLEKYGGHEQAA 422

Query: 445 GLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGA 504
           GL ++  N         ++A +++      P  KID  +    + +     L+   P+G 
Sbjct: 423 GLALKPENIDEFRRMINEYADSVLDEDDLVPRMKIDVRITKEDMTLENCKELKLLEPFGE 482

Query: 505 GNPNPVFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRG 562
            NP PVF + N K+  IR V     H ++ F   +   + AI F   G  L +    S  
Sbjct: 483 SNPPPVFRYDNLKVHEIRPVGQDSRHAKIRF-DDNGTLIDAICFN--GGGLTDCYELS-- 537

Query: 563 KRMHVTGHLCVNYWRGSKRCQLRVLDASP---VEGHH 596
             + V   + +N W G +  QL + D  P   VE  +
Sbjct: 538 DIVDVVCSMEINLWNGRENVQLNIKDIRPGLAVERQN 574


>gi|120437681|ref|YP_863367.1| single-stranded-DNA-specific exonuclease RecJ [Gramella forsetii
           KT0803]
 gi|117579831|emb|CAL68300.1| single-stranded-DNA-specific exonuclease RecJ [Gramella forsetii
           KT0803]
          Length = 564

 Score =  444 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 170/579 (29%), Positives = 276/579 (47%), Gaps = 24/579 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLIL 75
           RW     +       ++ +K  I   VA++LV R +S    AK F  P ++ L  DP ++
Sbjct: 2   RWTLKP-KPDPITVNSLAEKLGIGIPVAKLLVQRGISSFKEAKKFFRPDLKDLH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA  RI +AI N E IM++GDYDVDG  SVALM  FL     N   YIPDR  +GY
Sbjct: 60  KDMDKAVDRIEKAIENEENIMVYGDYDVDGTTSVALMSSFLKFRYPNVTTYIPDRYEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + + + YA  +GID ++ DHH+  SE   A A++
Sbjct: 120 GVSYKGIDYAADNDISLIIALDCGIKAIEKVAYAKEKGIDFVICDHHRPGSEIPNAIAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  I +   +         LL  LDLVA A   D+VP
Sbjct: 180 DPKREDCSYPYDELCGCGVGFKLIQAITQKNNE-----PEEVLLPYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V       G+K+L   +     ++  ++ +++ P INA GR+    
Sbjct: 235 ITGENRILAYHGLHVINVAPRKGIKSL---LGDRKNVSITDVVFIVAPRINAAGRMKHGL 291

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL  +D    +  A ++++ N +RR  +  + E+A+ +++      +     VV  
Sbjct: 292 HAVNLLSEEDEAISKKYAEEIEIYNTDRRSADKTITEEAKQQII--NSKEEDRITTVVYD 349

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   + +   S RS++G+D+ + +    E   + 
Sbjct: 350 ENWHKGVIGIVASRLTETWYRPTLVFTKSGE-RLAASARSVKGYDVYEALEGCKEH--IE 406

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+    +      F++     +   + TP   ID  L+   +      +
Sbjct: 407 QFGGHKYAAGLTLLESEYLNFKKKFEEVVSETIDRNLLTPEIGIDAELDLKDITPKFYRI 466

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVN--LAHLQMTFESQDSE-TLQAIAFRVYGT 551
           L+   P+G GN +PVF           + V     HL+   + + S+ T   I F +   
Sbjct: 467 LKQFAPFGPGNMSPVFISRGLTDTGYGKCVGEDKTHLKCQVKQEGSKATFDVIGFNLGE- 525

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              +  +   GK+      L  N W G+ + QL++ D  
Sbjct: 526 ---KLDLIKDGKKFDAVYSLDENTWNGNTKIQLKLKDIR 561


>gi|294084054|ref|YP_003550812.1| single-stranded DNA-specific exonuclease [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663627|gb|ADE38728.1| Single-stranded DNA-specific exonuclease [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 605

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 226/600 (37%), Positives = 334/600 (55%), Gaps = 14/600 (2%)

Query: 1   MNDQAFLGVECSISGFRWV----SLLGQEGINRALAITQKH-AIPDIVARVLVNRNVSID 55
           M   A LG+  S S  RW     SL   +       + +    +P  +AR+L +R +S  
Sbjct: 1   MTPDACLGITQSASDARWDHISASLNAHDTDRYTAGLQEHFADMPLPIARILASRGISAI 60

Query: 56  YAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRF 115
             +  ++P +R L+PDP    D DKA  RI  ++   + I IFGDYDVDGA++ AL +  
Sbjct: 61  EVETLIDPRLRDLLPDPSRFKDMDKAVARIADSVEAGDAIGIFGDYDVDGASAAALFVNV 120

Query: 116 LSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGID 175
           +    +   ++IPDR  +GYGPN + + +   +GA L++TVDCG +++  L    + G+D
Sbjct: 121 MRALHIETFVHIPDRFKEGYGPNANALTRLQEKGASLLLTVDCGISAHAPLAAVADSGMD 180

Query: 176 VIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN 235
           VIVIDHH    E   A++++NPNRLD+    GHLCAAGV F+VLV + R LRQ       
Sbjct: 181 VIVIDHHIAGPELPRAHSVINPNRLDEDGRYGHLCAAGVCFIVLVGVLRALRQRGFFEDR 240

Query: 236 --FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPIT 293
              DLL  LDLVALATVCDVVPL  LNRA+V +GL +   + N GL  L +   ++S   
Sbjct: 241 KAPDLLQQLDLVALATVCDVVPLTDLNRAFVAQGLKIMANRHNHGLARLADVAGMNSAPN 300

Query: 294 AENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQ 353
              LG++IGP INA GRIG S LG +LL      E   LA +LD +N+ RR +E  +   
Sbjct: 301 PYALGFLIGPRINAAGRIGVSELGVKLLSCQREDEAIGLAARLDEMNKERRSIEDDIRAH 360

Query: 354 AEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSG 413
           A  +   Q        V+VV  + WH G++G++A RLK++F +P+  I+F  DG G GS 
Sbjct: 361 AMDRASAQS----DNHVLVVGDEAWHEGVIGIVAGRLKDRFAKPACVIAFSPDGLGKGSA 416

Query: 414 RSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALIT 473
           RSI GF IG  +  A + G+L  GGGH MAAG ++ +        F  +   + +   I 
Sbjct: 417 RSIPGFAIGNAIIAAHQMGLLEGGGGHDMAAGFSIMKDKLAAFQAFMNQRLLDDLKGEIP 476

Query: 474 TPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQM 531
               K+  +L+ +     + D L+  GP+G+GNP P F  P+ ++++IR+V    AH+  
Sbjct: 477 KVSHKVSALLSVAGCQPEVSDWLDKLGPFGSGNPEPRFVLPDCRIKNIRLVGDAGAHVSC 536

Query: 532 TFESQDSETLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +      L AIAF+  G P+G+ L Q + G+ +H+ G L  + +RG +  Q+ + D +
Sbjct: 537 RLDDGSGTALNAIAFQAGGAPIGQLLQQAADGRYLHILGKLRRDRYRGGRAMQIEIEDVA 596


>gi|329850707|ref|ZP_08265552.1| single-stranded-DNA-specific exonuclease RecJ [Asticcacaulis
           biprosthecum C19]
 gi|328841022|gb|EGF90593.1| single-stranded-DNA-specific exonuclease RecJ [Asticcacaulis
           biprosthecum C19]
          Length = 618

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 225/608 (37%), Positives = 337/608 (55%), Gaps = 18/608 (2%)

Query: 2   NDQAFLGVECSISGFRWVSLL--GQEGINRALAITQKHAI-----P---DIVARVLVNRN 51
             + +LGV  S++G  W   L   +        ITQ+  +     P   D +AR +  R 
Sbjct: 12  VSEPYLGVTASLTGRGWSERLAAQKVAPETLREITQRLGLMNVAEPAFLDPLARFIAGRG 71

Query: 52  VSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVAL 111
           ++ D    F++P+++ L PDP    D D+A   +++A+    KI +F DYDVDGA S A 
Sbjct: 72  ITPDSLDTFIHPTLKALFPDPSSFMDMDRAVEAMLEALQAKAKICVFADYDVDGATSAAQ 131

Query: 112 MMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATN 171
           ++R+  H   +  +Y+PDR+ +GYGP+ +  +    +GA L+ITVDCG+ ++ AL +A  
Sbjct: 132 LVRWFRHMGHDLTVYVPDRVTEGYGPSNAAFDTLKRQGADLVITVDCGAMAHRALDHAAE 191

Query: 172 QGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNK 231
            G+DV+VIDHH ++ +   A A+VNPNR    S QG+L AAGVVF+VL  + R   +   
Sbjct: 192 IGLDVVVIDHHLMREDPPRALAVVNPNRPGCTSAQGNLAAAGVVFVVLAALNREAEKRGL 251

Query: 232 V--PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS 289
                  DL+  LDL AL  +CDV  L G NRA   +GL +  ++ NPG+ AL++    +
Sbjct: 252 FAGRGRPDLMQWLDLSALGAICDVTALTGFNRALAAQGLKIMSQRKNPGINALMDIAGSA 311

Query: 290 SP----ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRL 345
           S     ++  + G++IGP INAGGR+G S+LG RLL +DD  E   LA +LD LN+ RR 
Sbjct: 312 SEAGKLMSTFHSGFVIGPRINAGGRVGRSDLGVRLLSTDDPVEAASLAQELDELNRLRRD 371

Query: 346 MESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE 405
           +E+ +LEQA      Q        VIVV    WHPG++G++A RL+E++ RP   I  + 
Sbjct: 372 VETQVLEQAARVAEDQGLWPSDDPVIVVAHQDWHPGVIGIVAGRLRERWHRPVIIIGVDP 431

Query: 406 -DGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFA 464
             G G GSGRS  G ++G+ V  A E G+L+ GGGHAMAAGL+VER     L  F   + 
Sbjct: 432 VSGMGKGSGRSQAGVNLGEAVGAAFESGLLLSGGGHAMAAGLSVERDRIADLRRFLNDYI 491

Query: 465 HNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV 524
           H  V         +ID  L+  A +  L D  +   P+G GNP P+ AF + ++   + +
Sbjct: 492 HTHVAEADQVETVEIDAALSLKAASRDLFDRFDLLAPFGQGNPEPLLAFTDVRVAFAQAM 551

Query: 525 NLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQL 584
              H++          ++AI +R  GT LG+ L++  GK +HV   L  + + G +  QL
Sbjct: 552 KGGHVRCELLDDSGAKVKAIIWRAEGTALGDALLRPSGK-VHVLARLKADDYMGRRGIQL 610

Query: 585 RVLDASPV 592
            + D + V
Sbjct: 611 EIEDIALV 618


>gi|283856427|ref|YP_162966.2| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775429|gb|AAV89855.2| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 586

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 246/590 (41%), Positives = 348/590 (58%), Gaps = 15/590 (2%)

Query: 8   GVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRL 67
           GV  S  G  W       G       + ++ + D++ R+L+ R    +    + +P I+ 
Sbjct: 7   GVSSSALGQAWQWRGQNSGF------SGENPLEDLIDRILITRGCPRESLSAYRDPKIKN 60

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
            MPDP +L D D+AA R+ +AIY  E I+IFGDYDVDGA S ALM+  L    VNA  YI
Sbjct: 61  FMPDPSLLCDMDRAAERLAKAIYKKESIVIFGDYDVDGATSSALMIDLLRQLGVNAGYYI 120

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           PDR+ +GYGP    M K   EGA L++TVDCG+ +Y+AL+ A   G+DV+V+DHHQ + +
Sbjct: 121 PDRVAEGYGPAVQSMRKLAEEGANLVVTVDCGAQAYEALEAAKEAGLDVVVVDHHQCQPQ 180

Query: 188 EIPAYALVNPNRLDDL--SGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLD 243
              A+A+VNPNRLD+   +  GHL A GV FL+   + R LRQD          L++LLD
Sbjct: 181 LPEAHAVVNPNRLDEEEGAQYGHLAAVGVAFLLAAALVRHLRQDGYFSDRPEPKLMALLD 240

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TV DV  L GLNRA+V +GL V   +  PG+ AL++   +S P T  +LG+++GP
Sbjct: 241 LVALGTVADVAALHGLNRAFVAQGLKVMAARHRPGIAALLDVAGVSRPPTTYDLGFILGP 300

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGR+G+S+LG RLL S D  E E LA+ L+  N  RR +E  + E AE     Q  
Sbjct: 301 RINAGGRVGKSDLGVRLLTSLDKNECENLALALNQFNLERRSIEQTVTEAAEGLCEEQV- 359

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
              +  V+VV G+ WHPG++G++A RLK+K+ RP   I  +E+G G GSGRS+ G D+G 
Sbjct: 360 ---ERPVMVVAGEGWHPGVIGIVAGRLKQKYDRPIIVIGIDEEGNGKGSGRSLSGVDLGA 416

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V  A + G+LV GGGHAMAAGL++++        F  +     V          ID VL
Sbjct: 417 AVLSAKQAGLLVNGGGHAMAAGLSIKKDQIEDFSTFISERVQKDVETARANKALLIDEVL 476

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +A  VN++LI+ LE+ GPYGAG P+P            R++   HL + F+ QD ++ +A
Sbjct: 477 SAGGVNLSLIEALEAGGPYGAGWPSPHIVAGPVYAIQTRILKEKHLSVIFKGQDGQSFKA 536

Query: 544 IAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           IAF    TP+ + ++ + R +++ V G + +N W G K  QL + D +  
Sbjct: 537 IAFNAVETPITQMVVAAGRDRKLWVAGKIQLNEWNGRKDAQLHIEDIAWA 586


>gi|260752349|ref|YP_003225242.1| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258551712|gb|ACV74658.1| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 586

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 246/590 (41%), Positives = 348/590 (58%), Gaps = 15/590 (2%)

Query: 8   GVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRL 67
           GV  S  G  W       G       + ++ + D++ R+L+ R    +    + +P I+ 
Sbjct: 7   GVSSSALGQAWQWRGQNSGF------SGENPLEDLIDRILITRGCPRESLSAYRDPKIKN 60

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
            MPDP +L D D+AA R+ +AIY  E I+IFGDYDVDGA S ALM+  L    VNA  YI
Sbjct: 61  FMPDPSLLCDMDRAAERLAKAIYKKESIVIFGDYDVDGATSSALMIDLLRQLGVNAGYYI 120

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           PDR+ +GYGP    M K   EGA L++TVDCG+ +Y+AL+ A   G+DV+V+DHHQ + +
Sbjct: 121 PDRVAEGYGPAVQSMRKLAEEGANLVVTVDCGAQAYEALEAAKEAGLDVVVVDHHQCQPQ 180

Query: 188 EIPAYALVNPNRLDDL--SGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLD 243
              A+A+VNPNRLD+   +  GHL A GV FL+   + R LRQD          L++LLD
Sbjct: 181 LPEAHAVVNPNRLDEEEGAQYGHLAAVGVAFLLAAALVRHLRQDGYFSDRPEPKLMALLD 240

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TV DV  L GLNRA+V +GL V   +  PG+ AL++   +S P T  +LG+++GP
Sbjct: 241 LVALGTVADVAALHGLNRAFVAQGLKVMAARHRPGIAALLDVAGVSRPPTTYDLGFILGP 300

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGR+G+S+LG RLL S D  E E LA+ L+  N  RR +E  + E AE     Q  
Sbjct: 301 RINAGGRVGKSDLGVRLLTSLDKNECENLALALNQFNLERRSIEQIVTEAAEGLCEEQV- 359

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
              +  V+VV G+ WHPG++G++A RLK+K+ RP   I  +E+G G GSGRS+ G D+G 
Sbjct: 360 ---ERPVMVVAGEGWHPGVIGIVAGRLKQKYDRPIIVIGIDEEGNGKGSGRSLSGVDLGA 416

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V  A + G+LV GGGHAMAAGL++++        F  +     V          ID VL
Sbjct: 417 AVLSAKQAGLLVNGGGHAMAAGLSIKKDQIEDFSTFISERVQKDVETARANKALLIDEVL 476

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +A  VN++LI+ LE+ GPYGAG P+P            R++   HL + F+ QD ++ +A
Sbjct: 477 SAGGVNLSLIEALEAGGPYGAGWPSPHIVAGPVYAIQTRILKEKHLSVIFKGQDGQSFKA 536

Query: 544 IAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           IAF    TP+ + ++ + R +++ V G + +N W G K  QL + D +  
Sbjct: 537 IAFNAVETPITQMVVAAGRDRKLWVAGKIQLNEWNGRKDAQLHIEDIAWA 586


>gi|241762072|ref|ZP_04760156.1| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373538|gb|EER63125.1| single-stranded-DNA-specific exonuclease RecJ [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 586

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 246/590 (41%), Positives = 348/590 (58%), Gaps = 15/590 (2%)

Query: 8   GVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRL 67
           GV  S  G  W       G       + ++ + D++ R+L+ R    +    + +P I+ 
Sbjct: 7   GVSSSALGQAWQWRGQNSGF------SGENPLEDLIDRILITRGCPRESLSAYRDPKIKN 60

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
            MPDP +L D D+AA R+ +AIY  E I+IFGDYDVDGA S ALM+  L    VNA  YI
Sbjct: 61  FMPDPSLLCDMDRAAERLAKAIYKKESIVIFGDYDVDGATSSALMIDLLRQLGVNAGYYI 120

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           PDR+ +GYGP    M K   EGA L++TVDCG+ +Y+AL+ A   G+DV+V+DHHQ + +
Sbjct: 121 PDRVAEGYGPAVQSMRKLAEEGANLVVTVDCGAQAYEALEAAKEAGLDVVVVDHHQCQPQ 180

Query: 188 EIPAYALVNPNRLDDL--SGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLD 243
              A+A+VNPNRLD+   +  GHL A GV FL+   + R LRQD          L++LLD
Sbjct: 181 LPEAHAVVNPNRLDEEEGAQYGHLAAVGVAFLLAAALVRHLRQDGYFSDRPEPKLMALLD 240

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           LVAL TV DV  L GLNRA+V +GL V   +  PG+ AL++   +S P T  +LG+++GP
Sbjct: 241 LVALGTVADVAALHGLNRAFVAQGLKVMAARYRPGIAALLDVAGVSRPPTTYDLGFILGP 300

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGR+G+S+LG RLL S D  E E LA+ L+  N  RR +E  + E AE     Q  
Sbjct: 301 RINAGGRVGKSDLGVRLLTSLDKNECENLALALNQFNLERRSIEQTVTEAAEGLCEEQV- 359

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
              +  V+VV G+ WHPG++G++A RLK+K+ RP   I  +E+G G GSGRS+ G D+G 
Sbjct: 360 ---ERPVMVVAGEGWHPGVIGIVAGRLKQKYDRPIIVIGIDEEGNGKGSGRSLSGVDLGA 416

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V  A + G+LV GGGHAMAAGL++++        F  +     V          ID VL
Sbjct: 417 AVLSAKQAGLLVNGGGHAMAAGLSIKKNQIEDFATFISERVQKDVETARANKALLIDEVL 476

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
           +A  VN++LI+ LE+ GPYGAG P+P            R++   HL + F+ QD ++ +A
Sbjct: 477 SAGGVNLSLIEALEAGGPYGAGWPSPHVVAGPVYAIQTRILKEKHLSVIFKGQDGQSFKA 536

Query: 544 IAFRVYGTPLGEFLMQS-RGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           IAF    TP+ + ++ + R +++ V G + +N W G K  QL + D +  
Sbjct: 537 IAFNAVETPITQIVVAAGRDRKLWVAGKIQLNEWNGRKDAQLHIEDIAWA 586


>gi|15965474|ref|NP_385827.1| single-stranded-DNA-specific exonuclease protein [Sinorhizobium
           meliloti 1021]
 gi|307302595|ref|ZP_07582351.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           meliloti BL225C]
 gi|307318442|ref|ZP_07597876.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           meliloti AK83]
 gi|15074655|emb|CAC46300.1| Probable single-stranded-DNA-specific exonuclease [Sinorhizobium
           meliloti 1021]
 gi|306895782|gb|EFN26534.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           meliloti AK83]
 gi|306902959|gb|EFN33550.1| single-stranded-DNA-specific exonuclease RecJ [Sinorhizobium
           meliloti BL225C]
          Length = 600

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 335/590 (56%), Positives = 430/590 (72%), Gaps = 1/590 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           +AFLGVE S+SG RWVS L Q G NRALAI+Q H   +++ARVL  R V +D A  FL P
Sbjct: 10  RAFLGVERSVSGQRWVSRLDQAGQNRALAISQVHGYSELIARVLAGRGVGLDDAAAFLEP 69

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           ++R LMPDP  LTD  KAA R+  AI   EK++IFGDYDVDGAAS ALM RFL H  + A
Sbjct: 70  TLRALMPDPDTLTDGRKAAERLADAIRRREKVVIFGDYDVDGAASSALMARFLRHFDITA 129

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP  +++ I+ G++LI+TVDCGSTS++AL  A  +  DV+VIDHHQ
Sbjct: 130 EIYIPDRIFEGYGPNPQAIDQLIDRGSELIVTVDCGSTSHEALAVAAERRTDVVVIDHHQ 189

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL-NFDLLSLL 242
           V S   P +ALVNPNR DDLSGQGHLCAAGVV+LVLV   R+LR        +FDLLSLL
Sbjct: 190 VGSVLPPCHALVNPNREDDLSGQGHLCAAGVVYLVLVNTLRVLRLRGDPRAASFDLLSLL 249

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVALATVCDVVPL GLNRAYVVKGL+ AR  GN GL AL+ +  I  P+T  +LG+++G
Sbjct: 250 DLVALATVCDVVPLKGLNRAYVVKGLLAARHMGNAGLAALLRKAAIGGPVTPYHLGFLLG 309

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG++ LGSRLL  D +   E +A +LD LN++R+ ME+AML +AEA+VL + 
Sbjct: 310 PRINAGGRIGDAALGSRLLTLDVAAAAEAIASQLDELNRDRQAMEAAMLAEAEAEVLAEY 369

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
              + ASVIV     WHPGIVGL+AAR+KEKF RP+FAI+F+ +G+G GSGRSI GFD+G
Sbjct: 370 GTGEGASVIVTARQNWHPGIVGLIAARIKEKFRRPAFAIAFDPNGRGTGSGRSINGFDMG 429

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
           ++V  AV+ G+LVKGGGHAMAAGLTVER   G+L  FF++ A   +  L+     K+DG 
Sbjct: 430 RLVRAAVDNGLLVKGGGHAMAAGLTVERGKLGQLRQFFEERAETAIRDLVAVQTLKVDGA 489

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           L A+   + L+D+L+ AGPYG+G+P P+FAFP H+L+  R V   H+++T E QD   ++
Sbjct: 490 LAAAGATLDLVDLLDQAGPYGSGHPQPLFAFPQHRLRDSRQVGANHVKVTLEGQDGSRME 549

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            IAFR   TPLG+FL+ +RG  +HV G +  + W+G+++ QLRV DA+  
Sbjct: 550 GIAFRAAETPLGDFLLGNRGATVHVAGSVSADLWQGTRKVQLRVTDAAKA 599


>gi|92117830|ref|YP_577559.1| single-stranded-DNA-specific exonuclease RecJ [Nitrobacter
           hamburgensis X14]
 gi|91800724|gb|ABE63099.1| exonuclease RecJ [Nitrobacter hamburgensis X14]
          Length = 613

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 278/591 (47%), Positives = 367/591 (62%), Gaps = 3/591 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
             AFLGV  S +G  W   L   G  RALAI Q+H +P+++ARV+  R V +D   DFL+
Sbjct: 13  PDAFLGVSHSATGRLWRDRLDARGAARALAIAQRHQLPEMLARVIAGRGVEVDAVADFLD 72

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+IR LMPDP  +T  + AA+R+  A    E + IFGDYDVDGA S AL+   L HC ++
Sbjct: 73  PTIRRLMPDPFTVTQMEAAAKRLADAAMRGETVAIFGDYDVDGATSAALLAWHLRHCGLD 132

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +      GA L++TVDCG+TS + L  A  QG+ V+VIDHH
Sbjct: 133 PLIHIPDRIFEGYGPNVEAINALAARGATLLVTVDCGTTSIEPLAVAKQQGMSVVVIDHH 192

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLL 239
           Q   +     ALVNPNR DDLSG GHL A G+V + LV + R LRQ           DLL
Sbjct: 193 QCGDDLPEVEALVNPNRPDDLSGLGHLAAVGLVLVTLVALNRELRQRGFWTDERPEPDLL 252

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           ++L  VAL TV DV PL GLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+
Sbjct: 253 NMLHHVALGTVADVAPLTGLNRAFVAKGLIALRRRDHVGHTALMDVARLNGPPEAWHLGF 312

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E A   QAEA+ L
Sbjct: 313 MLGPRINAGGRIGRADLGVRLLLEGDVSEAARIAAELDRLNVERRVIEQAAEAQAEAEAL 372

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + +VIV   + WHPG+VGL+A+RLK+KF RP+F ++ E  G G GSGRSI G 
Sbjct: 373 ASLGLEDKGAVIVTASEGWHPGVVGLVASRLKDKFSRPAFVVALEPGGIGTGSGRSIGGV 432

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK V  AV +G+L+KGGGHAMAAG+T+ +        + +K     V          I
Sbjct: 433 DLGKAVRQAVTDGVLLKGGGHAMAAGVTLRKERLAEFRAYMEKALAADVARSRHVRELFI 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A AV    +  L  AGP+GAGNP PV A P+H+L     V  AHL++ F+S D  
Sbjct: 493 DGAVSARAVTPEFVATLNRAGPFGAGNPEPVVALPSHQLIYADEVGQAHLRLRFKSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            +  IAFR  G PLG  L Q RG+ +HV G L V+ W+G++R QLRV D +
Sbjct: 553 IVNGIAFRAIGQPLGNVLTQMRGQPLHVAGSLAVDRWQGAERVQLRVSDVA 603


>gi|255264521|ref|ZP_05343863.1| single-stranded-DNA-specific exonuclease RecJ [Thalassiobium sp.
           R2A62]
 gi|255106856|gb|EET49530.1| single-stranded-DNA-specific exonuclease RecJ [Thalassiobium sp.
           R2A62]
          Length = 582

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 256/592 (43%), Positives = 354/592 (59%), Gaps = 10/592 (1%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           M D  FLGV  S++G RWV     +    A A+ Q   +P  + R LV R V    A  F
Sbjct: 1   MVDNGFLGVAASVTGRRWVGPTADQD-RLAQAMAQDSDLPLPICRTLVRRGVPAPEASAF 59

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L P++R LMPDP  L D ++AA R VQA+   EKI IF DYDVDG AS AL++ +L   +
Sbjct: 60  LTPALRDLMPDPRSLLDMERAALRCVQALKKREKIAIFADYDVDGGASAALLLAWLRAMN 119

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
            +A +YIPDRI +GYGPN + M+K  ++   LI+ VDCG+ S+  ++ A +   DV+V+D
Sbjct: 120 HDATLYIPDRIDEGYGPNDAAMKKLADQH-DLIVCVDCGTLSHGPIEAAQSA--DVVVLD 176

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HH       PA+++VNPNR D+     HLCAAGVVF++LV   R +RQD+      DL+S
Sbjct: 177 HHLGGETLPPAHSVVNPNRQDETGDLAHLCAAGVVFMMLVEANRQMRQDDV--KGPDLMS 234

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATV DV PLIGLNRA+V  GL V  ++   GL AL +   + +  T+ +LG++
Sbjct: 235 MLDLVALATVADVAPLIGLNRAFVRTGLQVMAQRKRIGLVALADVARMDAAPTSYHLGFL 294

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP +NAGGRIG +++G+RLL S D  E   LA +LD LN  RR +E  +   A  ++  
Sbjct: 295 LGPRVNAGGRIGAADMGARLLASTDMNEARALAERLDQLNSERREIEGQVRAAATDQMEQ 354

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +    Q A ++   GD WHPG+VG++A+R+KE+  RPS  I   +  +G GSGRS+ G D
Sbjct: 355 R---DQSAPLVWAAGDGWHPGVVGIIASRIKEQTNRPSIVIGL-DGDEGKGSGRSVSGID 410

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  +     EG+L+KGGGH MAAGLTV R           +         +     K+D
Sbjct: 411 LGAAIQRVAAEGLLIKGGGHKMAAGLTVARAQLEPAMARLSELLGKQGAGELGPSDLKLD 470

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           GVL  SA    LI  LE AGP+GAG   P FAFP+ ++   + V  +HL++TF       
Sbjct: 471 GVLMPSAATPELIAQLEQAGPFGAGASAPRFAFPDVQINFAKRVGDSHLKITFGDGMGAR 530

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           ++AI+F  +  PLG  L +  G R H+ G L +N W+G  R QLR+ DA+P 
Sbjct: 531 IEAISFGAFDGPLGPTLEKHGGARFHLAGRLEINSWQGRDRVQLRLEDAAPA 582


>gi|303238658|ref|ZP_07325191.1| single-stranded-DNA-specific exonuclease RecJ [Acetivibrio
           cellulolyticus CD2]
 gi|302593777|gb|EFL63492.1| single-stranded-DNA-specific exonuclease RecJ [Acetivibrio
           cellulolyticus CD2]
          Length = 829

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 208/582 (35%), Positives = 315/582 (54%), Gaps = 21/582 (3%)

Query: 15  GFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPL 73
              WV     E   + L I+++  I  ++A+V ++R +  +   K+FLNPS+  L  DP 
Sbjct: 4   NKLWVINKIPE--EKILKISKQCGISALLAKVFLSRGIEDEDYIKEFLNPSMNDLF-DPF 60

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +L D +KA  RI+ A+   EKI+IFGDYDVDG  S +++  FL     N   YIPDR  +
Sbjct: 61  LLRDMEKAVERIINAVEKKEKIIIFGDYDVDGITSTSILFDFLKKVGANVGYYIPDRKEE 120

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++K I++GA LIITVDCG T+++ +++     +D+I+ DHH+ K E   AYA
Sbjct: 121 GYGLSIIAVDKVIDDGASLIITVDCGITAFEEVRHIIESHVDIIITDHHECKEELPEAYA 180

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           L+NP R D       L   GVVF ++  +   +   ++       ++ LDLVAL TV DV
Sbjct: 181 LINPCRHDCSYPFKELAGVGVVFKLVKALCIKMGLTDES------VNYLDLVALGTVADV 234

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIG 312
           VPLI  NR  V  GL       N GLKALI+        IT+  +G+++ P INA GRIG
Sbjct: 235 VPLIEENRVIVKYGLQKIENTLNTGLKALIDVSGSKDKQITSYVIGFVLAPRINAAGRIG 294

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           +++   RLL +D+  E   +A +L   N  R+  E  +L +  A +  Q  D+ +  VIV
Sbjct: 295 DASRAVRLLTTDNEDEAAQIAKELSEQNTYRQETEHNILCEVMAGI-EQYVDLDKEKVIV 353

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           V G  WH GI+G++A+++ E + RP   I+  EDG G GSGRSIE F++    +      
Sbjct: 354 VWGKGWHHGIIGIVASKITESYNRPCILIT-VEDGMGKGSGRSIEEFNL--FKALMDSSS 410

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L K GGH +AAGLT++  N          +A++I+      P  KID  ++   ++   
Sbjct: 411 LLEKFGGHELAAGLTIKEDNIQEFKTKINAYANSILNDSDLVPKVKIDIEVSKEDISEES 470

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN-LAHLQMTFESQDSETLQAIAFRVYGT 551
           +  L+   P+GAGNP+PVFA+ N  ++ IR V    H+++TF  ++++   AI F     
Sbjct: 471 VRQLDLMSPFGAGNPSPVFAYRNLVIKDIRAVGNNKHIKITFRDKETD-FDAIGF--SRG 527

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            L E   +S    +     L +N W   +  QL + D    E
Sbjct: 528 YLAEVYSES--DILDAACSLEINSWNNRESVQLNIKDLKVCE 567


>gi|115524940|ref|YP_781851.1| single-stranded-DNA-specific exonuclease RecJ [Rhodopseudomonas
           palustris BisA53]
 gi|115518887|gb|ABJ06871.1| exonuclease RecJ [Rhodopseudomonas palustris BisA53]
          Length = 613

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 281/593 (47%), Positives = 370/593 (62%), Gaps = 3/593 (0%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
              AFLGV  S +G  W   L   G  RALAI Q++ +P+++ARVL  RNV ID   DFL
Sbjct: 12  TPLAFLGVTRSATGRIWRDRLDIRGTARALAIAQRYQLPEMLARVLAGRNVEIDAVADFL 71

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P+IR L+PDP  +T+ + AA+RI  A    E++ IFGDYDVDGA S AL+   L HC +
Sbjct: 72  DPTIRNLLPDPHTVTEMEAAAKRIADAALRGEQVAIFGDYDVDGATSAALLAWHLRHCGL 131

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
           +  ++IPDRI +GYGPN   +     +GA L++TVDCG+TS + L  A   G+ V+VIDH
Sbjct: 132 DPLIHIPDRIFEGYGPNVEAVRGLAQKGATLLVTVDCGTTSLEPLAEAAKLGMAVVVIDH 191

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDL 238
           HQ   E     ALVNPNR DDLSG GHL A G+VF+ LV + R LRQ           +L
Sbjct: 192 HQCGEELPIVEALVNPNRPDDLSGLGHLAAVGLVFVTLVAVNRELRQRGFWTTERPEPNL 251

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           L +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG
Sbjct: 252 LDMLHHVALGTVADVAPLIGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLG 311

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           +M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ 
Sbjct: 312 FMLGPRINAGGRIGRADLGVRLLLEGDISEAAKIAAELDRLNSERRVIEQMAEAQAEAEA 371

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
           L       + +VIV   + WHPG+VGL+A+RLKEKFGRP+FAI+ E  G G GSGRSI G
Sbjct: 372 LASLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFGRPAFAIALEPGGLGTGSGRSIPG 431

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+GK V  AV +G+LVKGGGHAMAAG+T+ +        + +      V          
Sbjct: 432 VDLGKAVRQAVIDGVLVKGGGHAMAAGVTLRKDKLAEFRGYIEAALSTDVARARHANELF 491

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           IDG ++A  V      ML  AGP+G+GNP PV A P+H+L     V  AHL++ F+S D 
Sbjct: 492 IDGAVSARGVTPDFAAMLNRAGPFGSGNPEPVIALPSHQLVYADEVGQAHLRLRFKSGDG 551

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
             +  IAFR  G  LG  L ++RG+ +HV G L ++ W+GS+R QLRV D + 
Sbjct: 552 AIVNGIAFRAIGQKLGNALAENRGQLLHVAGSLAIDRWQGSERVQLRVTDVAV 604


>gi|83954144|ref|ZP_00962864.1| single-stranded-DNA-specific exonuclease RecJ [Sulfitobacter sp.
           NAS-14.1]
 gi|83841181|gb|EAP80351.1| single-stranded-DNA-specific exonuclease RecJ [Sulfitobacter sp.
           NAS-14.1]
          Length = 579

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 244/588 (41%), Positives = 347/588 (59%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGV+ S++G RWV   G E       + Q+ ++P  + +VL  R V+ + A+ FL PS
Sbjct: 2   SFLGVDASLTGRRWVG-PGVEVERATEVLVQQTSLPLALCQVLARRGVAAEEAEAFLAPS 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D +KAA R + A+   ++I +F DYDVDG +S AL++ +L      A 
Sbjct: 61  LRDLLPDPRSLRDMEKAATRFLAAVKARQRIAVFADYDVDGGSSAALLLVWLREMGCAAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN + M   +     LI+ VDCG+ S+  +  A    +  +++DHH  
Sbjct: 121 LYVPDRIDEGYGPNDAAM-AELAAAHDLIVCVDCGTLSHGPVAAAVGADV--VILDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                 A A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL++LLDL
Sbjct: 178 GETLPDALAVVNPNRQDEDGALAHLCAAAVVFLMLVEAGRQLREAG--ARGPDLMALLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           V LATV DV PLIG+NRA+V +GL V  R+   GL AL +   + +   A +LG+++GP 
Sbjct: 236 VGLATVADVAPLIGVNRAFVRQGLRVMARRDRLGLAALADVARMDTAPAAYHLGFLLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG+++LG+RLL  DD  E + LA KLD+LN  RR +E+A+   A  +   +  D
Sbjct: 296 INAGGRIGQADLGARLLACDDPHEAQSLAEKLDLLNTERRDVETAVRAAALDQAEARGFD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G  WHPG+VG++A+RLKE   RPS  I F EDG G GSGRS+ G D+G  
Sbjct: 356 ---APLVWASGAGWHPGVVGIVASRLKEASNRPSIVIGF-EDGIGKGSGRSVSGIDLGAP 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV             +        L      K+DG+L 
Sbjct: 412 IQRLAAEGLLIKGGGHKMAAGLTVAEDKLDAAMARLSELLAKQGAHLAGAADLKLDGMLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
            +A  + L   +E AGP+GAG P P +AF + +++  + V  +HL+++F   ++  + AI
Sbjct: 472 PAAATVELAQQVEQAGPFGAGAPAPRYAFADMQIRFAKRVGESHLKISFGDGNNTKMDAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AF  +  PLG  L    G R H+ G L +N WRG +  QLR+ DA+P 
Sbjct: 532 AFGAFDGPLGPALENHGGARFHLAGRLDINTWRGRQSVQLRLEDAAPA 579


>gi|83942968|ref|ZP_00955428.1| single-stranded-DNA-specific exonuclease RecJ [Sulfitobacter sp.
           EE-36]
 gi|83845976|gb|EAP83853.1| single-stranded-DNA-specific exonuclease RecJ [Sulfitobacter sp.
           EE-36]
          Length = 579

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 243/588 (41%), Positives = 346/588 (58%), Gaps = 10/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGV+ S++G RWV   G E       + Q+ ++P  + +VL  R V+ + A+ FL PS
Sbjct: 2   SFLGVDASLTGRRWVG-PGVEVERATEVLVQQTSLPLALCQVLARRGVAAEEAEAFLAPS 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D +KAA R + A+   ++I +F DYDVDG +S AL++ +L      A 
Sbjct: 61  LRDLLPDPRSLRDMEKAATRFLAAVKARQRIAVFADYDVDGGSSAALLLVWLREMGCAAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +Y+PDRI +GYGPN + M +       LI+ VDCG+ S+  +  A    +  +++DHH  
Sbjct: 121 LYVPDRIDEGYGPNDAAMAELAA-SHDLIVCVDCGTLSHGPVAAAVGADV--VILDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                 A A+VNPNR D+     HLCAA VVFL+LV   R LR+        DL++LLDL
Sbjct: 178 GETLPDALAVVNPNRQDEDGALAHLCAAAVVFLMLVEAGRQLREAG--ARGPDLMALLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           V LATV DV PLIG+NRA+V +GL V  R+   GL AL +   + +   A +LG+++GP 
Sbjct: 236 VGLATVADVAPLIGVNRAFVRQGLRVMARRDRLGLAALADVARMDTAPAAYHLGFLLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG+++LG+RLL  DD  E + LA KLD+LN  RR +E+A+   A  +   +  D
Sbjct: 296 INAGGRIGQADLGARLLACDDPHEAQSLAEKLDLLNTERRDVETAVRAAALDQAEARGFD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G  WHPG+VG++A+RLKE   RPS  I F EDG G GSGRS+ G D+G  
Sbjct: 356 ---APLVWASGAGWHPGVVGIVASRLKEASNRPSIVIGF-EDGIGKGSGRSVSGIDLGAP 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV             +        L      K+DG+L 
Sbjct: 412 IQRLAAEGLLIKGGGHKMAAGLTVAEDKLDAAMARLSELLAKQGAHLAGAADLKLDGMLM 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
            +   + L   +E AGP+GAG P P +AF + +++  + V  +HL+++F   ++  + AI
Sbjct: 472 PATATVELAQQVEQAGPFGAGAPAPRYAFADMQIRFAKRVGESHLKISFGDGNNTKMDAI 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           AF  +  PLG  L    G R H+ G L +N WRG +  QLR+ DA+P 
Sbjct: 532 AFGAFDGPLGPALENHGGARFHLAGRLDINTWRGRQSVQLRLEDAAPA 579


>gi|311069247|ref|YP_003974170.1| putative single-strand DNA-specific exonuclease [Bacillus
           atrophaeus 1942]
 gi|310869764|gb|ADP33239.1| putative single-strand DNA-specific exonuclease [Bacillus
           atrophaeus 1942]
          Length = 786

 Score =  442 bits (1136), Expect = e-121,   Method: Composition-based stats.
 Identities = 186/593 (31%), Positives = 283/593 (47%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW      +   +  ++T++  I  +VA +LV R     + A+ FLN        D
Sbjct: 3   ASKMRWEIQRPDQD--KVKSLTEQLDITPLVASLLVKRGFDTAESARLFLNTKEADFY-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  +    +A  RI +AI   E IMI+GDYD DG  S ++M++ L   S + + YIPDR 
Sbjct: 60  PFEMKGMKEAVERIKEAISQQEPIMIYGDYDADGVTSTSVMLKTLQKLSAHVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN         +G  LIITVD G  +    + A   G+DVI+ DHH+        
Sbjct: 120 KEGYGPNEQAFRSIKEQGFSLIITVDTGIAAVHEAEAAKELGLDVIITDHHEPGPVLPDV 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A+V+P +         L   GV F +   +   L +D           LLDL A+ T+ 
Sbjct: 180 CAIVHPKQPGCAYPFKELAGVGVAFKLAHALLGALPED-----------LLDLAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL   NR     G+   R    PGLKALI+           E +G+ + P +NA GR
Sbjct: 229 DLVPLHDENRLLATLGMQKLRMTNRPGLKALIKLSGGDIGQANEETIGFQLAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL+++D  E + LA ++D LN+ R+ + S M ++A   V  Q       S 
Sbjct: 289 IEQADPAVHLLMTEDEFEADELATEIDQLNKERQKIVSKMTDEAIEMVEQQGL---NGSA 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L ++F RP+  +  +E+ G   GS RSI+GFD+    S + 
Sbjct: 346 IVVAKSGWNPGVVGIVASKLVDRFYRPAVVLGIDEEKGIAKGSARSIKGFDL--FKSLSS 403

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L D   + A   +      PV +ID V +   + 
Sbjct: 404 CTDILPHFGGHPMAAGMTLSADDVSDLRDRLNQIADETLTEEDFIPVQEIDLVCSVEDIT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  +    P+G  NP P     N  L+ +R +     H++MT + Q S  L  + F 
Sbjct: 464 VESISEINLLSPFGMQNPKPHVMVENALLEDVRRIGANKNHIKMTVKDQ-SAKLDCVGFH 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G R+ + G + +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGELETG----IVPGSRISLVGEMSINEWNNRKKPQLMIKDAAVSEWQLFDLR 571


>gi|296445858|ref|ZP_06887810.1| single-stranded-DNA-specific exonuclease RecJ [Methylosinus
           trichosporium OB3b]
 gi|296256686|gb|EFH03761.1| single-stranded-DNA-specific exonuclease RecJ [Methylosinus
           trichosporium OB3b]
          Length = 607

 Score =  441 bits (1135), Expect = e-121,   Method: Composition-based stats.
 Identities = 259/595 (43%), Positives = 358/595 (60%), Gaps = 6/595 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FLGVE S+SG  W   L      RA+AI+Q   + D++ARVL  R V+ + A  FL+PS+
Sbjct: 14  FLGVERSLSGRVWRPRLAAAEEGRAIAISQVLGLGDLLARVLAGRGVTQESAPAFLDPSL 73

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           R LMPDPL+L D D A  R+ +A+   E++ +FGDYDVDGAAS AL++ FL         
Sbjct: 74  RALMPDPLLLQDMDAAVDRLARAVETGEQVAVFGDYDVDGAASSALLVEFLQAAGCPPPF 133

Query: 126 -YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
            +IPDRI++GYGPN   + +    GA L++T+DCG+TS++AL +A   G+D IVIDHHQ 
Sbjct: 134 LHIPDRILEGYGPNVEAISELRRRGASLLVTLDCGTTSHEALAHARALGLDAIVIDHHQA 193

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSL 241
               +P   +VNPNR DDLSG GHLCAAGV F+ LV + R LR  +         +LL+ 
Sbjct: 194 PER-LPEAIVVNPNRADDLSGLGHLCAAGVAFMTLVALSRELRVRDFWTGVRPEPELLAA 252

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATV DV  L GLNRA+V KGL V + +   GL AL++   +  P    +LG+ +
Sbjct: 253 LDLVALATVADVAALHGLNRAFVTKGLAVMKGRRRVGLAALLDAARVDGPPRPMHLGFAL 312

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LG+RLL   D  E   +A +LD LN  R+ +E A LE+AEA+   Q
Sbjct: 313 GPRINAGGRIGDAALGARLLTLRDPIEAARIAAELDRLNGERQALERATLEEAEAEADRQ 372

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
                + S +VV G  WHPGIVG++A+RLK+KF  P+F I  +      GSGR+  G D+
Sbjct: 373 LMRSNRLSCLVVAGADWHPGIVGIVASRLKDKFKIPAFVIGQKGQS-CSGSGRASTGVDL 431

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G+ V  AVE G++ KGGGH  AAG+T+          F        V     +    +DG
Sbjct: 432 GRAVRRAVEAGVIEKGGGHRAAAGVTLAPPRIDAFRVFMNDALEEEVERARASDALLVDG 491

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            L A   +  L+  LE AGP+G+GNP P+F FP+H++    VV   H+++  +S D   L
Sbjct: 492 ALTARGADADLVRALERAGPFGSGNPEPLFVFPDHRIVDAGVVGSDHVRVRLQSGDGARL 551

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHH 596
            A+AFR  G  +GE L++ RG  +HV   +    +RG +R + R++D +  +   
Sbjct: 552 DAVAFRAVGNEIGEALLRGRGDLLHVAARIGTRVYRGVERMETRIVDLARADRRL 606


>gi|148255389|ref|YP_001239974.1| exonuclease RecJ [Bradyrhizobium sp. BTAi1]
 gi|146407562|gb|ABQ36068.1| exonuclease RecJ [Bradyrhizobium sp. BTAi1]
          Length = 613

 Score =  441 bits (1135), Expect = e-121,   Method: Composition-based stats.
 Identities = 279/592 (47%), Positives = 370/592 (62%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            QAFLGV  S++   W   L   G  RALA+ Q++ +P+++ARVL  R+V ID   DFL+
Sbjct: 13  PQAFLGVRLSLTNKLWRDRLDARGAARALAMVQRYQLPEMLARVLAGRDVDIDAVNDFLD 72

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+IR LMPDP  +T  + AA+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++
Sbjct: 73  PTIRKLMPDPFTVTQMEAAAKRIADAAVRGEKVAIFGDYDVDGATSAALLAWHLRHCGLD 132

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +     +GA L++TVDCG+TS + L  A   G+ V+VIDHH
Sbjct: 133 PLIHIPDRIFEGYGPNVEAIRALAGKGATLLVTVDCGTTSLEPLAEARRLGMSVVVIDHH 192

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV---PLNFDLL 239
           Q   E     ALVNPNR DDLSG G+L A G+  + LV + R LR            DLL
Sbjct: 193 QCGEELPEVEALVNPNRPDDLSGLGYLAAVGLTLVTLVAVNRELRGRGFWSGTRPEPDLL 252

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           S+L  VAL TV DV PLI LNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+
Sbjct: 253 SMLHHVALGTVADVAPLIALNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGF 312

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP INAGGRIG ++LG RLL+  D  E   +A +LD LN  RR++E     QAEA+ L
Sbjct: 313 MLGPRINAGGRIGRADLGVRLLLESDVSEAARIAAELDRLNSERRIIEQHAEAQAEAEAL 372

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + +VIV   + WHPG+VGL+A+RLKEKF RP+FAI+ E  G G GSGRSI G 
Sbjct: 373 ASLGLEDKGAVIVTASEGWHPGVVGLVASRLKEKFARPAFAIALEPGGIGTGSGRSIPGV 432

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+GK V  AVE+G+L+KGGGHAMAAG+T+ +        + +      V          I
Sbjct: 433 DLGKAVRHAVEQGLLIKGGGHAMAAGVTLRKERLAEFRAYLESALAADVAEARHVNEILI 492

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A A    L+  L  AGP+G+GNP P+ A P+H+L     V  AHL++ F+S D  
Sbjct: 493 DGAISARAATPELVATLNRAGPFGSGNPEPIVALPSHQLVYADEVGQAHLKLRFKSGDGA 552

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           T+ AIAFR  G  LG  L+Q RG+ +HV G L V+ ++G +R QLRVLD + 
Sbjct: 553 TVNAIAFRSVGQKLGNALVQHRGQVLHVAGTLTVDRYQGVERVQLRVLDVAV 604


>gi|56417161|ref|YP_154235.1| single-stranded-DNA-specific exonuclease [Anaplasma marginale str.
           St. Maries]
 gi|222475526|ref|YP_002563943.1| single-stranded-DNA-specific exonuclease (recJ) [Anaplasma
           marginale str. Florida]
 gi|255003512|ref|ZP_05278476.1| single-stranded-DNA-specific exonuclease (recJ) [Anaplasma
           marginale str. Puerto Rico]
 gi|255004634|ref|ZP_05279435.1| single-stranded-DNA-specific exonuclease (recJ) [Anaplasma
           marginale str. Virginia]
 gi|56388393|gb|AAV86980.1| single-stranded-DNA-specific exonuclease [Anaplasma marginale str.
           St. Maries]
 gi|222419664|gb|ACM49687.1| single-stranded-DNA-specific exonuclease (recJ) [Anaplasma
           marginale str. Florida]
          Length = 586

 Score =  441 bits (1135), Expect = e-121,   Method: Composition-based stats.
 Identities = 231/580 (39%), Positives = 327/580 (56%), Gaps = 14/580 (2%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           + G  W   + +        I Q+  I ++VARVL  R + I+  ++FL P++RLL+PDP
Sbjct: 17  VGGATW--RVCEVPCRDVTTIMQRFGICEVVARVLATRGIPIEEMENFLFPTLRLLLPDP 74

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             L D DKA  RI  AI N E I IFGDYDVDGA S A++ R+L    V+  +YIPDR+ 
Sbjct: 75  FHLLDMDKAVARIHDAIRNGESIAIFGDYDVDGATSSAMLCRYLRGLEVHTKIYIPDRVE 134

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN + M K   EG  L ITVDCG+ +Y+ +  A +  +DVIV+DHH   +    A 
Sbjct: 135 EGYGPNSAAMLKLREEGYSLCITVDCGTLAYEPILAARSVNLDVIVVDHHIGINTLPKAV 194

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATV 250
           A+VNPNRLD+ S   +L A G  FL+LV + + LR+          DL++ LDLVAL TV
Sbjct: 195 AVVNPNRLDESSEHTYLSAVGTSFLLLVALQKTLREAGVFAHRSEPDLMNYLDLVALGTV 254

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
           CDV+P+I LNRA V  GL V   + N GL+ L + + I   I+  +LG+ IGP INAGGR
Sbjct: 255 CDVMPMIKLNRAMVRHGLKVISARSNVGLRVLGDAIGIEEKISVYHLGFSIGPHINAGGR 314

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G ++LG+ LL SDD  E E ++  L  LN  R+ +E   LE+A  +             
Sbjct: 315 VGNASLGASLLSSDDESECERISYMLLSLNAERKELEKRSLEEALHQAERLVAAGNN--- 371

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           +++    WH G++G++A+RLKE+F  PS  +S      G  S RS+ G DIG  V  A  
Sbjct: 372 VIMVAGTWHVGVIGIVASRLKERFHLPSIVVSLSG-NLGKASARSVSGIDIGAAVLAAKL 430

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           E ++ +GGGHAMAAG +V       L      F            V    G+L A AVN 
Sbjct: 431 EQLIPEGGGHAMAAGFSVCADKLEALY----SFFLERFKHSDIQKVSYACGILTAGAVNF 486

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYG 550
            L   L+   P+G GNP P F   N +++   V+  +H++    S D+  ++ + F+  G
Sbjct: 487 PLWRELQMLEPFGPGNPEPRFILKNVEIRKPEVMGGSHVRC-LISGDNALVKGVCFKCIG 545

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           T LG  L+Q RG+ +H+ G + VN WRG++  Q  + DA+
Sbjct: 546 TELGTTLLQ-RGRCVHLLGKISVNQWRGNEYVQFVIDDAA 584


>gi|148559790|ref|YP_001259184.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ovis ATCC
           25840]
 gi|148371047|gb|ABQ61026.1| single-stranded-DNA-specific exonuclease RecJ [Brucella ovis ATCC
           25840]
          Length = 575

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 309/571 (54%), Positives = 387/571 (67%), Gaps = 2/571 (0%)

Query: 21  LLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDK 80
            LG    N ALAI Q H I D+VARVL  R VS++ A +F++P++R LMPDP  L D D 
Sbjct: 3   RLGPREANTALAIAQHHGISDLVARVLAGRGVSVEGAPEFVDPTLRNLMPDPATLNDMDN 62

Query: 81  AARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPS 140
           AA RI  AI   E + IFGDYDVDGA S ALM RFL H  V  ++YIPDRI +GYGPNP 
Sbjct: 63  AAGRIADAIQRRETVAIFGDYDVDGACSSALMARFLKHYGVQHSIYIPDRIFEGYGPNPD 122

Query: 141 LMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV-KSEEIPAYALVNPNR 199
            M +   +GA LI+TVDCG+ S  ++  A   G DV+V+DHHQV       A A+VNPNR
Sbjct: 123 AMRELAAKGASLIVTVDCGTNSVPSITAAKQAGADVVVLDHHQVGGDLPEDAVAIVNPNR 182

Query: 200 LDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGL 259
            DD+S QGHLCAAGVVFL LV + +ILR   K P   DLLS+LDLVALATVCDVVPL G+
Sbjct: 183 EDDISQQGHLCAAGVVFLALVQVAKILRARGKGP-GPDLLSMLDLVALATVCDVVPLKGV 241

Query: 260 NRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSR 319
           NRA+VVKGL+VAR Q N GL AL     I  P+ A +LGY+IGP INAGGRIG++ LG+R
Sbjct: 242 NRAFVVKGLLVARGQSNVGLAALARVARIGEPLNAFHLGYLIGPRINAGGRIGDAGLGAR 301

Query: 320 LLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWH 379
           LL  DD    + +AM+LD LNQ R+ ME+ ML +AEA+   +      ASVIV   DRWH
Sbjct: 302 LLTLDDPAMADRIAMELDRLNQERQAMEAEMLMEAEAEASLEISGGAGASVIVTASDRWH 361

Query: 380 PGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGG 439
           PGIVGLLA+RLKEK  RP+FAI+F  +G G GSGRSI G D+GK+V  AVE+G+LVKGGG
Sbjct: 362 PGIVGLLASRLKEKARRPAFAIAFNANGVGSGSGRSISGLDLGKLVRGAVEKGLLVKGGG 421

Query: 440 HAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESA 499
           HAMAAG+T+ER N G L  + ++ A +IV  L       IDG L AS   +AL + L+ A
Sbjct: 422 HAMAAGITIERGNLGALRAYLEEEAADIVSRLRENQSLSIDGALAASGATVALYEALQKA 481

Query: 500 GPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQ 559
           GPYG+ +P P+ A P+H L  +R V   H+++T    D + + AIAFR     LG FL  
Sbjct: 482 GPYGSAHPQPLLALPHHVLADVRGVGRDHVRVTLRGADGKRVNAIAFRAAEGDLGRFLFN 541

Query: 560 SRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + G  +HV G+L +N+W GS   Q+++LDA+
Sbjct: 542 NIGCSVHVAGNLSLNHWNGSVSPQIQILDAA 572


>gi|298207151|ref|YP_003715330.1| single-stranded-DNA-specific exonuclease recJ [Croceibacter
           atlanticus HTCC2559]
 gi|83849786|gb|EAP87654.1| single-stranded-DNA-specific exonuclease recJ [Croceibacter
           atlanticus HTCC2559]
          Length = 568

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 171/582 (29%), Positives = 276/582 (47%), Gaps = 26/582 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW     +    +  A++   ++P+ +A +LV R ++  D AK F  PS+  L  +P +L
Sbjct: 2   RWTLKP-KPDYTKVTALSAALSVPENIAALLVQRGITNYDEAKSFFRPSLSELH-NPFLL 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  RI +AI  SE I+++GDYDVDG  SVALM  FL   + N   YIPDR  +GY
Sbjct: 60  KDMDVAVTRIEKAIKESENILVYGDYDVDGTTSVALMSSFLKTKTPNVATYIPDRYDEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + D + YA  +G+D I+ DHH+   +   A A++
Sbjct: 120 GVSYKGIDFAADNDITLIIALDCGIKAIDKVAYAKEKGVDFIICDHHRPGKQIPDAIAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  I              DLL  LDLVA A   D+VP
Sbjct: 180 DPKRDDCNYPYKELCGCGVGFKLIQAINEQSG-----GTINDLLGYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL +       G  A+I++V     +T  ++ ++I P INA GR+   N
Sbjct: 235 MTGENRILAYHGLHIINTAPRMGFYAIIKQVK-KETLTITDVVFIIAPRINAAGRMKHGN 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   D       A +++  N++RR  + ++ E+A  ++       +     VV  
Sbjct: 294 HAVTLLTETDINLAAKYAQEIETFNKDRREADKSITEEALLQINDNS--EKDCKTTVVYH 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   + K   S RS++GFD+   +        + 
Sbjct: 352 ESWHKGVIGIVASRLTETYYRPTLVFTKSGE-KLAASARSVKGFDVYNALEAC--SKHIE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+   ++      F+K     +   + TP   ID  L+ + +      +
Sbjct: 409 QFGGHKYAAGLTLLEKDYENFKAEFEKVVSETIDERLLTPEINIDSELDLADITPKFFRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVNLA--HLQMTFESQ-----DSETLQAIAFR 547
           L+   P+G GN +P F   N +     + V     HL++  +       D   + AI F 
Sbjct: 469 LKQFAPFGPGNMHPTFMTKNVRDTGYGKCVGQDNAHLKLAVQPNNVPKSDKRGIGAIGFN 528

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           +      +  + +  K   +   +  N W G+   QL++ D 
Sbjct: 529 LGN----KCELTTDRKTFDIVYSIDENEWNGNVSLQLKLKDL 566


>gi|218530939|ref|YP_002421755.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           chloromethanicum CM4]
 gi|218523242|gb|ACK83827.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           chloromethanicum CM4]
          Length = 611

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 263/592 (44%), Positives = 355/592 (59%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGIN-RALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            + FL V  S  G  W    G  G+   A+ +TQ + +PD++ARVLV R V    A  +L
Sbjct: 18  PRPFLDVTASALGRPWRERCGDPGLQALAVTMTQAYGLPDLLARVLVGRGVRPAEADAYL 77

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP +L D + A  R+  A+   E + IFGDYDVDGA+S AL+  +L    V
Sbjct: 78  APRLRDLMPDPSVLVDMEAAVERLAHAVRAREAVAIFGDYDVDGASSAALLADYLRALGV 137

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   +     EGA L++ VDCG+  ++ L  A   G+DVIV+DH
Sbjct: 138 PVRIHIPDRITEGYGPNVGAVTTLREEGAGLLVCVDCGTAGHEPLAAAAALGLDVIVLDH 197

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLL 239
           H    E     ALVNPNRLDDLSG GHLCAAGVVF+ LV + R LR+D          L 
Sbjct: 198 HGAPEELPQTRALVNPNRLDDLSGLGHLCAAGVVFMTLVALARRLRRDRVFATSAEPRLT 257

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDLVALATV DVVPL GLNRA+VV+GL V R +G PGL AL++   +S P  A +LG+
Sbjct: 258 DFLDLVALATVADVVPLTGLNRAFVVQGLAVMRGRGRPGLAALLDAAGLSEPPEAWHLGF 317

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIG++ LG+RLL + D  E   +A +LD LN+ R+ +E+  + +AEA++ 
Sbjct: 318 LVGPRINAGGRIGDAGLGARLLTTADPMEARRIADELDRLNRERQAIEAQAVAEAEAEMD 377

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                     V++     WHPGIVGL+AARLKE+FGRP+FA + + DG  +GSGRS+ G 
Sbjct: 378 AHLTRDPDRPVLIAASPEWHPGIVGLIAARLKERFGRPAFAFAVKPDGSAVGSGRSVVGA 437

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G  V  AVE G+ VKGGGHAMAAG+T+         +         V          I
Sbjct: 438 DLGGAVRSAVEAGLAVKGGGHAMAAGVTLPPGGLAAFGESLTHDLVEAVGRARAAEALLI 497

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A      L+ +++ AGP+G G P PV A P H++    +V   H++    S D +
Sbjct: 498 DGTVSAGGATAELVRLIQRAGPFGQGAPEPVMALPRHRVVDAGIVGNGHVRARLVSGDGQ 557

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
            + AIAFR    PLG  L+   G+  HV G L  + WRG++R Q+R+ D +P
Sbjct: 558 AVGAIAFRAAQGPLGVALLGGIGRSFHVAGTLSCDRWRGAERAQVRICDVAP 609


>gi|157827557|ref|YP_001496621.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia bellii
           OSU 85-389]
 gi|157802861|gb|ABV79584.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia bellii
           OSU 85-389]
          Length = 585

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 229/586 (39%), Positives = 335/586 (57%), Gaps = 13/586 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W      E I   + + +   I D++AR++  R   I  A+DFL P I+ L+
Sbjct: 4   QASINGKIWQRRSVNEEI--VIELCRSFKISDLLARMISLRIDDIAKAEDFLMPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D  KA  R ++AI + +KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMQKAVDRAIKAILSKQKICIFADYDVDGATSSALLKNVFKDLNIVCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP PS M+K  + G +L+ITVDCG+ +++AL+YA + G+DVIVIDHH       
Sbjct: 122 RIAEGYGPTPSAMQKIKDNGTELLITVDCGAMAHEALKYAKDAGLDVIVIDHHIATEILP 181

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLLSLLDLVAL 247
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N        +L+  LDLVAL
Sbjct: 182 EAVAIVNPNRVDETSECKHLAAVGVAFLFATGILSDLKRQNYFEKTLPPNLMKYLDLVAL 241

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCD+V LIGLNRA+V  GL +  ++ N G+K L +   ++      +LG+++GP INA
Sbjct: 242 GTVCDMVKLIGLNRAFVSSGLKIMHQRQNIGIKTLYDMAGLNEIPKCYHLGFILGPHINA 301

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGR+G+S+LG+ LL ++ S E   LA +L+  N  R+++E  M+E+A     TQ    Q 
Sbjct: 302 GGRVGKSSLGANLLSTNCSNEALKLAEELEKHNNERKVIEMLMIEEAMEMAKTQ----QD 357

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
            S++ +  + WHPG++G++A RLKEKF +P   I+  + G G  S RSI G D G  +  
Sbjct: 358 NSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEIIN 416

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           A  + +L+ GGGHAMAAG TV       L +F        +  L      + D  L+ S+
Sbjct: 417 AKVKNLLITGGGHAMAAGFTVAAEKIQELQEFLNNAFRISLNRLENYKQAEYDLDLSLSS 476

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF----ESQDSETLQA 543
           V++ L++ L +  P+G GN  P+F F N  +    +V   H++  F    +S  S+ LQA
Sbjct: 477 VHLPLMEELSTLEPFGQGNYEPIFKFDNLFVLKADIVGSKHIRCLFAPNKKSSSSKALQA 536

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           IAF   GT   E L+  +   + V G L  N W+ +   QL + D 
Sbjct: 537 IAFNSLGTSFEEVLLSPKAHNISVLGTLKTNNWQNNYTIQLIIKDV 582


>gi|91205110|ref|YP_537465.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia bellii
           RML369-C]
 gi|91068654|gb|ABE04376.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia bellii
           RML369-C]
          Length = 585

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 229/586 (39%), Positives = 335/586 (57%), Gaps = 13/586 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W      E I   + + +   I D++AR++  R   I  A+DFL P I+ L+
Sbjct: 4   QASINGKIWQRRSVNEEI--VIELCRSFKISDLLARMISLRIDDIAKAEDFLMPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D  KA  R ++AI + +KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMQKAVDRAIKAILSKQKICIFADYDVDGATSSALLKNVFKDLNIVCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP PS M+K  + G +L+ITVDCG+ +++AL+YA + G+DVIVIDHH       
Sbjct: 122 RIAEGYGPTPSAMQKIKDNGTELLITVDCGAMAHEALKYAKDAGLDVIVIDHHIATEILP 181

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLLSLLDLVAL 247
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N        +L+  LDLVAL
Sbjct: 182 EAVAIVNPNRVDETSECKHLAAVGVAFLFATGILSDLKRQNYFEKTLPPNLMKYLDLVAL 241

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCD+V LIGLNRA+V  GL +  ++ N G+K L +   ++      +LG+++GP INA
Sbjct: 242 GTVCDMVKLIGLNRAFVSSGLKIMHQRQNIGIKTLYDMAGLNEIPKCYHLGFILGPRINA 301

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGR+G+S+LG+ LL ++ S E   LA +L+  N  R+++E  M+E+A     TQ    Q 
Sbjct: 302 GGRVGKSSLGANLLSTNCSNEALKLAEELEKHNNERKVIEMLMIEEAMEMAKTQ----QD 357

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
            S++ +  + WHPG++G++A RLKEKF +P   I+  + G G  S RSI G D G  +  
Sbjct: 358 NSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEIIN 416

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           A  + +L+ GGGHAMAAG TV       L +F        +  L      + D  L+ S+
Sbjct: 417 AKVKNLLITGGGHAMAAGFTVAAEKIQELQEFLNNAFRISLNRLENYKQAEYDLDLSLSS 476

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF----ESQDSETLQA 543
           V++ L++ L +  P+G GN  P+F F N  +    +V   H++  F    +S  S+ LQA
Sbjct: 477 VHLPLMEELSTLEPFGQGNYEPIFKFDNLFVLKADIVGSKHIRCLFAPNKKSSSSKALQA 536

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           IAF   GT   E L+  +   + V G L  N W+ +   QL + D 
Sbjct: 537 IAFNSLGTSFEEVLLSPKAHNISVLGTLKTNNWQNNYTIQLIIKDV 582


>gi|291485171|dbj|BAI86246.1| hypothetical protein BSNT_04007 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 786

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 189/593 (31%), Positives = 284/593 (47%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW      +   +  ++T++  I  +VA +LV R     + A+ FL+        D
Sbjct: 3   ASKMRWEIQRPDQD--KVKSLTEQLHITPLVASLLVKRGFDTAESARLFLHTKDADFY-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  +    +AA RI QAI   EKIMI+GDYD DG  S ++M+  L   S   + YIPDR 
Sbjct: 60  PFEMKGMKEAADRIKQAISQQEKIMIYGDYDADGVTSTSVMLHTLQKLSAQVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN        + G  LIITVD G  +    + A   G+DVI+ DHH+   E    
Sbjct: 120 KEGYGPNEQAFRSIKDRGFSLIITVDTGIAAVHEAKVAKELGLDVIITDHHEPGPELPDV 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           +A+V+P +         L   GV F +   +   L              LLDL A+ T+ 
Sbjct: 180 HAIVHPKQPGCTYPFKELAGVGVAFKLAHALLGELPD-----------ELLDLAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL   NR     GL   RR    GLK LI+           E +G+ + P +NA GR
Sbjct: 229 DLVPLHDENRLIATLGLERLRRTNRLGLKELIKLSGGDIGEANEETVGFQLAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL+S+DS E E LA ++D LN+ R+ M S M ++A   V  Q  D      
Sbjct: 289 IEQADPAVHLLMSEDSFEAEELAAEIDQLNKERQKMVSKMTDEAIEMVEQQGLDQT---A 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L ++F RP+  +  +E+ G   GS RSI GF++    S + 
Sbjct: 346 IVVAKAGWNPGVVGIVASKLVDRFYRPAIVLGIDEEKGIAKGSARSIRGFNL--FESLSE 403

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T++  +   L     + A N +      PV ++D V +   + 
Sbjct: 404 CRDILPHFGGHPMAAGMTLKAEDVPDLRSRLNEIADNTLTEEDFIPVQEVDLVCSIEDIT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  +    P+G  NP P     N  L+ +R +     H++MT  ++ S+ L  + F 
Sbjct: 464 VESIAEMNMLSPFGMLNPKPHVLVENAVLEDVRKIGANKTHVKMTIRNESSQ-LDCVGFN 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G R+ + G + +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGELQEG----IVPGSRISIVGEMSINEWNNRKKPQLMIKDAAVSEWQLFDLR 571


>gi|321312290|ref|YP_004204577.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus subtilis
           BSn5]
 gi|320018564|gb|ADV93550.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus subtilis
           BSn5]
          Length = 786

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 189/593 (31%), Positives = 284/593 (47%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW      +   +  ++T++  I  +VA +LV R     + A+ FL+        D
Sbjct: 3   ASKMRWEIQRPDQD--KVKSLTEQLHITPLVASLLVKRGFDTAESARLFLHTKDADFY-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  +    +AA RI QAI   EKIMI+GDYD DG  S ++M+  L   S   + YIPDR 
Sbjct: 60  PFEMKGMKEAADRIKQAISQQEKIMIYGDYDADGVTSTSVMLHTLQKLSAQVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN        + G  LIITVD G  +    + A   G+DVI+ DHH+   E    
Sbjct: 120 KEGYGPNEQAFRSIKDRGFSLIITVDTGIAAVHEAKVAKELGLDVIITDHHEPGPELPDV 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           +A+V+P +         L   GV F +   +   L              LLDL A+ T+ 
Sbjct: 180 HAIVHPKQPGCTYPFKELAGVGVAFKLAHALLGELPD-----------ELLDLAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL   NR     GL   RR    GLK LI+           E +G+ + P +NA GR
Sbjct: 229 DLVPLHDENRLIATLGLERLRRTNRLGLKELIKLSGGDIGEANEETVGFQLAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL+S+DS E E LA ++D LN+ R+ M S M ++A   V  Q  D      
Sbjct: 289 IEQADPAVHLLMSEDSFEAEELAAEIDQLNKERQKMVSKMTDEAIEMVEQQGLDQT---A 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L ++F RP+  +  +E+ G   GS RSI GF++    S + 
Sbjct: 346 IVVAKAGWNPGVVGIVASKLVDRFYRPAIVLGIDEEKGIAKGSARSIRGFNL--FESLSE 403

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T++  +   L     + A N +      PV ++D V +   + 
Sbjct: 404 CRDILPHFGGHPMAAGMTLKAEDVPDLRSRLNEIADNTLTEEDFIPVQEVDLVCSVEDIT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  +    P+G  NP P     N  L+ +R +     H++MT  ++ S+ L  + F 
Sbjct: 464 VESIAEMNMLSPFGMLNPKPHVLVENAVLEDVRKIGANKTHVKMTIRNESSQ-LDCVGFN 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G R+ + G + +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGELQEG----IVPGSRISIVGEMSINEWNNRKKPQLMIKDAAVSEWQLFDLR 571


>gi|190571037|ref|YP_001975395.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019558|ref|ZP_03335364.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|190357309|emb|CAQ54738.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212994980|gb|EEB55622.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 579

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 232/587 (39%), Positives = 341/587 (58%), Gaps = 16/587 (2%)

Query: 6   FLGVEC-SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
            L +E  SI+   W     +        + Q+  +P+I+AR+LV R V+I+ A DFL+P 
Sbjct: 2   LLDIEKRSITNALWKLQ--EADQREIFTLIQRFELPEILARILVARGVNIENAHDFLHPL 59

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR L+PDP  L D DKA   I++AI N+E I IFGDYDVDGA S AL+ R+L     ++ 
Sbjct: 60  IRSLLPDPFHLLDMDKAVSHIIKAINNNENIAIFGDYDVDGATSSALINRYLRAIGTHSI 119

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDR+ +GYG N   + +    G  L I+VDCG+ +Y  ++ A   G+D+IV+DHH  
Sbjct: 120 IYIPDRVDEGYGLNTDALLQLKKNGIDLCISVDCGTLAYQPIEDAKVFGLDIIVVDHHLG 179

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLL 242
             +   A A+VNPNRLD+ S   +L A GV FL++V + RILR+          DL  LL
Sbjct: 180 TEKLPSAVAVVNPNRLDESSPYNNLAAVGVSFLLIVALNRILREQGFFTNKKEPDLFDLL 239

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVAL TVCDV+ + GLNRA+V++GL V   + N GL+ L + + I    +   LG+ IG
Sbjct: 240 DLVALGTVCDVMQITGLNRAFVLQGLKVMSARKNVGLRVLFDALGILEKPSVSRLGFSIG 299

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIGE++LG+RLL +DD  +   +A+KL  LN  R+++E+  + +A  +     
Sbjct: 300 PCINAGGRIGEASLGARLLSTDDDDDAHSIALKLIDLNNARKMLENEAILEATTQAENFA 359

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
                    ++    WH GI+G++A+RLKE+F  P+  IS   +G G  S RSI G DIG
Sbjct: 360 HLGVN---FIMVSGNWHQGIIGIIASRLKEQFHLPTIVIS-LNNGIGKASCRSISGVDIG 415

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
             V  A    ++++GGGH+MAAG +++      L DFF +   N         + K DG+
Sbjct: 416 AAVLSAKFTNLIIEGGGHSMAAGFSIKEDKISDLHDFFTERFANSTND----KIIKADGI 471

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + A A+N++L + L+   P+GAGNP P F     K++   V+ + H++      D+  ++
Sbjct: 472 VTAKAINLSLWNQLQRLEPFGAGNPEPRFIIQGAKIRKPEVIGVDHIKCFIAD-DNVMVK 530

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAFR   T LG  +MQ   K   + G + +NYW G++  Q  + D 
Sbjct: 531 AIAFRCANTELGSAIMQGNVKA--ILGKISMNYWNGNEFVQFLIEDV 575


>gi|294678579|ref|YP_003579194.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           capsulatus SB 1003]
 gi|294477399|gb|ADE86787.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter
           capsulatus SB 1003]
          Length = 577

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 245/587 (41%), Positives = 339/587 (57%), Gaps = 15/587 (2%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FL V+ S++G RWV    +     A A+ Q   +P  +ARVLV R V+ + A  FL P+
Sbjct: 3   SFLNVDTSLTGRRWVGPSLEAD-RLAEAMAQATHLPLPLARVLVARGVTPEAAAGFLEPT 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D +KAA R ++A+ + EKI IF DYDVDG +S AL++ FL    V   
Sbjct: 62  LRDLLPDPHRLKDMEKAAARFLRALRSREKIAIFADYDVDGGSSAALLICFLRAFGVTPT 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M+  +     LI+ VDCG+ S+  +  A    +  +++DHH  
Sbjct: 122 LYIPDRIDEGYGPNVPAMQA-LGREHGLIVCVDCGTLSHAPVAAAAPADV--VILDHHLG 178

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                PA A VNPNR D+    GHLCAA VVFL+LV   R LR +       DL+++LDL
Sbjct: 179 GETLPPAVACVNPNRQDEPGDLGHLCAASVVFLMLVEANRQLRAEGV--KGPDLMAMLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+G+NRA V +GL V  R+  PGL AL +   +    TA +LG+++GP 
Sbjct: 237 VALATVADVAPLLGVNRALVRQGLKVMARRERPGLVALSDVARLDKAPTAYHLGFLLGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG ++LG+RLL +D + E   LA +LD LN  RR +E+ + + A  +   +  D
Sbjct: 297 VNAGGRIGAADLGARLLSTDSAAEAAALAERLDRLNSERREIENRVRDAALTQAEARGLD 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
                ++   G+ WHPG+VG++AARLKE   RP+  I   E G G GS RS+ G D+G  
Sbjct: 357 G---PLVWAAGEGWHPGVVGIVAARLKEATNRPAVVIG-LEGGLGKGSARSVAGVDLGAA 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLC-DFFQKFAHNIVPALITTPVFKIDGVL 483
           V     EG+L+KGGGH MAAGLT+ R    R                       ++DG+L
Sbjct: 413 VQRVAAEGLLLKGGGHRMAAGLTLPRAVEPRWKAAECSPGRARHGGPADL----RLDGLL 468

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
              A   ALI+ L+ AGPYG   P+P FAFP   + + R +  +HL+++F       L A
Sbjct: 469 MPGAATPALIEDLDRAGPYGQAAPSPRFAFPAMAILNARRIGESHLRLSFGDGLGAKLDA 528

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAF  +  PLG  L      R H+ G L ++ W G  + QLR+ DA+
Sbjct: 529 IAFGAFDGPLGPALSAGGAGRFHLAGKLELDSWGGRSKVQLRLDDAA 575


>gi|296532974|ref|ZP_06895629.1| single-stranded-DNA-specific exonuclease RecJ [Roseomonas
           cervicalis ATCC 49957]
 gi|296266697|gb|EFH12667.1| single-stranded-DNA-specific exonuclease RecJ [Roseomonas
           cervicalis ATCC 49957]
          Length = 599

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 243/599 (40%), Positives = 335/599 (55%), Gaps = 14/599 (2%)

Query: 1   MND---QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYA 57
           M D   +A LGV  S+ G RWV    Q      +AI Q+  +P+++ ++L  R V+ + A
Sbjct: 8   MTDPAGEAVLGVTRSVLGRRWVWR--QADTRIGMAIAQRLDLPELLGQLLAARGVTPEQA 65

Query: 58  KDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLS 117
             FL P++R L+PDP +L D D+AA R+ QA+   E + +FGDYDVDGA++ ALM+RFL 
Sbjct: 66  ALFLEPTLRALLPDPSVLVDMDRAAERLAQAVRAREPVAVFGDYDVDGASAGALMLRFLR 125

Query: 118 HCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVI 177
                   Y+PDR+ +GYGPNP  +    + GA L++ VDCG  ++ AL+ A  +  DV+
Sbjct: 126 DLGCPVRHYVPDRLKEGYGPNPGAIAALCDGGATLLVCVDCGIAAHAALEAARGR-ADVV 184

Query: 178 VIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLN 235
           V+DHH+ +       A VNPNRLD  SG  HLCAA V F+  V   R LR+         
Sbjct: 185 VLDHHKAEGPVPVVAAAVNPNRLDCGSGLKHLCAAAVSFMAAVATLRALRRSGFFEGREP 244

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DL  LLDLVALATVCDV+PL GLNRA+V +GL V  R   PG+ AL+E        +A 
Sbjct: 245 PDLRDLLDLVALATVCDVMPLTGLNRAFVTQGLKVMARGERPGIAALLEVAQAREAPSAY 304

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
            LG+++GP INA GRIGE +LG RLL  DD  E  ++A +LD +N+ R+ +ES +L  A 
Sbjct: 305 TLGFLLGPRINASGRIGEPDLGLRLLACDDPVEARIMAERLDAVNRRRQEVESEVLAAAF 364

Query: 356 AKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRS 415
           A+   Q        V+++ G+ WHPG+VG++A R+KEKF RP+   +   DG   GSGRS
Sbjct: 365 AQAEAQAGAGH--PVLLICGEGWHPGVVGIVAGRVKEKFNRPTCV-AGISDGLAKGSGRS 421

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           + G D+G  V  A + G+L  GGGHAMAAG +           F  +        L  + 
Sbjct: 422 VPGIDLGAAVIAARQSGLLETGGGHAMAAGFSFRLERQEEFHAFLNERLS-HAADLPGSA 480

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL--AHLQMTF 533
              +DG L   A    L   +   GP+GAGN  PVF FP  ++     V      ++   
Sbjct: 481 DLVVDGTLRVPAATAELATQVARLGPFGAGNEEPVFIFPRVRVVRADRVGKEGNTVRAFL 540

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           E +    L+AI FR    PL E L+ SRG  +H+ G L   +W G+    L V D +P 
Sbjct: 541 EGEGGGRLKAICFRAKEGPLAELLLNSRGVPVHLAGALRAEHWNGNVSAGLHVQDGAPA 599


>gi|296331693|ref|ZP_06874162.1| putative single-strand DNA-specific exonuclease [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305675348|ref|YP_003867020.1| putative single-strand DNA-specific exonuclease [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151288|gb|EFG92168.1| putative single-strand DNA-specific exonuclease [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305413592|gb|ADM38711.1| putative single-strand DNA-specific exonuclease [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 786

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 187/593 (31%), Positives = 281/593 (47%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW      +   +  ++T++  I  +VA +LV R     + A+ FL+        D
Sbjct: 3   ASKMRWEIQRPDQD--KVKSLTEQLHITPLVASLLVKRGFDTAESARLFLHTKDADFY-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  +    +A  RI QAI   E+IMI+GDYD DG  S ++M+  L   S   + YIPDR 
Sbjct: 60  PFEMKGMKEAVDRIKQAISQQEQIMIYGDYDADGVTSTSVMLHTLQKLSAQVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN          G  LIITVD G  +    + A   G+DVI+ DHH+   E    
Sbjct: 120 KEGYGPNEQAFRSIKERGFSLIITVDTGIAAVHEAKVAKELGLDVIITDHHEPGPELPNV 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           +A+V+P +         L   GV F +   +   L              LLDL A+ T+ 
Sbjct: 180 HAIVHPKQPGCTYPFKELAGVGVAFKLAHALLGELPD-----------ELLDLAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL   NR     GL   RR    GLK L++           E +G+ I P +NA GR
Sbjct: 229 DLVPLHDENRLIATLGLERLRRTNRLGLKELVKLSGGDIGEANEETVGFQIAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL+S+DS E E LA ++D LN+ R+ M S M ++A   V  Q  D      
Sbjct: 289 IEQADPAVHLLMSEDSFEAEELAAEIDQLNKERQKMVSKMTDEAIEMVEQQGLDQT---A 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L ++F RP+  +  +E+ G   GS RSI GF++    S + 
Sbjct: 346 IVVAKSGWNPGVVGIVASKLVDRFYRPAIVLGIDEEKGIAKGSARSIRGFNL--FESLSE 403

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L +   + A N +      PV ++D V     + 
Sbjct: 404 CRDILPHFGGHPMAAGMTLNAEDVPDLRNRLNEIADNTLTEEDFIPVQEVDLVCGVEDIT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  +    P+G  NP P     N  L+ +R +     H++MT  ++ S+ L  + F 
Sbjct: 464 VESITEMNLLSPFGMLNPKPHVLVENAVLEDVRKIGANKNHVKMTVRNESSQ-LDCVGFN 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G R+ + G + +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGELEEG----IVPGSRISIVGEMSINEWNNRKKPQLMIKDAAVSEWQLFDLR 571


>gi|86144179|ref|ZP_01062516.1| single-stranded-DNA-specific exonuclease RecJ [Leeuwenhoekiella
           blandensis MED217]
 gi|85829441|gb|EAQ47906.1| single-stranded-DNA-specific exonuclease RecJ [Leeuwenhoekiella
           blandensis MED217]
          Length = 563

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 175/578 (30%), Positives = 275/578 (47%), Gaps = 21/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E   +  A  ++ AIP+ +A++L+ R V   D AK F  PS+  L  DP ++
Sbjct: 2   RWTLKPIPE-TEKINAFAKQLAIPEKIAQLLIQRGVDTYDKAKAFFRPSLEDLH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA  RI  AI  +E I+++GDYDVDG  SVALM  +L         YIPDR  +GY
Sbjct: 60  KDMDKAVARINSAIAQNENILVYGDYDVDGTTSVALMSSYLKTLHPQVATYIPDRYAEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G + + ++   +    LI+ +DCG  + + + YA   GID I+ DHH+  +E   A A++
Sbjct: 120 GVSYTGIDYAHDNDITLIVALDCGVKAIEKVAYAKKLGIDFIICDHHRPGAEIPEAVAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  + +             L+  LDLVA A   D+VP
Sbjct: 180 DPKREDCDYPYKELCGCGVGFKLIQAMEQEKGL-----PVKTLVPYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V       G++ALIE VN    +T  ++ ++I P INA GRI    
Sbjct: 235 ITGENRVLAFYGLDVINTLPRTGIQALIENVNKDE-LTITDVVFIIAPRINAAGRIKHGL 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   D +  + +A  ++  N  R+ ++  + ++A  ++  + +  +     VV  
Sbjct: 294 HAVELLTEQDYERAQEMASGIEGFNAERKDLDKVITQEALLQI--ETNKEENRKTTVVFQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   + K   S RS++GFD+   +    E   + 
Sbjct: 352 ENWHKGVIGIVASRLTETYYRPTLVFTKSGE-KLAASARSVKGFDVYDALEQCSEH--IE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+    +      F++   + +   +  P   ID  L    +      +
Sbjct: 409 QFGGHKYAAGLTLGEHQYEGFKQKFEEVVSSSIDERLLIPEITIDAELELDDITPKFYRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVN--LAHLQMTFESQDSETLQAIAFRVYGTP 552
           L    PYG GN  PVF   N       + V     HL+ +     S+T+ AI F +    
Sbjct: 469 LRQFAPYGPGNMTPVFMSKNLTDTGYGKCVGADETHLKCSVTQNGSQTIGAIGFGLG--- 525

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +  +    K       L +N W G+K  QL++ D  
Sbjct: 526 -SKCDLIQHKKPFKAAYSLDINEWNGTKSIQLKLRDIQ 562


>gi|170749204|ref|YP_001755464.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655726|gb|ACB24781.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           radiotolerans JCM 2831]
          Length = 605

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 264/594 (44%), Positives = 358/594 (60%), Gaps = 4/594 (0%)

Query: 5   AFLGVECSISGFRWVSLLG-QEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
            FLGV  S++G RW    G     N+   + Q H +P+++ARVL  R +  + A   L P
Sbjct: 12  PFLGVAASVTGRRWQERCGGAAVQNQIAKMVQAHGLPELLARVLAGRGIVPEAAPRHLAP 71

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
            +R LMPDP  L D + A RR+V+A+   E + +FGDYDVDGAAS AL+  +L +  + A
Sbjct: 72  RLRDLMPDPDTLLDMEAAVRRLVRAVKRGETVAVFGDYDVDGAASAALLAGYLRNLGLRA 131

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            ++IPDRI +GYGPN + +     EGA L++ VDCG++ +  L+ A   G+DVIV+DHH 
Sbjct: 132 PIHIPDRITEGYGPNVAAITALAAEGATLLVCVDCGTSGHAPLEEAEKFGLDVIVLDHHA 191

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN---FDLLS 240
                 PA A+VNPNRLDDLSG GHLCAAG+VFL LV + R LRQ+     +     L  
Sbjct: 192 ASEILPPARAVVNPNRLDDLSGLGHLCAAGIVFLTLVALNRALRQEGFFGSHRPEPQLTD 251

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLVALATV DVVPL GLNRA+V +GL V R +G  GL AL++  ++  P  A +LG++
Sbjct: 252 ALDLVALATVADVVPLTGLNRAFVTQGLTVMRHRGRTGLAALLDAASLGEPPEAWHLGFV 311

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG+S LG+RLL + D  E   +A  LD LN+ R+ +E+  + +AEA++  
Sbjct: 312 LGPRINAGGRIGDSALGARLLTTADPGEAARIAADLDRLNRERQAIEAQAVLEAEAEMDR 371

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                   +V+V     WHPGIVGL+A+RLKE+F RP+FA +   DG   GSGRSI G D
Sbjct: 372 ALTLDPDRTVLVTASADWHPGIVGLIASRLKERFNRPAFAFAIRPDGTATGSGRSIPGAD 431

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  V   VE  +  KGGGHAMAAG+TV   +  R            V          ID
Sbjct: 432 LGLAVRACVEARLASKGGGHAMAAGVTVRADDIPRFEAHLAMLLGASVAVARAADALLID 491

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G L+A       + +L+ AGP+G G P P+FA   H+L    VV  +H++    S+D + 
Sbjct: 492 GGLSAGGATAETVRLLQRAGPFGQGAPEPIFALGRHRLVDAGVVGSSHVRARLRSRDGQV 551

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
           + AI FR    PLG  L+   G+ MHV G L  + WRG++R QLR++D +P E 
Sbjct: 552 VGAICFRAAERPLGLALLNGIGREMHVAGTLSCDRWRGAERAQLRIVDLAPSES 605


>gi|269958438|ref|YP_003328225.1| single-stranded-DNA-specific exonuclease RecJ [Anaplasma centrale
           str. Israel]
 gi|269848267|gb|ACZ48911.1| single-stranded-DNA-specific exonuclease RecJ [Anaplasma centrale
           str. Israel]
          Length = 586

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 231/580 (39%), Positives = 327/580 (56%), Gaps = 14/580 (2%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           + G  W   + +        I Q+  I ++VARVL  R + I+  ++FL P++RLL+PDP
Sbjct: 17  VGGATW--RVSEVPCRDVTTIMQRFGICEVVARVLATRGIPIEEMENFLFPTLRLLLPDP 74

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             L D DKA  RI  AI N E I IFGDYDVDGA S A++ R+L    V+  +YIPDR+ 
Sbjct: 75  FHLLDMDKAVARIHDAIRNGESIAIFGDYDVDGATSSAMLCRYLRGLEVHTKIYIPDRVE 134

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN + M K   EG  L ITVDCG+ +Y+ +  A +  +DVIV+DHH   +    A 
Sbjct: 135 EGYGPNSAAMLKLREEGYSLCITVDCGTLAYEPILAARSVNLDVIVVDHHIGINTLPKAV 194

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATV 250
           A+VNPNRLD+ S   +L A G  FL+LV + + LR+          DL++ LDLVAL TV
Sbjct: 195 AVVNPNRLDESSEHTYLSAVGTSFLLLVALQKTLREAGVFAHRSEPDLMNYLDLVALGTV 254

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
           CDV+P+I LNRA V  GL V   + N GL+ L + + I   I+  +LG+ IGP INAGGR
Sbjct: 255 CDVMPMIKLNRAMVRHGLKVISARSNVGLRVLGDAIGIEEKISVYHLGFSIGPHINAGGR 314

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G ++LG+ LL SDD  E E ++  L  LN  R+ +E   LE+A  +             
Sbjct: 315 VGNASLGASLLSSDDESECERISYMLLSLNAERKELEKRSLEEALHQAERLVAAGNN--- 371

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           +++    WH G++G++A+RLKE+F  PS  +S      G  S RS+ G DIG  V  A  
Sbjct: 372 VIMVAGTWHVGVIGIVASRLKERFHLPSIVVSLSG-NLGKASARSVSGIDIGAAVLAAKL 430

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           E ++ +GGGHAMAAG +V       L      F            V    G+L A AVN 
Sbjct: 431 EQLIPEGGGHAMAAGFSVCADKLEALY----SFFLERFKHSDIQKVSYACGILTAGAVNF 486

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYG 550
            L   L+   P+G GNP P F   N +++   V+  +H++    S D+  ++ + F+  G
Sbjct: 487 PLWRELQMLEPFGPGNPEPRFILKNVEIRKPEVMGGSHVRC-LISGDNALVKGVCFKCIG 545

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           T LG  L+Q RG+ +H+ G + VN WRG++  Q  + DA+
Sbjct: 546 TELGTTLLQ-RGRCVHLLGKISVNQWRGNEYVQFVMDDAA 584


>gi|58617623|ref|YP_196822.1| single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Gardel]
 gi|58417235|emb|CAI28348.1| Single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Gardel]
          Length = 590

 Score =  438 bits (1127), Expect = e-120,   Method: Composition-based stats.
 Identities = 224/591 (37%), Positives = 341/591 (57%), Gaps = 20/591 (3%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           + +  ++GV    +G  W        +   L I QK  + +IVAR+L  R ++I+   +F
Sbjct: 11  LENSGYIGV----TGALW--KPYDVNLRDILTIKQKFYLSEIVARILSARKINIEEISNF 64

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L P+++  +P+P  + D DKA  RI  AI+N E I+IFGDYDVDGA S AL+ ++LS   
Sbjct: 65  LYPTLKSSLPNPFHMLDMDKAVYRICHAIHNRENIVIFGDYDVDGATSSALIKQYLSQIG 124

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           V   +YIPDRI +GYGPN   + K    G  L ITVDCG+ +++ +  A +  +DVIVID
Sbjct: 125 VPTTIYIPDRICEGYGPNTQALLKLKEIGNSLCITVDCGTIAHEPISAAKSVNLDVIVID 184

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDL 238
           HH   +    A A++NPNRLD+ S   +L   GV FL+LV +++ L++      N   +L
Sbjct: 185 HHIGINTLPDAVAVINPNRLDETSPYTYLAGVGVSFLMLVALHKTLKEQGFFKNNQEPNL 244

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
           ++ LDLVAL TVCDV+P+IGLNR +V +GL +   + N GLK L + + +        LG
Sbjct: 245 INYLDLVALGTVCDVMPIIGLNRTFVKQGLKIMTTRQNLGLKTLSDVIGLEEKPNIYQLG 304

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           + IGP INAGGR+G ++LG+RLL +++ +E   ++ KL   N  R+ +E+    +A  ++
Sbjct: 305 FNIGPHINAGGRVGNASLGARLLSTNNEEEALEISEKLQNFNLERKTLENQSFNEAVEQI 364

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
                       I++    WHPGI+G++A RLK+KF  PS  IS  E+G G  S RSI  
Sbjct: 365 EATIISSN----IIIATGNWHPGIIGIVAGRLKDKFFLPSIVIS-LENGIGKASARSIPD 419

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            D+G  +  A   GI+++GGGHAMAAG +++      L +F  +  HNI        VFK
Sbjct: 420 VDLGAAILEAKALGIIIEGGGHAMAAGFSIQENKIKILHEFLSQKFHNINT----RKVFK 475

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +DG++ A A+N+ L   L+   P+G GNP P F   N ++++  V+  +H++      + 
Sbjct: 476 VDGIVTAEAINLKLWKELQFLEPFGIGNPEPRFILTNIRIKNPEVIGESHIRC-LIYDNK 534

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
             ++ I FR  GT LG  L++     +   G + +NYWRG++  Q  + DA
Sbjct: 535 TFIKGICFRCIGTELGTTLLECTTTTLL--GKISINYWRGNENIQFIIEDA 583


>gi|15604385|ref|NP_220901.1| single-stranded-DNA-specific exonuclease RECJ (recJ) [Rickettsia
           prowazekii str. Madrid E]
 gi|3861077|emb|CAA14977.1| SINGLE-STRANDED-DNA-SPECIFIC EXONUCLEASE RECJ (recJ) [Rickettsia
           prowazekii]
 gi|292572140|gb|ADE30055.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           prowazekii Rp22]
          Length = 586

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 220/585 (37%), Positives = 330/585 (56%), Gaps = 14/585 (2%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           SI+G  W     +E I     + +   I D +AR++  R  +++  ++FL P I+ L+PD
Sbjct: 6   SINGKIWKQKPIKEDI--VTELCRSFKISDFLARIVSLRVNNLEEVENFLIPKIKNLLPD 63

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L D DKA  RI+QAI NS++I IF DYDVDGA S AL+  FL   ++  ++Y+PDRI
Sbjct: 64  PFHLLDMDKAVDRIIQAIVNSQQICIFADYDVDGATSAALLKHFLRDLNIICDIYVPDRI 123

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGP P  M+K    G +L+ITVDCG+ ++DAL+YA +  +DVIVIDHH        A
Sbjct: 124 YEGYGPTPLAMQKIKGNGTELLITVDCGAMAHDALKYAKDVKLDVIVIDHHISTEILPDA 183

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSLLDLVALA 248
            A+VNPNR+D+ S   +L A GV FL    I   L++ N         +L+  LDLVAL 
Sbjct: 184 VAIVNPNRIDETSEYKYLAAVGVTFLFATAILSNLKKRNYFSQSIPTPNLMKYLDLVALG 243

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAG 308
           TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP INAG
Sbjct: 244 TVCDMMKLTGLNRAFVTAGLKVMQQRQNIGIKTLYDIAGLDEIPQCYHLGFILGPRINAG 303

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+G+SNLG+ LL ++   E   LA +L+  N  R+++E  M+ +A    LTQ    + +
Sbjct: 304 GRVGKSNLGANLLATNCHNEANKLANELEKHNNERKVIELLMINEAIDIALTQ----KDS 359

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
           S++ V  + WHPG++G++A +LKEKF +P   ++   +G G  S RSI G D    +  A
Sbjct: 360 SLLFVVKEGWHPGVIGIVAGKLKEKFDKPVVVVA-LNNGIGKASCRSILGIDFSAEIINA 418

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
             + +++ GGGHAMAAG T        L DF        +  L +    + D  L  + V
Sbjct: 419 KSKDLIISGGGHAMAAGFTATASKLQELQDFLNDAFSISINKLASYKHAEYDIDLTVNGV 478

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQAI 544
           N  L++ L++  P+G GN  P+F F +  +    +V   H++           ++ L AI
Sbjct: 479 NFRLMEELKTLEPFGPGNYEPIFKFDDLFILKADIVGSKHIKCMLAPDKQYFGNKALSAI 538

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
            F   GTP  + L+ SR + +   G L +N W+ +   QL + D 
Sbjct: 539 VFDAVGTPFEDILLSSRARHISAIGTLKMNNWKYNYTIQLIIKDI 583


>gi|157828569|ref|YP_001494811.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933283|ref|YP_001650072.1| RecJ [Rickettsia rickettsii str. Iowa]
 gi|157801050|gb|ABV76303.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908370|gb|ABY72666.1| RecJ [Rickettsia rickettsii str. Iowa]
          Length = 587

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 222/585 (37%), Positives = 329/585 (56%), Gaps = 14/585 (2%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+PD
Sbjct: 6   SINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLRPKIKNLLPD 63

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PDRI
Sbjct: 64  PFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPDRI 123

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH        A
Sbjct: 124 AEGYGPTPFAMQKIKDHGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHHITTEILPDA 183

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVALA 248
            A+VNPNR+D+ S   HL A GV FL    I   L++ N         +L+  LDLVAL 
Sbjct: 184 VAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLVALG 243

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAG 308
           TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP INAG
Sbjct: 244 TVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKTLYDMAGLHEIPKCYHLGFILGPRINAG 303

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q +
Sbjct: 304 GRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKVIELLMIEEAMEIALTQ----QDS 359

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
           SV+ +  + WHPG++G++A +LKEKF +P   I+  + G G  S RSI G D G  +  A
Sbjct: 360 SVLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEIINA 418

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
             + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  ++V
Sbjct: 419 KSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTVNSV 478

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQAI 544
           N  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L AI
Sbjct: 479 NFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKALSAI 538

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF   GT   + L+  + K +   G L  N W+ +   QL + D 
Sbjct: 539 AFNSVGTAFEDVLLSPKTKNIAAIGTLKTNNWQDNYTIQLIIKDI 583


>gi|57239581|ref|YP_180717.1| single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57161660|emb|CAH58590.1| putative single-stranded-DNA-specific exonuclease RecJ [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 585

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 222/579 (38%), Positives = 336/579 (58%), Gaps = 16/579 (2%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           ++G  W        +   L I QK  + +IVAR+L  R ++I+   +FL P+++  +P+P
Sbjct: 14  VTGALW--KPYDVNLRDILTIKQKFYLSEIVARILSARKINIEEISNFLYPTLKSSLPNP 71

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             + D DKA  RI  AI+N E I+IFGDYDVDGA S AL+ ++LS   V   +YIPDRI 
Sbjct: 72  FHMLDMDKAVYRICHAIHNRENIVIFGDYDVDGATSSALIKQYLSQIGVPTTIYIPDRIC 131

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN   + K    G  L ITVDCG+ +++ +  A +  +DVIVIDHH   +    A 
Sbjct: 132 EGYGPNTQALLKLKEIGNSLCITVDCGTIAHEPISAAKSVNLDVIVIDHHIGINTLPDAV 191

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATV 250
           A++NPNRLD+ S   +L   GV FL+LV +++ L++      N   +L++ LDLVAL TV
Sbjct: 192 AVINPNRLDETSPYTYLAGVGVSFLMLVALHKTLKEQGFFKNNQEPNLINYLDLVALGTV 251

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
           CDV+P+IGLNR +V +GL +   + N GLK L + + +        LG+ IGP INAGGR
Sbjct: 252 CDVMPIIGLNRTFVKQGLKIMTTRQNLGLKTLSDVIGLEEKPNIYQLGFNIGPHINAGGR 311

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G ++LG+RLL +++ +E   ++ KL   N  R+ +E+    +A  ++            
Sbjct: 312 VGNASLGARLLSTNNEEEALEISEKLQNFNLERKTLENQSFNEAVEQIEATIISSN---- 367

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           I++    WHPGI+G++A RLK+KF  PS  IS  E+G G  S RSI   D+G  +  A  
Sbjct: 368 IIIATGNWHPGIIGIVAGRLKDKFFLPSIVIS-LENGIGKASARSIPDVDLGAAILEAKA 426

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
            GI+++GGGHAMAAG +++      L +F  +  HNI        VFK+DG++ A A+N+
Sbjct: 427 LGIIIEGGGHAMAAGFSIQENKIKILHEFLSQKFHNINT----RKVFKVDGIVTAEAINL 482

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYG 550
            L   L+   P+G GNP P F   N ++++  V+  +H++      +   ++ I FR  G
Sbjct: 483 KLWKELQFLEPFGIGNPEPRFILTNIRIKNSEVIGESHIRC-LIYDNKTFIKGICFRCIG 541

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           T LG  L++     +   G + +NYWRG++  Q  + DA
Sbjct: 542 TELGTTLLECTTTTLL--GKISINYWRGNENIQFIIEDA 578


>gi|332977810|gb|EGK14567.1| single-stranded-DNA-specific exonuclease RecJ [Desmospora sp. 8437]
          Length = 791

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 179/591 (30%), Positives = 301/591 (50%), Gaps = 27/591 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDP 72
           S  RW  +  +E  ++   +  +  I  + AR+L++R V   + A+ FL  S+  L   P
Sbjct: 14  SKTRWQLVEAEE--SQVRELAGELGIHPLTARLLIHRGVSDPEQARRFLQVSLSELY-SP 70

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++   ++A  RI  A+   EKI+I+GDYD DG +S +L+M+       + + YIP+R  
Sbjct: 71  FLMDGIEEAVDRIRTALDRREKILIYGDYDADGVSSTSLLMKVFRGLDADVDYYIPNRFT 130

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG N + + K    G QL+I+VD G ++    ++A   G+D+I+ DHH+  +      
Sbjct: 131 EGYGLNENALRKAKEAGVQLMISVDTGISAVKEAKFARELGLDLIITDHHEPPAVLPEGV 190

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A++NP + D       L   GV F +   +   + +            LLDLVAL T+ D
Sbjct: 191 AVINPKKPDCSYPCKLLAGVGVAFKLAHALLGRVPE-----------ELLDLVALGTIAD 239

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           +VPL+  NR     GL    R+ NPGL AL++   I   +TA ++G+ +GP INAGGR+ 
Sbjct: 240 LVPLMDENRVIAALGLKEINRRRNPGLSALMDVAGIQGEVTAGHVGFSLGPRINAGGRLD 299

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            +     LL+++D ++  +LA +LD +N+ R+ +   +  +A A+V  +    +    IV
Sbjct: 300 TAATAVELLLTEDPEQARVLAEELDGMNRERQKLVEEIAAEACAQV--ESAPEKHRRFIV 357

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEE 431
           V    W+ G++G++A+RL EK+ RP+  +  +E+ G   GS RSI G D+ + ++     
Sbjct: 358 VAAPGWNVGVIGIVASRLVEKYYRPTIVLGIDEETGMAKGSARSIAGLDLYRALTTC--G 415

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L + GGH MAAG+++ R N         + A   +      P+ +++  L+   VN+ 
Sbjct: 416 DLLPQFGGHEMAAGMSLPRENIEEFHRRLDQIAGEWLREEDYIPLSRVEADLSIGEVNLD 475

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVY 549
           LI  LE   P G GNP P F      L  ++V+     HL+M  E +  ++L+A+ FR+ 
Sbjct: 476 LIKELERLEPCGMGNPTPRFQLRGAGLSRLQVMGREKNHLKMVLEVE-GDSLEAVGFRM- 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           G    E    +R +   + G L +N W   +  Q  + D        F  +
Sbjct: 534 GELAAEIAPSARPE---LLGELSINEWNHRRSPQFLIRDIRVPHLQVFDWR 581


>gi|310643546|ref|YP_003948304.1| single-stranded-DNA-specific exonuclease recj [Paenibacillus
           polymyxa SC2]
 gi|309248496|gb|ADO58063.1| Single-stranded-DNA-specific exonuclease RecJ [Paenibacillus
           polymyxa SC2]
          Length = 798

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 177/592 (29%), Positives = 304/592 (51%), Gaps = 26/592 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDP 72
           S +RW     +  +  A  +T++  I  +++R+LVNR V+    A  FL  S+  +  DP
Sbjct: 4   SQYRW--KTPEVNLEAAQPLTEELGISPLLSRLLVNRGVTTAGEANRFLYGSVDDVH-DP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L    +A  RI QA+   E I+I+GDYD DG +S +LM++ +     + ++YIP R  
Sbjct: 61  FLLLGMKEAVPRIRQALERGEHILIYGDYDADGVSSTSLMIQLMRFLKASYDIYIPHRSN 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++    +G  L+ITVD G ++ + + YAT+ GIDVIV DHH+  +    AY
Sbjct: 121 EGYGLHNHALDWAHQQGVTLVITVDTGISAVEQIAYATSLGIDVIVTDHHEPPAVLPEAY 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
            L+NP   D       L   GV   +   +   + +              ++ A+ TV D
Sbjct: 181 TLINPKLPDCPYPFKGLAGVGVALKLAQALLSEVPE-----------EWFEIAAIGTVAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE-NLGYMIGPSINAGGRI 311
           ++PL G NR  V +G+   R    PG++AL+    +        N+ + + P INA GR+
Sbjct: 230 LMPLHGENRTIVRRGIQSMRNSAFPGIRALLHVAGVEISTVTSVNIAFALAPRINASGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             +     LL ++  +E + LA  LD+LN+ R+ +   ++EQAE ++ ++ +  +  SVI
Sbjct: 290 DHAGRAVSLLTTEKEEEADQLAHALDLLNRERQQVVERIVEQAEQQLASKLNGDKLPSVI 349

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVE 430
           V+ G+ W+ G+VG++A++L +++ RP+  +  + E G   GS RSI   DI   ++   E
Sbjct: 350 VLAGEGWNVGVVGIVASKLLDRYYRPTIILGIDTETGMCKGSARSIPALDIYSALTDCHE 409

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             ++   GGH  AAG+T+ R +     +   ++A +I+      P+ + D V     +++
Sbjct: 410 --LMEHFGGHPSAAGMTLSRDHLELFEERLNRYAGSILTPEDFIPIAEADMVCRLDEISL 467

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRV 548
            +++ LE   P+G GNP+P F     +L+  R +     H+++  E Q+  +L AIAFR 
Sbjct: 468 QVVEELELLQPFGMGNPSPRFVLQGLQLREARKMGREKNHVKLLLE-QNGLSLDAIAFRR 526

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
               L +FL Q     + + G L +N W G +  QL + D        F  +
Sbjct: 527 GD--LADFLQQQTD--IDLLGELSINEWNGKRSLQLMMQDIRVQAPQIFDYR 574


>gi|58584384|ref|YP_197957.1| single-stranded DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418700|gb|AAW70715.1| Single-stranded DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 579

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 231/587 (39%), Positives = 332/587 (56%), Gaps = 16/587 (2%)

Query: 6   FLGVEC-SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
            LG+E   I+   W     +      L +TQ+  +P+I+AR L  R V+I+ A +FL P 
Sbjct: 2   LLGIEKRGITNALWKLQ--EADQREVLTLTQRFELPEILARTLAIRGVNIENAGNFLYPL 59

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           IR L+PDP  L D DKA  RI+QAI N E I IFGDYDVDGA S AL+ R+L    +++ 
Sbjct: 60  IRSLLPDPFHLLDMDKAVFRIIQAINNDENIAIFGDYDVDGATSSALISRYLRAIGIHSI 119

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDR+ +GYG N + + +   +G  L I+VDCG+ +Y  ++ A   G+DVIVIDHH  
Sbjct: 120 IYIPDRVDEGYGLNSNALLQLKKKGIDLCISVDCGTLAYQPIEDAKGFGLDVIVIDHHLG 179

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLL 242
             +   A A+VNPNRLD+ S    L A GV FL+ V + + LR+ +        DL  LL
Sbjct: 180 TEKLPSAIAVVNPNRLDESSPYNSLAAVGVSFLLTVALNKSLREQDFFAGKKEPDLFDLL 239

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVAL TVCDV+ + GLNRA+V +GL V   + N GL+ L + + I        L + IG
Sbjct: 240 DLVALGTVCDVMQITGLNRAFVSQGLKVMSARKNVGLRVLFDALGILERPNVSRLSFNIG 299

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIGE+ LG+RLL +DD +E + +A+KL  LN  R++ME+  L +A  +V    
Sbjct: 300 PCINAGGRIGEALLGARLLSTDDKKEADSIALKLIDLNNARKMMENEALLEAIIQVEKST 359

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIG 422
                    ++    WH G++G++A+RLKEKF  P+  IS      G  S RSI G DIG
Sbjct: 360 QSGAN---FIMVSGNWHQGVIGIIASRLKEKFHLPTIVISLNNR-IGKASCRSIPGVDIG 415

Query: 423 KMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGV 482
             V  A    ++++GGGH+MAAG  +       L DF  +               K+DG+
Sbjct: 416 AAVLSAKCMNLIIEGGGHSMAAGFLINEDKMSDLHDFLTERFAYSTND----KALKVDGI 471

Query: 483 LNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQ 542
           + A A+N++L + L+   P+G GNP P F     K++   +V + H++      D   ++
Sbjct: 472 VTAKAINLSLWNQLQRLEPFGVGNPEPRFIIQGAKIRKPEIVGVDHIKCFIVDDD-VMVR 530

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAFR   T LG  +M+   +   + G + +NYW G++  Q  + D 
Sbjct: 531 AIAFRSANTHLGSAIMEGNIEA--ILGKISMNYWNGNEFVQFLIEDV 575


>gi|157964581|ref|YP_001499405.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia massiliae
           MTU5]
 gi|157844357|gb|ABV84858.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia massiliae
           MTU5]
          Length = 608

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 222/587 (37%), Positives = 333/587 (56%), Gaps = 14/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 25  QASINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLIPKIKNLL 82

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 83  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 142

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH       
Sbjct: 143 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHHIATEILP 202

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVA 246
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N         +L+  LDLVA
Sbjct: 203 DAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMKYLDLVA 262

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD++ L GLNRA+V  GL + +++ N G+K L +   ++      +LG+++GP IN
Sbjct: 263 LGTVCDMMKLTGLNRAFVASGLKIMQQRQNIGIKTLYDMAGLNEIPKCYHLGFILGPRIN 322

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q
Sbjct: 323 AGGRVGKSSLGANLLSTSCSNEANKLAEELEKHNNERKVIELLMIEEAMEIALTQ----Q 378

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A +LKEKF +P   I+  + G G  S RSI G D G  + 
Sbjct: 379 DSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEII 437

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  +
Sbjct: 438 NAKSKDLLIAGGGHAMAAGFTVTADKLQELQNFFNNAFRISINKLENYKHAEYDIELTVN 497

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQ 542
           +VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L 
Sbjct: 498 SVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKALS 557

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAF   GT   + L+ S+ K +   G L  N W+G+   QL + D 
Sbjct: 558 AIAFNSVGTAFEDVLLSSKAKNIAAIGTLKTNNWQGNYTIQLIIKDI 604


>gi|58579570|ref|YP_197782.1| single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58418196|emb|CAI27400.1| Single-stranded-DNA-specific exonuclease recJ [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 590

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 222/579 (38%), Positives = 336/579 (58%), Gaps = 16/579 (2%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           ++G  W        +   L I QK  + +IVAR+L  R ++I+   +FL P+++  +P+P
Sbjct: 19  VTGALW--KPYDVNLRDILTIKQKFYLSEIVARILSARKINIEEISNFLYPTLKSSLPNP 76

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             + D DKA  RI  AI+N E I+IFGDYDVDGA S AL+ ++LS   V   +YIPDRI 
Sbjct: 77  FHMLDMDKAVYRICHAIHNRENIVIFGDYDVDGATSSALIKQYLSQIGVPTTIYIPDRIC 136

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN   + K    G  L ITVDCG+ +++ +  A +  +DVIVIDHH   +    A 
Sbjct: 137 EGYGPNTQALLKLKEIGNSLCITVDCGTIAHEPISAAKSVNLDVIVIDHHIGINTLPDAV 196

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATV 250
           A++NPNRLD+ S   +L   GV FL+LV +++ L++      N   +L++ LDLVAL TV
Sbjct: 197 AVINPNRLDETSPYTYLAGVGVSFLMLVALHKTLKEQGFFKNNQEPNLINYLDLVALGTV 256

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
           CDV+P+IGLNR +V +GL +   + N GLK L + + +        LG+ IGP INAGGR
Sbjct: 257 CDVMPIIGLNRTFVKQGLKIMTTRQNLGLKTLSDVIGLEEKPNIYQLGFNIGPHINAGGR 316

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G ++LG+RLL +++ +E   ++ KL   N  R+ +E+    +A  ++            
Sbjct: 317 VGNASLGARLLSTNNEEEALEISEKLQNFNLERKTLENQSFNEAVEQIEATIISSN---- 372

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           I++    WHPGI+G++A RLK+KF  PS  IS  E+G G  S RSI   D+G  +  A  
Sbjct: 373 IIIATGNWHPGIIGIVAGRLKDKFFLPSIVIS-LENGIGKASARSIPDVDLGAAILEAKA 431

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
            GI+++GGGHAMAAG +++      L +F  +  HNI        VFK+DG++ A A+N+
Sbjct: 432 LGIIIEGGGHAMAAGFSIQENKIKILHEFLSQKFHNINT----RKVFKVDGIVTAEAINL 487

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYG 550
            L   L+   P+G GNP P F   N ++++  V+  +H++      +   ++ I FR  G
Sbjct: 488 KLWKELQFLEPFGIGNPEPRFILTNIRIKNSEVIGESHIRC-LIYDNKTFIKGICFRCIG 546

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           T LG  L++     +   G + +NYWRG++  Q  + DA
Sbjct: 547 TELGTTLLECTTTTLL--GKISINYWRGNENIQFIIEDA 583


>gi|308174463|ref|YP_003921168.1| single-strand DNA-specific exonuclease [Bacillus amyloliquefaciens
           DSM 7]
 gi|307607327|emb|CBI43698.1| putative single-strand DNA-specific exonuclease [Bacillus
           amyloliquefaciens DSM 7]
 gi|328554383|gb|AEB24875.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           amyloliquefaciens TA208]
          Length = 785

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/593 (31%), Positives = 278/593 (46%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW     Q    +  ++T++  I  +VA +LV R     + A+ FL+        D
Sbjct: 3   ASKMRWEIQ--QPDKEKVKSLTEQLDITPLVASLLVKRGFDTAESARLFLHTKDADFY-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L    +A  RI  A+   E IMI+GDYD DG  S ++M+  L   S N + YIPDR 
Sbjct: 60  PYELKGMREAVDRIKLAVSRGEPIMIYGDYDADGVTSTSVMLTALRQLSANVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN          G  LIITVD G  +    + A   G+DVI+ DHH+   E    
Sbjct: 120 TEGYGPNEQAFRSIKERGFSLIITVDTGIAAVHEAEVAKELGLDVIITDHHEPGPELPDV 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           +A+++P +         L   GV F +   +   L +           ++LDL A+ TV 
Sbjct: 180 FAIIHPKQPGCSYPFKELAGVGVAFKLAHALTGSLPE-----------AMLDLAAIGTVA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL   NR     G+   R    PGLKALI+           E +G+ + P +NA GR
Sbjct: 229 DLVPLHDENRLIASLGIERLRTTNRPGLKALIKLSGGDIGQADEETIGFQVAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL++DD  E E LA  +D LN+ R+ M   M E+A   V  Q       S 
Sbjct: 289 IEQADPAVHLLMTDDQFEAEELASDIDRLNKERQKMVKTMTEEAVEMVQQQGG---NPSA 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L E+F RP+  +  + E G   GS RSI GF++    S + 
Sbjct: 346 IVVAKAGWNPGVVGIVASKLAERFYRPAVVLGMDEEQGIAKGSARSIRGFNL--FTSLSQ 403

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T++  +   L D   + A   +      PV ++D V     + 
Sbjct: 404 CRDILPHFGGHPMAAGMTLKAEDVADLRDRLNQMAEETLTEEDFIPVQEVDLVCGVEDIT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  L    P+G  NP P     N  L  +R++     H++MT ++ DS  L  + F 
Sbjct: 464 VESITELNMLSPFGMLNPKPHVMVENAVLDEVRLIGANKNHVKMTVKN-DSAALDCVGFN 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G  + + G + +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGELEAG----IVPGSTISIVGEMSINEWNNRKKPQLMIKDAAVPEWQLFDIR 571


>gi|16079816|ref|NP_390640.1| single-strand DNA-specific exonuclease [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221310700|ref|ZP_03592547.1| hypothetical protein Bsubs1_15096 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315024|ref|ZP_03596829.1| hypothetical protein BsubsN3_15007 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319945|ref|ZP_03601239.1| hypothetical protein BsubsJ_14918 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324226|ref|ZP_03605520.1| hypothetical protein BsubsS_15062 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|81342119|sp|O32044|RECJ_BACSU RecName: Full=Single-stranded-DNA-specific exonuclease recJ
 gi|2635226|emb|CAB14721.1| putative single-strand DNA-specific exonuclease [Bacillus subtilis
           subsp. subtilis str. 168]
          Length = 786

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 189/593 (31%), Positives = 281/593 (47%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW      +   +  ++T++  I  +VA +LV R     + A+ FL+        D
Sbjct: 3   ASKMRWEIQRPDQD--KVKSLTEQLHITPLVASLLVKRGFDTAESARLFLHTKDADFY-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  +    +AA RI QAI   EKIMI+GDYD DG  S ++M+  L   S   + YIPDR 
Sbjct: 60  PFEMKGMKEAADRIKQAISQQEKIMIYGDYDADGVTSTSVMLHTLQKLSAQVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN          G  LIITVD G  +    + A   G+DVI+ DHH+   E    
Sbjct: 120 KEGYGPNEQAFRSIKERGFSLIITVDTGIAAVHEAKVAKELGLDVIITDHHEPGPELPDV 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A+V+P +         L   GV F +   +   L              LLDL A+ T+ 
Sbjct: 180 RAIVHPKQPGCTYPFKELAGVGVAFKLAHALLGELPD-----------ELLDLAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL   NR     GL   RR    GLK LI+           E +G+ + P +NA GR
Sbjct: 229 DLVPLHDENRLIATLGLERLRRTNRLGLKELIKLSGGDIGEANEETVGFQLAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL+S+DS E E LA ++D LN+ R+ M S M ++A   V  Q  D      
Sbjct: 289 IEQADPAVHLLMSEDSFEAEELAAEIDQLNKERQKMVSKMTDEAIEMVEQQGLDQT---A 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L ++F RP+  +  +E+ G   GS RSI GF++    S + 
Sbjct: 346 IVVAKAGWNPGVVGIVASKLVDRFYRPAIVLGIDEEKGIAKGSARSIRGFNL--FESLSE 403

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T++  +   L     + A N +      PV ++D V     + 
Sbjct: 404 CRDILPHFGGHPMAAGMTLKAEDVPDLRSRLNEIADNTLTEEDFIPVQEVDLVCGVEDIT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  +    P+G  NP P     N  L+ +R +     H++MT  ++ S+ L  + F 
Sbjct: 464 VESIAEMNMLSPFGMLNPKPHVLVENAVLEDVRKIGANKTHVKMTIRNESSQ-LDCVGFN 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G R+ + G + +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGELQEG----IVPGSRISIVGEMSINEWNNRKKPQLMIKDAAVSEWQLFDLR 571


>gi|118580215|ref|YP_901465.1| single-stranded-DNA-specific exonuclease RecJ [Pelobacter
           propionicus DSM 2379]
 gi|118502925|gb|ABK99407.1| exonuclease RecJ [Pelobacter propionicus DSM 2379]
          Length = 568

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 186/581 (32%), Positives = 286/581 (49%), Gaps = 19/581 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD-FLNPSIRLLMPDPLI 74
            +W+       +    A+  + AI  + A +L  R +S   A D FL+PS+  ++ DP  
Sbjct: 4   KQWIVRTAPVELP---AMAGEKAILPLTAAILAGRGISEPDAMDAFLSPSLADML-DPSR 59

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           +     A  R+++A    EKI ++GDYDVDG     L++ FL     + + +IP+R  DG
Sbjct: 60  MKGMADAVARLLEARRRQEKITVYGDYDVDGITGTTLLVSFLRQTGFDCDYFIPNRFDDG 119

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   +++ IN GA LI++VDCG T+ +   +   +G ++I++DHH  K     A A+
Sbjct: 120 YGLNGEALDRIINAGAALILSVDCGITAVEEALFCRQRGAELIIVDHHAPKETLPDACAV 179

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATVCD 252
           +NP +         L   GV F +LV +   LR       +   DL   LDLVAL T+ D
Sbjct: 180 LNPLQSGCDYAFKCLAGVGVAFNLLVALRAALRDQGSFGSDSGPDLRQWLDLVALGTIAD 239

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           VVPLIG NR YV  GL +      PG++AL +   +   +++  +G+ + P +NA GR+ 
Sbjct: 240 VVPLIGQNRIYVTHGLRLLAAPCKPGIQALKKVAGVGGAVSSGQVGFRLAPRLNAAGRME 299

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            +  G  LL+ DD      +A +LD  N  R+ +E A+L++A + V  Q  +      IV
Sbjct: 300 SAVPGVELLLGDDPPHCLAIAEELDAANGERQAIERAILQEAISLV-EQGGNYPDRRSIV 358

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +    WH G+VG++A+RL E+F RP+  I+ +E G+G GSGRSI GF +   +       
Sbjct: 359 LASPSWHQGVVGIVASRLAERFHRPTILIALDEQGQGKGSGRSIPGFHLLDALKVC--SP 416

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L + GGH  A G+++           F+  A  ++      P   ID       V   L
Sbjct: 417 LLERFGGHRHAVGVSLSGERVDDFSATFEAEARRLLGNGELMPRLDIDAEAEPREVTKEL 476

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
              L+   P+G GNP P+    +  +   RVV   HL++     D     AIAFR+    
Sbjct: 477 ALELKRLEPFGMGNPEPLLMMRSLTVLEQRVVGEDHLRLRLSRDDH-VFNAIAFRMASRT 535

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           + E         + +     +N W GS   QLRV D  P E
Sbjct: 536 VSE--------TIDIAFFPEMNQWNGSSTLQLRVKDLRPTE 568


>gi|15892684|ref|NP_360398.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia conorii
           str. Malish 7]
 gi|15619857|gb|AAL03299.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia conorii
           str. Malish 7]
          Length = 587

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 222/587 (37%), Positives = 331/587 (56%), Gaps = 14/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH       
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHHIATEILP 181

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVA 246
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N         +L+  LDLVA
Sbjct: 182 DAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLVA 241

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP IN
Sbjct: 242 LGTVCDMMKLTGLNRAFVASGLKVMQQRHNIGIKTLYDMAGLHEIPKCYHLGFILGPRIN 301

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q
Sbjct: 302 AGGRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKVIELLMIEEAMEIALTQ----Q 357

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A +LKEKF +P   I+  + G G  S RSI G D G  + 
Sbjct: 358 DSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEII 416

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  +
Sbjct: 417 NAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTVN 476

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQ 542
           +VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L 
Sbjct: 477 SVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKALS 536

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAF   GT   + L+  + K + V G L  N W+ +   QL + D 
Sbjct: 537 AIAFNSVGTAFEDVLLSPKAKNIAVIGTLKTNNWQDNYTIQLIIKDI 583


>gi|295132117|ref|YP_003582793.1| single-stranded-DNA-specific exonuclease RecJ [Zunongwangia
           profunda SM-A87]
 gi|294980132|gb|ADF50597.1| single-stranded-DNA-specific exonuclease RecJ [Zunongwangia
           profunda SM-A87]
          Length = 567

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 164/581 (28%), Positives = 270/581 (46%), Gaps = 22/581 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW         +   ++ Q   +   +AR+L  R + S + AK F  P+++ L  DP ++
Sbjct: 4   RWTIKP-NPNPDIVNSLMQSLGVGKPIARLLAQRGINSFEEAKKFFRPNLKDLH-DPYLM 61

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA  RI +A+   E IM++GDYDVDG  SVALM  +L     N   YIPDR  +GY
Sbjct: 62  RDMDKAVARIEKALAEEENIMVYGDYDVDGTTSVALMSSYLKTRYPNVATYIPDRYNEGY 121

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + D + YA  +GID ++ DHH+   +   A A++
Sbjct: 122 GVSYQGIDFAADNDISLIIALDCGIKAIDKVAYAREKGIDFVICDHHRPGEKIPEAAAVL 181

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  +               LL  LDLVA A   D+VP
Sbjct: 182 DPKREDCEYPYKELCGCGVGFKLIQALAEKRGDS-----IQVLLPYLDLVATAIGADIVP 236

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V       G KA++ ++     IT  ++ ++I P INA GR+    
Sbjct: 237 ITGENRILAYHGLHVINVAPRQGFKAILSQLK-KETITITDVVFVIAPRINAAGRMKHGL 295

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL  +  ++ +  A +++  N +R+  + ++  +A  ++  +  + Q+    VV  
Sbjct: 296 HAVELLTEEKEEQAQQFASEIEYHNSHRKDTDKSITAEALVQI--EELEEQERLSTVVYA 353

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           D WH G++G++A+RL E + RP+   +   D K   S RS++GFD+   +    E   + 
Sbjct: 354 DHWHKGVIGIVASRLTETYYRPTLVFTKSGD-KLAASARSVKGFDVYNALEACQEH--IE 410

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT++   +      F++     +   + TP   ID  +    +      +
Sbjct: 411 QFGGHMYAAGLTIKEEEYDNFKRKFEEVVAETIDRKLLTPEISIDAEIELDEITPKFWRI 470

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVNLA--HLQMTFES-QDSETLQAIAFRVYGT 551
           L+   P+G GN +P+F   N       + V     HL+       ++ +   I F +   
Sbjct: 471 LKQFAPFGPGNMSPLFMSRNLTDSGFGKCVGNEHTHLKCKVSQLNNTASFDVIGFNLGE- 529

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
              +  +    K       +  N W G+   QL++ D   V
Sbjct: 530 ---KLELIQNKKSFSAVYAVDENEWNGNVSLQLKLKDLKEV 567


>gi|27379488|ref|NP_771017.1| single-stranded-DNA-specific exonuclease [Bradyrhizobium japonicum
           USDA 110]
 gi|27352640|dbj|BAC49642.1| single-stranded-DNA-specific exonuclease [Bradyrhizobium japonicum
           USDA 110]
          Length = 633

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 284/596 (47%), Positives = 374/596 (62%), Gaps = 4/596 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            QAFLGV  S++   W   L   G  +ALAI Q+H +P+++ARVL  R V ID   DFL+
Sbjct: 33  PQAFLGVTRSLTDKLWRDRLDARGAAQALAIVQRHQLPELLARVLAGRGVDIDAVPDFLD 92

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+IR LMPDP  +T+ + AA+RI  A    EK+ IFGDYDVDGA S AL+   L HC ++
Sbjct: 93  PTIRKLMPDPFTVTEMEAAAKRIADAAAKGEKVAIFGDYDVDGATSAALLAWHLRHCGLD 152

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI +GYGPN   +     +GA L++TVDCG+TS + L  A   G+ V+VIDHH
Sbjct: 153 PLIHIPDRIFEGYGPNTEAVRGLAAKGATLLVTVDCGTTSIEPLAEAKRLGMSVVVIDHH 212

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLL 239
           Q  +E     ALVNPNRLDDLSG GHL A G+V + LV + R LRQ           DLL
Sbjct: 213 QAGTELPLVDALVNPNRLDDLSGLGHLAAVGLVLVTLVAVNRELRQRGFWNAEMPEPDLL 272

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
            +L  VAL TV DV PLIGLNRA+V KGL+  RR+ + G  AL++   ++ P  A +LG+
Sbjct: 273 GMLHHVALGTVADVAPLIGLNRAFVAKGLIAMRRRDHVGHTALMDVARLNGPPEAWHLGF 332

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           M+GP +NAGGRIG ++LG RLL+  DS E   +A +LD LN  RR++E A   QAEA+ L
Sbjct: 333 MLGPRVNAGGRIGRADLGVRLLLEGDSVEAARIAAELDRLNTERRVIEQAAEAQAEAEAL 392

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  +  VIV   + WHPG+VGL+A+RLKEKF RP+FAI+ E  G G GSGRSI G 
Sbjct: 393 ASIGLEDKLGVIVTASEGWHPGVVGLVASRLKEKFSRPAFAIALEPGGIGTGSGRSIAGV 452

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           DIGK V  AV +GIL+KGGGHAMAAG+T+ +        + +      V          I
Sbjct: 453 DIGKAVRQAVTDGILLKGGGHAMAAGVTLRKEKLAEFRAYLENALARDVAEARHVNELYI 512

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG ++A AV   L   L  AGP+G+GNP  V A P H+L     V  AHL++ F+S D  
Sbjct: 513 DGAVSARAVTTELAATLNRAGPFGSGNPEAVLALPAHQLVYADEVGQAHLRLRFKSGDGA 572

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS-PVEG 594
            +  IAFR  G  LG  L+ +RG+++HV G L V+ ++G++R Q RV+D + P +G
Sbjct: 573 IVNGIAFRSVGQKLGNALVANRGQQLHVAGSLSVDRYQGAERVQFRVIDVALPDQG 628


>gi|34581633|ref|ZP_00143113.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia sibirica
           246]
 gi|28263018|gb|EAA26522.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia sibirica
           246]
          Length = 587

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 221/587 (37%), Positives = 330/587 (56%), Gaps = 14/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH       
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHHIATEILP 181

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVA 246
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N         +L+  LDLVA
Sbjct: 182 DAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLVA 241

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP IN
Sbjct: 242 LGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKTLYDMAGLHEIPKCYHLGFILGPRIN 301

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q
Sbjct: 302 AGGRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKVIELLMIEEAMEIALTQ----Q 357

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A +LKEKF +P   I+  + G G  S RSI G D G  + 
Sbjct: 358 DSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEII 416

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  +
Sbjct: 417 NAKSKDLLIAGGGHAMAAGFTVAAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTVN 476

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQ 542
           +VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L 
Sbjct: 477 SVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKALS 536

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAF   GT   + L+  + K +   G L  N W+ +   QL + D 
Sbjct: 537 AIAFNSVGTAFEDVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIKDI 583


>gi|295706718|ref|YP_003599793.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus megaterium
           DSM 319]
 gi|294804377|gb|ADF41443.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus megaterium
           DSM 319]
          Length = 780

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 182/593 (30%), Positives = 296/593 (49%), Gaps = 29/593 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDP 72
           S  RW      E         +   I  +VA +L+NR ++  + A++FL+        DP
Sbjct: 4   SKKRWNVQECDE--QLVNEFVENLNITPLVASLLLNRGMTTVEAAREFLHVD-AQTFHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D DKA  RI QAI ++EKIMI+GDYD DG +S ++M+  L     + + YIP+R  
Sbjct: 61  FLLHDMDKAVARIQQAIDHNEKIMIYGDYDADGVSSTSVMLSALQQLGADVDFYIPNRFT 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN +  +K    G QL+ITVD G ++ +   YA     D+I+ DHH+       AY
Sbjct: 121 EGYGPNKAAFDKISAGGYQLVITVDTGISAVEETAYARELNFDLIITDHHEPGPVLPDAY 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+++P           L   GV F +   +   L +            LL+L  + T+ D
Sbjct: 181 AIIHPKLPGSTYPFKELAGVGVAFKLAHALLGELPE-----------HLLELAVIGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAEN-LGYMIGPSINAGGRI 311
           +VPL+  NR    KGL   +     G++AL+    +      E+ +G+ + P INA GR+
Sbjct: 230 LVPLVDENRLIARKGLDYLKLTKRTGIEALLSVCGVKREEINEDTIGFAMAPRINAVGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
            +++    LL++ +++E + LA ++D LN+ R+ + + + E+A   V       +  SV+
Sbjct: 290 QDADPAVHLLMTTNAEEAKGLAKEIDALNKVRQQIVNDITEEAVEFVENMYPPDEN-SVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDG-KGIGSGRSIEGFDIGKMVSFAVE 430
           +VEG+ W+ G+VG++A+RL EKF RP+  +S + +     GS RSIEGFD+   +S    
Sbjct: 349 IVEGEGWNAGVVGIVASRLVEKFYRPTIVLSIDSENRIAKGSARSIEGFDLFANLSKC-- 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T+   +   L     + A N++      P+  +D V     + +
Sbjct: 407 RDILPHFGGHPMAAGMTLNSDDVEELRTRLNEQASNVLTEQDFIPITSVDTVCTTEEITL 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRV 548
             I+ + +  P+G  NP P     +    S+R +     HL++ FE  D  ++ A+ F  
Sbjct: 467 ENIEQMSALAPFGMHNPKPKVLIKDVHTTSMRKIGANKNHLKLVFEDSD-VSVDAVGFG- 524

Query: 549 YGTPLGEFLMQSRG-KRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
               LG  L +     ++ + G L +N W   ++ QL V D S  E   F  +
Sbjct: 525 ----LGYILDEVSPIAKVSLVGELSINEWNNMRKPQLMVEDISVDEWQMFDYR 573


>gi|328912788|gb|AEB64384.1| putative single-strand DNA-specific exonuclease [Bacillus
           amyloliquefaciens LL3]
          Length = 785

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/593 (31%), Positives = 277/593 (46%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW     Q    +  ++T++  I  +VA +LV R     + A+ FL+        D
Sbjct: 3   ASKMRWEIQ--QPDKEKVKSLTEQLDITPLVASLLVKRGFDTAESARLFLHTKDADFY-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L    +A  RI  A+   E IMI+GDYD DG  S ++M   L   S N + YIPDR 
Sbjct: 60  PYELKGMREAVDRIKLAVSRGEPIMIYGDYDADGVTSTSVMQTALRQLSANVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN          G  LIITVD G  +    + A   G+DVI+ DHH+   E    
Sbjct: 120 TEGYGPNEQAFRSIKERGFSLIITVDTGIAAVHEAEVAKELGLDVIITDHHEPGPELPDV 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           +A+++P +         L   GV F +   +   L +           ++LDL A+ TV 
Sbjct: 180 FAIIHPKQPGCSYPFKELAGVGVAFKLAHALTGSLPE-----------AMLDLAAIGTVA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL   NR     G+   R    PGLKALI+           E +G+ + P +NA GR
Sbjct: 229 DLVPLHDENRLIASLGIERLRTTNRPGLKALIKLSGGDIGQADEETIGFQVAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL++DD  E E LA  +D LN+ R+ M   M E+A   V  Q       S 
Sbjct: 289 IEQADPAVHLLMTDDQFEAEELASDIDRLNKERQKMVKTMTEEAVEMVQQQGG---NPSA 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L E+F RP+  +  + E G   GS RSI GF++    S + 
Sbjct: 346 IVVAKAGWNPGVVGIVASKLAERFYRPAVVLGMDEEQGIAKGSARSIRGFNL--FTSLSQ 403

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T++  +   L D   + A   +      PV ++D V     + 
Sbjct: 404 CRDILPHFGGHPMAAGMTLKAEDVADLRDRLNQMAEETLTEEDFIPVQEVDLVCGVEDIT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I  L    P+G  NP P     N  L  +R++     H++MT ++ DS  L  + F 
Sbjct: 464 VESITELNMLSPFGMLNPKPHVMVENAVLDEVRLIGANKNHVKMTVKN-DSAALDCVGFN 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 G       G  + + G + +N W   K+ QL + DA+  E   F  +
Sbjct: 523 KGELEAG----IVPGSTISIVGEMSINEWNNRKKPQLMIKDAAVPEWQLFDIR 571


>gi|312131175|ref|YP_003998515.1| exonuclease recj [Leadbetterella byssophila DSM 17132]
 gi|311907721|gb|ADQ18162.1| exonuclease RecJ [Leadbetterella byssophila DSM 17132]
          Length = 567

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 167/578 (28%), Positives = 269/578 (46%), Gaps = 14/578 (2%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
             W      E       + Q+  +   +A +L  R + + D AK F  PS++ L  DP +
Sbjct: 3   KHWSYKPLPEDGE-VAELQQQLNVSSAMATLLWQRGIYTFDAAKHFFRPSLKDLH-DPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D DKA  R+  A+   EKI+I+GDYDVDG  +VA++  FL    VN   Y PDR  +G
Sbjct: 61  MRDMDKAVDRVSAALNADEKILIYGDYDVDGTTAVAMVYGFLKKKHVNLLYYNPDRYTEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++    +G  LII++DCG  S D + YA + GID I+ DHH+   E   A A+
Sbjct: 121 YGVSKQGIDYAKEQGVSLIISLDCGIKSADKVAYARSLGIDFIICDHHEPGEELPEAVAV 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R D +     L   GV F +L  + +            +L   LDL  ++   D+V
Sbjct: 181 LDPKRKDCIYPYKELTGNGVGFKLLSALCQTRG-----WEWAELEEYLDLCMVSIASDIV 235

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           P+ G NR     GL          LKAL+        +  E++ + IGP INA GRI  +
Sbjct: 236 PITGENRILAFYGLQKLNASPRISLKALMNVAGTQGEMNIESVVFTIGPRINAAGRIRHA 295

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D  E   LA  +   N  R+ +++ + E+A   +       ++A   V+ 
Sbjct: 296 RAAVELLLSEDEDEAMELAYAIQKHNTERKGLDARITEEALDLIKRDPWLYEEAWSTVLY 355

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + WH G++G++A+R  E F RP+   +   +    GS RS+ GFD+   +    E   L
Sbjct: 356 KEDWHKGVIGIVASRCIENFYRPTIIFTKAGEDYAAGSARSVAGFDLYGAIEACSEH--L 413

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           ++ GGH  AAG+T+           F       +      PV  +D  ++ S +      
Sbjct: 414 IQFGGHMHAAGMTISIDKIEDFRKAFDGEVKARLLEEQRIPVITVDLEVHLSELTPKFHK 473

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLG 554
           +++   P+G  N  P+F   N + ++ +V+   HL++    QD  +  AI F +      
Sbjct: 474 VMKQMSPFGPENMQPIFVSHNLRARTAQVLKEKHLKLEVV-QDGFSFPAIGFGLAPEFYR 532

Query: 555 EFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           E    + G+   +   L  N++RG+   QL + D    
Sbjct: 533 EL---ASGRPFSMAYSLEENHFRGNTTQQLFIRDIKLA 567


>gi|58698831|ref|ZP_00373706.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630248|ref|YP_002727039.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia sp. wRi]
 gi|58534647|gb|EAL58771.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592229|gb|ACN95248.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia sp. wRi]
          Length = 579

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 231/582 (39%), Positives = 340/582 (58%), Gaps = 15/582 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+   W     +    + L +TQ+  +P+I+AR+LV R V+I+ A DFL P IR L+
Sbjct: 7   KRSITNALWKLQ--EADQRQILTLTQRFELPEILARILVTRGVNIENASDFLYPLIRSLL 64

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D DKA  RI++AI N E + IFGDYDVDGA S AL+ R+L    +++ +YIPD
Sbjct: 65  PDPFHLLDMDKAVSRIIRAIKNDENLAIFGDYDVDGATSSALINRYLRAIDIHSIIYIPD 124

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R+ +GYG +   + +    G  L I+VDCG+ +Y  ++ A   G+D+IV+DHH    +  
Sbjct: 125 RVDEGYGLSTDALLQLKKNGIDLCISVDCGTLAYQPIEDAKAFGLDIIVVDHHLGTEKLP 184

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLDLVAL 247
            A A+VNPNRLD+ S   +L A GV FL++V + + LR+          DL  LLDLVAL
Sbjct: 185 SAVAIVNPNRLDESSPYNNLAAVGVSFLLIVALNKSLREQGFFTNKKEPDLFDLLDLVAL 244

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCDV+ + GLNRA V +GL V   + N GL+ L + + I    +   LG+ IGP INA
Sbjct: 245 GTVCDVMQITGLNRALVSQGLKVMSTRKNVGLRVLFDALGILEKPSVSRLGFSIGPCINA 304

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGRIGE++LG+RLL +DD +E   +A+KL  LN  R+++E+  L +A A+          
Sbjct: 305 GGRIGEASLGARLLSTDDDEEAHSIALKLIDLNNARKVLENEALLEATAQAEKSAQSGAN 364

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
               ++    WH GI+G++A+RLKE+F  P+  IS   +G G  S RSI G DIG  V  
Sbjct: 365 ---FIMISGNWHQGIIGIIASRLKEQFHLPTVVIS-LNNGIGKASCRSILGVDIGAAVLS 420

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           A    ++++GGGH+MAAG +++      L DFF +   N +         K D ++ A A
Sbjct: 421 AKFINLIIEGGGHSMAAGFSIKEDKINDLHDFFTERFSNSIN----EKTLKADSIVTAKA 476

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
           +N++L + L+  GP+G GNP P F     K++   V+ + H++      D+  ++AIAFR
Sbjct: 477 INLSLWNQLQRLGPFGVGNPEPRFIIQGAKIRKPEVIGVDHIKCFIAD-DNVMVKAIAFR 535

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
              T LG  +MQ   K   + G + +NYW G++  Q  + D 
Sbjct: 536 SANTHLGSAIMQGNVKA--ILGKISMNYWNGNEFVQFLIEDV 575


>gi|197105103|ref|YP_002130480.1| single-stranded-DNA-specific exonuclease RecJ [Phenylobacterium
           zucineum HLK1]
 gi|196478523|gb|ACG78051.1| single-stranded-DNA-specific exonuclease RecJ [Phenylobacterium
           zucineum HLK1]
          Length = 598

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 223/587 (37%), Positives = 337/587 (57%), Gaps = 7/587 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           +LGV  S+SG RW        + R   ++    + + +AR L +R V     + FLNP++
Sbjct: 10  YLGVTRSLSGRRWRERAACPDLTRRHQLS--LGLSEPLARALASRGVGEGEGETFLNPTL 67

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           + L PDP   +D D+AA  +V A+ N  +I++F DYDVDGA+S AL++R+     +   +
Sbjct: 68  KALFPDPSCFSDMDRAAEILVDALENRRRIVVFADYDVDGASSAALLVRWFRAMGLEIAI 127

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV- 184
           Y+PDR+ +GYGP+P+   +  +EGA+L++TVDCG+ ++DAL  A   G+ V+VIDHH + 
Sbjct: 128 YVPDRLTEGYGPSPAAFRRLKDEGAELVVTVDCGAAAHDALACAGEIGLPVVVIDHHLMR 187

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
             E  P  ALVNPNR D +SGQGHL AAGV F++L  + R  R+    P   DL + LDL
Sbjct: 188 PGEIPPIAALVNPNRPDCVSGQGHLAAAGVTFVLLAALNREARRRGLAPE-PDLRAWLDL 246

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
            A+  +CDV  L G NRA   +GL V     NPGL AL++        +  ++G+++GP 
Sbjct: 247 AAMGAICDVTRLTGFNRALAAQGLKVMSGWKNPGLAALMQVAKGQGAASTFHVGFLLGPR 306

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGRIG S+LG+RLL +DD  E   LA +LD LN +R+ +E+ ++E A   +  Q  +
Sbjct: 307 INAGGRIGRSDLGARLLSTDDPDEAAALAAELDGLNASRKEVEAQVMEAAIRHI-EQESN 365

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGK 423
              A  ++V  D WHPG++G++A RL+E++ +P   +        G GSGRS  G ++G+
Sbjct: 366 AADAPCLLVAQDDWHPGVIGIVAGRLRERYRKPCIVVGIDRAANVGKGSGRSQPGVNLGR 425

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
            V  A EEG+L+ GGGHAMAAGL+V       L DF      +           +ID ++
Sbjct: 426 AVQAAFEEGLLLAGGGHAMAAGLSVRPDAIPELRDFLNARLADEQAQAAAEDGLEIDALV 485

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            A   + AL    +   P+G GNP P FA  + +++    +   H++ T        L+A
Sbjct: 486 TARGCDRALWRDFQRLAPFGPGNPEPTFAAADMRIERPMALKGGHVRCTLTDSSGGKLKA 545

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +A+R+  T  G  L+Q  G  +HV G L  + W+G +  +L + D +
Sbjct: 546 VAWRMADTEAGRRLLQEGGA-VHVAGRLKPDDWQGREGVELEIEDVA 591


>gi|258543197|ref|YP_003188630.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634275|dbj|BAI00251.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637335|dbj|BAI03304.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640387|dbj|BAI06349.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643444|dbj|BAI09399.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646499|dbj|BAI12447.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649552|dbj|BAI15493.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652538|dbj|BAI18472.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655596|dbj|BAI21523.1| single-stranded-DNA-specific exonuclease RecJ [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 610

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 230/599 (38%), Positives = 333/599 (55%), Gaps = 12/599 (2%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRAL---AITQKHAIPDIVARVLVNRNVSIDYAK 58
           +  A LGVE S+ G RW    G E         A+ Q+  IP+IV R+L  R ++ D A 
Sbjct: 16  SSPAVLGVEASLIGRRWAWRAGAEDPALMRLGAALAQQLGIPEIVGRLLAMRQITPDQAS 75

Query: 59  DFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSH 118
            FL P +R LMPDP  LTD DKAA R+ +A+ N E I IFGDYDVDGA + A++  F   
Sbjct: 76  HFLEPKLRALMPDPSSLTDMDKAADRMAKAVQNREVIGIFGDYDVDGACASAILASFFEE 135

Query: 119 CSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIV 178
                + +IPDR+ +GYGPN + ++  + +GA ++I VDCG+ S D L   T++  DVIV
Sbjct: 136 LGCTVHTHIPDRMTEGYGPNVAALDNLVAQGASILICVDCGTASADILSQVTDK-ADVIV 194

Query: 179 IDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LN 235
           +DHH+ +    P  A VNPNR D  SG  H+CAA + FL  V   R LR+ +        
Sbjct: 195 LDHHKSEDALPPILATVNPNRPDCSSGLHHICAAALAFLAAVATTRDLRRADWFTADQPP 254

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DL+  LDLVALATVCDV+PL GLNRA+V +GL +  R+   GL AL+E   ++    A 
Sbjct: 255 PDLMRQLDLVALATVCDVMPLHGLNRAFVTQGLKIMARRQRTGLNALMEIAGVTKAPDAF 314

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
           + G+ +GP INAGGRI E+ LG RLL   DS E   +A +LD +N+ R+ +E+ +L++A 
Sbjct: 315 SCGFALGPRINAGGRIAEAALGLRLLRCPDSFEARQMAERLDAVNRRRQGVEADILDRAM 374

Query: 356 AKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRS 415
            +   Q       +VI++ G  WHPG+VG++A R+KE+F RP+   + +EDG   GSGRS
Sbjct: 375 QQAEAQ--KEAGHAVILLAGKDWHPGVVGIVAGRIKERFNRPALVGAEQEDGTIKGSGRS 432

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           + G D+G ++  A + G+L  GGGHAMAAG ++          F               P
Sbjct: 433 VPGLDLGTVIIAARQAGMLKTGGGHAMAAGFSLTADKLEDFHTFLDTRLAQAATLPEKVP 492

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTF 533
              +D V++ S     L   + +  P+GAGNP P+ A P   +     +      L++  
Sbjct: 493 -LTVDAVVSISGATAELAQDMGALAPFGAGNPEPLLAIPRVTVIRADRIGRDGNTLRLLL 551

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           + +++  L+A+ FR +  PL   L  +    +H+ G+L    W G       + DA+  
Sbjct: 552 KGENNGRLKALLFRAHENPLAAKLEDTTRPALHLAGYLRAESWNGRTDATFFIQDAAAA 610


>gi|239947713|ref|ZP_04699466.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921989|gb|EER22013.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 599

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 223/587 (37%), Positives = 334/587 (56%), Gaps = 14/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 16  QASINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLIPKIKNLL 73

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 74  PDPFHLLDMEKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNIFRDLNIICDIYVPD 133

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH       
Sbjct: 134 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHHIATEILP 193

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVA 246
            A A+VNPNR+D+ S   HL A GV FL +  I   L++ N         +L+  LDLVA
Sbjct: 194 DAVAIVNPNRIDEKSEYKHLAAVGVAFLFVTAILSNLKKQNYFTQPMLQPNLMKYLDLVA 253

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD++ L GLNRA+V  GL V +++ N G+KAL +   ++      +LG+++GP IN
Sbjct: 254 LGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKALYDMAGLNEIPKCYHLGFILGPRIN 313

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q
Sbjct: 314 AGGRVGKSSLGANLLSTSCSNEANKLAEELEKHNNERKVIELLMIEEAMEIALTQ----Q 369

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A RLKEKF +P   I+  + G G  S RSI G D G  + 
Sbjct: 370 DSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEII 428

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  +
Sbjct: 429 NAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISINKLENYKHAEYDIDLTVN 488

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQ 542
           +VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L 
Sbjct: 489 SVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCILVPNKRGFGNKALS 548

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAF   GT   + L+  + K +   G L  N W+ +   QL + D 
Sbjct: 549 AIAFNSVGTSFEDVLLSPKAKNITAIGTLKTNNWQDNYTIQLIIKDI 595


>gi|325286103|ref|YP_004261893.1| single-stranded-DNA-specific exonuclease RecJ [Cellulophaga lytica
           DSM 7489]
 gi|324321557|gb|ADY29022.1| single-stranded-DNA-specific exonuclease RecJ [Cellulophaga lytica
           DSM 7489]
          Length = 562

 Score =  435 bits (1119), Expect = e-119,   Method: Composition-based stats.
 Identities = 170/578 (29%), Positives = 275/578 (47%), Gaps = 21/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW     +    +   +     + +IVA++L+ R ++  + AK +  P +  L  DP +L
Sbjct: 2   RWTIKP-KPDAAKVAELQNALQVDEIVAKLLLQRGITTFEEAKKYFRPQLSDLH-DPYLL 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  RI QAI N E IM+FGDYDVDG  SVAL+  +L     N   YIPDR  +GY
Sbjct: 60  KDMDLAIARIEQAIANEENIMVFGDYDVDGTTSVALVSSYLQSYYPNVTTYIPDRYKEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G + + ++   +    LII +DCG  + D + YA  +G+D I+ DHH+  +    A A++
Sbjct: 120 GVSYAGIDYADDNDISLIIALDCGVKAVDKVAYAKEKGVDFIICDHHRPGATLPNAVAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +  R D       LC  GV F ++  +     Q        DL+  LDLVA A   D+VP
Sbjct: 180 DAKRNDCNYPYDELCGCGVGFKLIQALGSKRGQ-----TIEDLVPYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V       G KA+I ++     +T  ++ ++I P INA GR+    
Sbjct: 235 ITGENRVLAYYGLQVINSTPRAGFKAIINQIKKDV-LTITDVVFVIAPRINAAGRMVHGL 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   + ++ E  A  ++  N +RR ++  + ++A  ++       ++    VV  
Sbjct: 294 HAVNLLTETNLEQAEEFAAAIEQYNADRRELDQEITKEALVQITDN--KEEKHFTSVVYN 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   + K   S RS++GFD+   +        + 
Sbjct: 352 ENWHKGVIGIVASRLTETYYRPTLVFTKSGE-KLAASARSVKGFDVYNALEAC--ADHIE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+    +      F+K     +   + TP   ID  LN + ++  L+ +
Sbjct: 409 QFGGHKYAAGLTLSEAQYDGFKKEFEKVVTKTIDPNLLTPEITIDAELNFNEISPKLMRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQ-SIRVVN--LAHLQMTFESQDSETLQAIAFRVYGTP 552
           ++   P+G GN +PVF   N +     + V    AHL++      S  + AI F +    
Sbjct: 469 IKQMEPFGPGNMSPVFMAENLQDTGYAKGVGQEEAHLKLAAVQNGSNPIGAIGFNLGN-- 526

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +  +    K       L  N W+G    QL++ D  
Sbjct: 527 --KLPLVQNKKPFSAVFSLDENEWQGVVSLQLKLRDIR 562


>gi|254294222|ref|YP_003060245.1| single-stranded-DNA-specific exonuclease RecJ [Hirschia baltica
           ATCC 49814]
 gi|254042753|gb|ACT59548.1| single-stranded-DNA-specific exonuclease RecJ [Hirschia baltica
           ATCC 49814]
          Length = 609

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 224/591 (37%), Positives = 358/591 (60%), Gaps = 8/591 (1%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
              AFLGVE S++G RW          +A  I+++ + PD++ ++L  R V++D A  + 
Sbjct: 18  TGPAFLGVEHSLTGRRWRVRP--VDDEKATEISRRLSKPDLIGKLLAGRGVTLDEADTYF 75

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
           +P+++ L PDP    D D A   I++A+ +  K  +  DYDVDG  S A++ ++      
Sbjct: 76  SPTLKALFPDPSSFADMDAACEVILEALVSGRKCAVLADYDVDGGTSAAILTKYFKAWDR 135

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              +Y+PDR+ +GYGP+    E    +GA+L++TVDCG+ + +AL+ A + G+DV+V+DH
Sbjct: 136 ELILYVPDRLTEGYGPSVEAFESLKEQGAELVMTVDCGAAAVEALEAAHSLGLDVVVLDH 195

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLL 239
           H ++SE  PA A+VNPNR D  SG GH+ AAGVVF++   + R+ RQ +  P     D +
Sbjct: 196 HLMQSEPPPAAAVVNPNRPDCKSGCGHMAAAGVVFVLTAGLNRLARQKSVAPAGGLPDPM 255

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
             LDL AL T+CD+ PL G+NRA+V  GL V +R  N GL AL +   + +P +  +  +
Sbjct: 256 KWLDLCALGTLCDMAPLKGVNRAFVNAGLKVLQRMDNVGLAALSQVSGVEAPKSVYHATF 315

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP +NAGGRIG+  + ++LL ++D +E   LA +L  LN+ R+ +E+ +L++A     
Sbjct: 316 LLGPRLNAGGRIGDPWIAAKLLATEDRKEALALAERLQALNEARKEIEAEILDEATRIAE 375

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED--GKGIGSGRSIE 417
           ++  +   A  IVV G+ WHPG++G++A RLKEKF RP+  I + E+      GSGRS+ 
Sbjct: 376 SRLVEKPDAGAIVVGGEGWHPGVIGIVAGRLKEKFHRPTIVIGWGEELGPVAKGSGRSVA 435

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVF 477
           G ++G +++ A +EGI++ GGGHAMAAGL++E        D+ ++        L    V 
Sbjct: 436 GVNLGNLIAKASKEGIILSGGGHAMAAGLSLEPSQLEAFRDYMEESTAEAKKELEQARVL 495

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
           ++DG+L+ ++ +  L+  ++ AGPYGAG+P P+FA  N +  ++R V + HL      +D
Sbjct: 496 ELDGLLSPASADGELLLSVDGAGPYGAGSPEPIFAMANVRSHNVRRVGVDHLSFEILGED 555

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLD 588
              L+AIAFR     LG+ ++   G+ MH+ G L  + WRG+ + Q  V D
Sbjct: 556 GGKLRAIAFRAADADLGQAIL--SGQMMHLAGKLKPDEWRGAGKVQFEVSD 604


>gi|42520197|ref|NP_966112.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|42409935|gb|AAS14046.1| single-stranded-DNA-specific exonuclease RecJ [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 579

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 232/582 (39%), Positives = 340/582 (58%), Gaps = 15/582 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+   W     +    + L +TQ+  +P+I+AR+LV R V+I+ A DFL P IR L+
Sbjct: 7   KRSITNALWKLQ--EADQRQILTLTQRFELPEILARILVTRGVNIENASDFLYPLIRSLL 64

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D DKA  RI++AI N E + IFGDYDVDGA S AL+ R+L    +++ +YIPD
Sbjct: 65  PDPFHLLDMDKAVSRIIRAIKNDENLAIFGDYDVDGATSSALINRYLRAIDIHSIIYIPD 124

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R+ +GYG N   + +    G  L I+VDCG+ +Y  ++ A   G+D+IV+DHH    +  
Sbjct: 125 RVDEGYGLNTDALLQLKKNGIDLCISVDCGTLAYQPIEDAKAFGLDIIVVDHHLGTEKLP 184

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLDLVAL 247
            A A+VNPNRLD+ S   +L A GV FL++V + + LR+          DL  LLDLVAL
Sbjct: 185 SAVAVVNPNRLDESSPYNNLAAVGVSFLLIVALNKSLREQGFFTNKKEPDLFDLLDLVAL 244

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCDV+ + GLNRA V +GL V   + N GL+ L + + I    +   LG+ IGP INA
Sbjct: 245 GTVCDVMQITGLNRALVSQGLKVMSTRKNVGLRVLFDALGILEKPSVSRLGFSIGPCINA 304

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGRIGE++LG+RLL +DD +E   +A+KL  LN  R+++E+  L +A A+          
Sbjct: 305 GGRIGEASLGARLLSTDDDEEAHSIALKLIDLNNARKVLENEALLEATAQAEKSAQSGAN 364

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
               ++    WH GI+G++A+RLKE+F  P+  IS   +G G  S RSI G DIG  V  
Sbjct: 365 ---FIMISGNWHQGIIGIIASRLKEQFHLPTVVIS-LNNGIGKASCRSILGVDIGAAVLS 420

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           A    ++++GGGH+MAAG +++      L DFF +   N +         K D ++ A A
Sbjct: 421 AKFINLIIEGGGHSMAAGFSIKEDKINDLHDFFTERFSNSIN----EKTLKADSIVTAKA 476

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
           +N++L + L+  GP+G GNP P F     K++   V+ + H++      D+  ++AIAFR
Sbjct: 477 INLSLWNQLQRLGPFGVGNPEPRFIIQGAKIRKPEVIGVDHIKCFIAD-DNVMVRAIAFR 535

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
              T LG  +MQ   K   + G + +NYW G++  Q  + D 
Sbjct: 536 SANTHLGSAIMQGNVKA--ILGKISMNYWNGNEFVQFLIEDV 575


>gi|89889907|ref|ZP_01201418.1| single-stranded DNA-specific exonuclease [Flavobacteria bacterium
           BBFL7]
 gi|89518180|gb|EAS20836.1| single-stranded DNA-specific exonuclease [Flavobacteria bacterium
           BBFL7]
          Length = 565

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 173/580 (29%), Positives = 275/580 (47%), Gaps = 23/580 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLIL 75
           RW     Q  I     + Q+  I   +A +LV R V     AK F  P +  L  DP ++
Sbjct: 2   RWTLKP-QPDIATQEKLAQELGIDSFLAGLLVQRGVDAFAKAKSFFRPDLNELH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A +RI +AI N+E I+++GDYDVDG  SVALM  FL         YIPDR  +GY
Sbjct: 60  KDMDVAVQRIQKAIGNNENILVYGDYDVDGTTSVALMSTFLLSFYDRVATYIPDRYGEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + D + YA  +GID I+ DHH+   +   A A++
Sbjct: 120 GVSYQGIDYAADNDFSLIIALDCGVKAIDKVAYAAEKGIDFIICDHHRPGKKLPNAIAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F +                   L+  LDLVA A   D+VP
Sbjct: 180 DPKRDDCTYPFDELCGCGVGFKLCQAFVEA-----NDWEFEMLIPYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           ++G NR     GL V       G KA+I ++   + +T  ++ ++I P INA GR+  + 
Sbjct: 235 IVGENRILAYHGLNVINTSPRAGFKAIIHQLKKDT-LTITDVVFIIAPRINAAGRMKHAL 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               L+++DD +E + +A +++  N +RR  + ++ E+A+ +++    + ++    VV  
Sbjct: 294 HAVELMVTDDFKEAQRIAAEIEEYNADRREADRSITEEAKQQIINN--NEEERFTTVVFQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   D     S RS+ GFD+   +        + 
Sbjct: 352 ENWHKGVIGIVASRLIETYYRPTLVFTKSGD-YLAASARSVSGFDVYNALEQC--SDYIE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT++  N+    D F++     +     TP  KID +L    ++     +
Sbjct: 409 QFGGHKYAAGLTLKPENYSLFKDRFEEVVCATIEKQHLTPEIKIDAMLPLENISPKFYRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVNL--AHLQMTF--ESQDSETLQAIAFRVYG 550
           L+   PYG GN  PVF           + V     HL++       D   + AI F +  
Sbjct: 469 LQQMAPYGPGNMRPVFMTEKVMDTGYGKCVGKSEDHLKVKVVKNKNDRNGMDAIGFNLG- 527

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              G+  +     +  +   +  N W G+   QL + D  
Sbjct: 528 ---GKSDLVKNKVKFDIAYTISENEWNGNISLQLLLKDIK 564


>gi|157825818|ref|YP_001493538.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia akari
           str. Hartford]
 gi|157799776|gb|ABV75030.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia akari
           str. Hartford]
          Length = 587

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 220/587 (37%), Positives = 329/587 (56%), Gaps = 14/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QTSINGKIWQQKLIHEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLIPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D  KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMKKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNVFRDLNIICDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  ++  +L+ITVDCG+ +Y+A++YA +  +DVIVIDHH       
Sbjct: 122 RIAEGYGPTPFAMQKIKDKDTELLITVDCGAMAYEAIKYAKDLNLDVIVIDHHIATEILP 181

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVA 246
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N         +L+  LDLVA
Sbjct: 182 DAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSHLKKQNYFTQTMLQPNLMKYLDLVA 241

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD++ L GLNRA+V  GL V +++ N G+K L +   ++      +LG+++GP IN
Sbjct: 242 LGTVCDMMTLTGLNRAFVSSGLKVMQQRQNIGIKTLYDMAGLNEIPKCYHLGFILGPRIN 301

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q
Sbjct: 302 AGGRVGKSSLGANLLSTSCSNEASKLAEELEKHNNERKVIELLMIEEATEIALTQ----Q 357

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A RLKEKF +P   ++  + G G  S RSI G D G  + 
Sbjct: 358 DSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVVALND-GIGKASCRSILGIDFGAEII 416

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L   
Sbjct: 417 NAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISINTLENYKHAEYDIDLTVD 476

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQ 542
            VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L 
Sbjct: 477 GVNFHLMEELNTLEPFGQGNHEPIFKFDDLFVLKAYIVGSKHIKCMLVPNKRSFGNKALS 536

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAF   GT   + L+  + K +   G L  N W+ +   QL + D 
Sbjct: 537 AIAFNSVGTSFEDVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIKDI 583


>gi|294501371|ref|YP_003565071.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus megaterium
           QM B1551]
 gi|294351308|gb|ADE71637.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus megaterium
           QM B1551]
          Length = 780

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 181/593 (30%), Positives = 294/593 (49%), Gaps = 29/593 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDP 72
           S  RW      E         +   I  +VA +L+NR ++  + A++FL+        DP
Sbjct: 4   SKKRWNVQECDE--QLVNEFVENLNITPLVASLLLNRGMTTVEAAREFLHVD-AQTFHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D DKA  RI QAI ++EKIMI+GDYD DG +S ++M+  L     + + YIP+R  
Sbjct: 61  FLLHDMDKAVARIQQAIDHNEKIMIYGDYDADGVSSTSVMLSALQQLGADVDFYIPNRFT 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN    +K    G QL+ITVD G ++ +   YA     D+I+ DHH+       AY
Sbjct: 121 EGYGPNKEAFDKISAGGYQLVITVDTGISAVEETAYARELNFDLIITDHHEPGPVLPDAY 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+++P           L   GV F +   +   L +            LL+L  + T+ D
Sbjct: 181 AIIHPKLPGSTYPFKELAGVGVAFKLAHALLGELPE-----------HLLELAVIGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAEN-LGYMIGPSINAGGRI 311
           +VPL+  NR    KGL   +     G++AL+    +      E+ +G+ + P INA GR+
Sbjct: 230 LVPLVDENRLIARKGLDYLKLTKRTGIEALLSVCGVKREEINEDTIGFAMAPRINAVGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
            +++    LL++ +++E + LA ++D LN+ R+ + + + E+A   V +     +  SV+
Sbjct: 290 QDADPAVHLLMTTNAEEAKGLAKEIDALNKERQQIVNDITEEAVEFVESMYPPDEN-SVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDG-KGIGSGRSIEGFDIGKMVSFAVE 430
           +VEG+ W+ G+VG++A+RL EKF RP+  +S + +     GS RSIEGFD+   +S    
Sbjct: 349 IVEGEGWNAGVVGIVASRLVEKFYRPTIVLSIDSENRIAKGSARSIEGFDLFANLSKC-- 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T+   +   L     + A N++      P+  +D V     + +
Sbjct: 407 RDILPHFGGHPMAAGMTLNSDDVEELRRRLNEQASNVLTEQDFIPITSVDTVCTTEEITL 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRV 548
             I+ + +  P+G  NP P     +    S+R +     HL++ FE     ++ A+ F  
Sbjct: 467 ENIEQMSALAPFGMHNPKPKVLIKDVHTTSMRKIGANKNHLKLVFED-SGVSVDAVGFG- 524

Query: 549 YGTPLGEFLMQSRG-KRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
               LG  L +     ++ + G L +N W    + QL V D S  E   F  +
Sbjct: 525 ----LGYILDEVSPIAKVSLVGELSINEWNNMHKPQLMVEDISVDEWQMFDYR 573


>gi|229586785|ref|YP_002845286.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia africae
           ESF-5]
 gi|228021835|gb|ACP53543.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia africae
           ESF-5]
          Length = 587

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 220/587 (37%), Positives = 330/587 (56%), Gaps = 14/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           P+P  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PNPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH       
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHHIATEILP 181

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVA 246
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N         +L+  LDLVA
Sbjct: 182 DAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLVA 241

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP IN
Sbjct: 242 LGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKTLYDMAGLHEIPKCYHLGFILGPRIN 301

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q
Sbjct: 302 AGGRVGKSSLGAHLLSTSCSNEATKLAKELEKHNNERKVIELLMIEEAMEIALTQ----Q 357

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A +LKEKF +P   I+  + G G  S RSI G D G  + 
Sbjct: 358 DSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEII 416

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  +
Sbjct: 417 NAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTVN 476

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQ 542
           +VN  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L 
Sbjct: 477 SVNFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKALS 536

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAF   GT   + L+  + K +   G L  N W+ +   QL + D 
Sbjct: 537 AIAFNSVGTAFEDVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIKDI 583


>gi|241116890|ref|XP_002401658.1| single-stranded DNA specific exonuclease RecJ, putative [Ixodes
           scapularis]
 gi|215493202|gb|EEC02843.1| single-stranded DNA specific exonuclease RecJ, putative [Ixodes
           scapularis]
          Length = 581

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 223/585 (38%), Positives = 333/585 (56%), Gaps = 14/585 (2%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+PD
Sbjct: 1   SINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLIPKIKNLLPD 58

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L D +KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y+PDRI
Sbjct: 59  PFHLLDMEKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNIFRDLNIICDIYVPDRI 118

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH        A
Sbjct: 119 AEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHHIATEILPDA 178

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVALA 248
            A+VNPNR+D+ S   HL A GV FL +  I   L++ N         +L+  LDLVAL 
Sbjct: 179 VAIVNPNRIDEKSEYKHLAAVGVAFLFVTAILSNLKKQNYFTQPMLQPNLMKYLDLVALG 238

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAG 308
           TVCD++ L GLNRA+V  GL V +++ N G+KAL +   ++      +LG+++GP INAG
Sbjct: 239 TVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKALYDMAGLNEIPKCYHLGFILGPRINAG 298

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q +
Sbjct: 299 GRVGKSSLGANLLSTSCSNEANKLAEELEKHNNERKVIELLMIEEAMEIALTQ----QDS 354

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
           S++ +  + WHPG++G++A RLKEKF +P   I+  + G G  S RSI G D G  +  A
Sbjct: 355 SLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEIINA 413

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
             + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  ++V
Sbjct: 414 KSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISINKLENYKHAEYDIDLTVNSV 473

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQAI 544
           N  L++ L +  P+G GN  P+F F +  +    +V   H++           ++ L AI
Sbjct: 474 NFPLMEELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCILVPNKRGFGNKALSAI 533

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF   GT   + L+  + K +   G L  N W+ +   QL + D 
Sbjct: 534 AFNSVGTSFEDVLLSPKAKNITAIGTLKTNNWQDNYTIQLIIKDI 578


>gi|323490005|ref|ZP_08095226.1| single-stranded-DNA-specific exonuclease recJ [Planococcus
           donghaensis MPA1U2]
 gi|323396301|gb|EGA89126.1| single-stranded-DNA-specific exonuclease recJ [Planococcus
           donghaensis MPA1U2]
          Length = 780

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/592 (33%), Positives = 303/592 (51%), Gaps = 27/592 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDP 72
           S  RW      E   +   I  +  I  ++A++LV R + + + A+ F+   +   M DP
Sbjct: 4   SKKRWRLTTPDE--QQVQDIQNELNISSVLAKILVTRGLNTAEAARSFMKMDVSG-MHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D D A  RI QAI N EKI+++GDYD DG  S  +MM  L     + +  IP+R  
Sbjct: 61  YLMKDMDIAIARIRQAIDNQEKIVVYGDYDADGVTSTTVMMTALQDLGADVSFMIPNRFK 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
            GYGPN  L ++  + G +LI+TVD G +  + + +A N G+DVI+ DHH +  +   A 
Sbjct: 121 HGYGPNTDLFQQAFDNGTKLIVTVDNGISGIEQVDFANNLGMDVIISDHHDIGEQLPNAL 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+V+P   +     G L   GV F +   +Y  +              L++L A+ TV D
Sbjct: 181 AIVHPRHPEGHYPFGELAGVGVAFKMAHALYEEVPD-----------HLIELTAIGTVAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRI 311
           +VPL G NR +V +GL       +P + AL E   I    IT E +G+M GP INA GR+
Sbjct: 230 LVPLHGENRLFVKEGLAALIDSPSPAIGALCEVAGIKQQDITEETIGFMFGPRINAIGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
            +++   ++ +++D  E   LA  LDVLN+ R+ +   + E+A  +V  Q        V+
Sbjct: 290 QDADPAVQMFLTEDPAEARSLASGLDVLNKERQAIVKQITEEAMLQV-EQRYPEGVPRVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           VV  + W+PG+VG++A++L EKF RPS  +S   E+GK  GS RSI+GF +      A  
Sbjct: 349 VVAQEGWNPGVVGIVASKLTEKFYRPSIVLSLNPENGKAKGSARSIDGFHLY--NELAKN 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T+E  +   L +   + A   + A    PV  ID  L    ++I
Sbjct: 407 RDILPHFGGHPMAAGMTLEASDVDELRERLIRQAETSLTAEDLLPVVDIDIPLRLDEIDI 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRV 548
             I+ + S  P+G G   P F   +  + SIR +     HL+M   +Q + TL A+ F +
Sbjct: 467 TAIESMRSLAPFGMGFAKPKFYLESVHVSSIRKIGAAQNHLKMEL-TQHAVTLDAVGFGL 525

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
               +G+ L  +   ++ V G L VN W G K+ QL V D    +   F  +
Sbjct: 526 G--SVGDEL--TPDVKIDVIGDLQVNEWNGRKKPQLMVEDVRTDQWQLFDIR 573


>gi|260459842|ref|ZP_05808096.1| single-stranded-DNA-specific exonuclease RecJ [Mesorhizobium
           opportunistum WSM2075]
 gi|259034644|gb|EEW35901.1| single-stranded-DNA-specific exonuclease RecJ [Mesorhizobium
           opportunistum WSM2075]
          Length = 593

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 305/587 (51%), Positives = 381/587 (64%), Gaps = 1/587 (0%)

Query: 4   QAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNP 63
           + FL V  S +G  W   L +     ALAI Q H +PDIVARVL  R V+ D  + FL+P
Sbjct: 6   RLFLDVRQSATGLAWEHRLTERQDMIALAIAQGHGVPDIVARVLAGRGVTADETERFLDP 65

Query: 64  SIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNA 123
           +IR L+PDP  LTD D+AA RI  A+   EK+ IFGDYDVDGAAS AL+ RFL+H SV +
Sbjct: 66  TIRDLLPDPASLTDMDRAAARIAAAVMAKEKVAIFGDYDVDGAASSALLKRFLTHFSVPS 125

Query: 124 NMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQ 183
            +YIPDRI +GYGPNP  M + ++ GA LI+TVDCG+ S  ++  A   G DV+V+DHHQ
Sbjct: 126 EIYIPDRIFEGYGPNPDAMRELVSRGATLIVTVDCGTNSAVSVDAANAAGADVVVLDHHQ 185

Query: 184 VKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLD 243
           V      A A+VNPNR DDLSGQGHLCAAGVVFL LV   R+LR     P    L   LD
Sbjct: 186 VGGALPAAIAVVNPNRDDDLSGQGHLCAAGVVFLALVQTARVLRGLTDAPPPDLLSL-LD 244

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGP 303
           L ALATVCDVVPL G+NRA+VVKGL VAR+Q N GL AL     I  PI+  +L Y+IGP
Sbjct: 245 LAALATVCDVVPLTGVNRAFVVKGLQVARQQKNEGLAALARVSRIGEPISTFHLAYLIGP 304

Query: 304 SINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCD 363
            INAGGRIG++ LGSRLL +DD  E   +A  LD LNQ R+LME  ML  A A+   +  
Sbjct: 305 RINAGGRIGDAALGSRLLATDDPVEARTIAETLDRLNQERQLMEQEMLAAARAEADAELA 364

Query: 364 DIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGK 423
                +++V   + WHPGIVGLLA+RLK+   RP+FAI+F   G G GSGRS+ GFD+G+
Sbjct: 365 GGSGPAIVVTASNNWHPGIVGLLASRLKDHARRPAFAIAFNAVGIGTGSGRSVSGFDLGR 424

Query: 424 MVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVL 483
           +V  A   G++VKGGGH MAAG+TVER   G L  FF++ A   V  L       IDG L
Sbjct: 425 LVREAATAGLIVKGGGHGMAAGITVERARLGELRAFFEERAAADVFRLQDEESLAIDGAL 484

Query: 484 NASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQA 543
            A    + L+D LE AGP+GAG+  PVF  P H+L   R V   H++   +S     +QA
Sbjct: 485 AAEGATLGLLDALEKAGPFGAGHVAPVFVLPRHRLADARSVGTNHIRCELQSDSGGRIQA 544

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           IAFR   T LGEFL ++RGK +HV G L  N+W G++  Q R++DA+
Sbjct: 545 IAFRAVDTVLGEFLFKNRGKTVHVAGSLSGNHWNGNRTVQFRIIDAA 591


>gi|238650226|ref|YP_002916077.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia peacockii
           str. Rustic]
 gi|238624324|gb|ACR47030.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia peacockii
           str. Rustic]
          Length = 587

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 220/587 (37%), Positives = 329/587 (56%), Gaps = 14/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLRPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D +KA  R V AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMEKAVDRTVTAILNNQKICIFADYDVDGATSAALLKNIFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH       
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDVNLDVIVIDHHIATEILP 181

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVA 246
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N         +L+  LDLVA
Sbjct: 182 DAVAIVNPNRIDEKSEYKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMQYLDLVA 241

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD++ L GLNRA+V  GL V +++ N G+K L +   +       +LG+++GP IN
Sbjct: 242 LGTVCDMMKLTGLNRAFVASGLKVIQQRQNIGIKTLYDMAGLHEIPKCYHLGFILGPRIN 301

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q
Sbjct: 302 AGGRVGKSSLGAHLLSTSCSNEANKLAKELEKHNNERKVIELLMIEEAMEIALTQ----Q 357

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A +LKEKF +P   I+  + G G  S RSI G D G  + 
Sbjct: 358 DSSLLFIVKEGWHPGVIGIVAGKLKEKFDKPVAVIALND-GIGKASCRSILGIDFGAEII 416

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  +
Sbjct: 417 NAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISITKLENYKHAEYDIDLTVN 476

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQ 542
           +VN  L++ L +  P+G  N  P+F F +  +    +V   H++           ++ L 
Sbjct: 477 SVNFPLMEELNTLEPFGQENHEPIFKFDDLFVLKADIVGSKHIKCMLVPNKRGFGNKALS 536

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAF   GT   + L+  + K +   G L  N W+ +   QL + D 
Sbjct: 537 AIAFNSVGTAFEDVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIKDI 583


>gi|312110096|ref|YP_003988412.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y4.1MC1]
 gi|311215197|gb|ADP73801.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y4.1MC1]
          Length = 785

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 183/589 (31%), Positives = 301/589 (51%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E I     + ++  I  ++A +LV+R V + + A  FL P ++    DP +L
Sbjct: 7   RWDVKRPDENI--VKHLVEQLRIDPLIATLLVHRGVRTAEEANAFLYP-LKQPFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              ++A  RI +AI + E I+++GDYD DG +S  +M+  L       + YIP+R  +GY
Sbjct: 64  DGMERAVVRIQRAIQDGEHILVYGDYDADGVSSTTVMVSALKEAGAIVDFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        ++G  LIITVD G  +   +  A   G+DVI+ DHH+V      AY ++
Sbjct: 124 GPNEKAFRWAKDQGFSLIITVDNGIAAVKEVALANELGMDVIITDHHEVGPTLPEAYEII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P +         L   GV F V   +   +              LLD+ A+ T+ D+V 
Sbjct: 184 HPKKPGSTYPFRELAGVGVAFKVAHALLGEVP-----------RYLLDVAAIGTIADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R+    GL+AL  +  I    I  + +G++I P +NA GR+GE+
Sbjct: 233 LTGENRVLVAQGLEQLRKTKRIGLRALCTQCGIDAEKIDEQTVGFIIAPRMNAAGRLGEA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +   RLL+++D +E + LA ++D LN+ R+ + + + E+A   +  Q    +   V+VV 
Sbjct: 293 DPAVRLLMTEDEEEAKRLAKEMDDLNRERQQLVAEIAEEAAQIIQEQFPPSENK-VLVVA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A+RL E+F RP+  +S + E G   GS RSI GFD+    S +    I
Sbjct: 352 KEGWNPGVIGIVASRLVEQFYRPTIVLSIDAEKGIAKGSARSIHGFDM--FSSLSTCRDI 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+  GGH MAAG+T+   + G L       A +++     TP+  ID V + S + +A+ 
Sbjct: 410 LLHFGGHPMAAGMTLSLEDVGELRRRLNALADDMLTDDDFTPITSIDAVCSVSDLTMAVA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + LE   P+G GN  P+F   N  ++++R V    +HL+  F +Q+   + ++ F     
Sbjct: 470 EQLEKFAPFGVGNAKPLFLMENVSVETMRRVGADQSHLKAVF-AQNGAAIDSVGFGFGYL 528

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   +   ++ V G L +N W   ++ QL + D +  E   F  +
Sbjct: 529 ----RDEIAPDAKVSVVGELVINEWNHLRKPQLMIYDMAVHECQLFDIR 573


>gi|194017157|ref|ZP_03055769.1| recombination protein J [Bacillus pumilus ATCC 7061]
 gi|194011025|gb|EDW20595.1| recombination protein J [Bacillus pumilus ATCC 7061]
          Length = 774

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 182/593 (30%), Positives = 285/593 (48%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
           +S  RW          +  ++++   I  + A +LV R +   + A+ FL         D
Sbjct: 3   LSKMRWEY--EHPSEEKVKSLSENLNISALTASLLVKRGLEEVEEARSFLFDQKAEFH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L    +A  RI +AI   E I+IFGDYD DG  S ++++  L   S   + YIPDR 
Sbjct: 60  PFLLKGMKEAVERINKAIEEQESIVIFGDYDADGVTSTSVLLHTLKELSAKVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN         +GA L+ITVD G  + +  + A   G+D+I+ DHH+   E   A
Sbjct: 120 KEGYGPNEQAFRYIKEQGASLVITVDTGIAAVNEARIAKEIGLDLIITDHHEPSEELPEA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A+V+P +         L   GV F V   +   L              LLDL A+ T+ 
Sbjct: 180 LAIVHPKQPGCEYPFKELAGVGVAFKVAHALLGKLP-----------TQLLDLAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+VPL   NR    KGLM  R+   PGLKAL++    +      E +G+ I P +NA GR
Sbjct: 229 DLVPLHDENRWLAKKGLMQLRQSNRPGLKALLKEAGATLEEANEETVGFQIAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL+++D  E E LA  +  LN+ R+ + S + E+A   V    DD    S 
Sbjct: 289 IEQADPAVHLLMTEDKDEAEELARFVQELNKERQKIVSTITEEAIQMVEETGDDQ---SA 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L + F RP+  +  +E+ +   GS RSI GFD+   +S   
Sbjct: 346 IVVAKAGWNPGVVGIVASKLTDTFSRPAIVLGIDEETQMAKGSARSIPGFDLFFHLSKC- 404

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L +   ++A+  +      P+ ++D V     + 
Sbjct: 405 -RDILPHFGGHPMAAGMTLRADDVPLLRERLNQYANETLTEEDFIPIQRVDAVCKVDELT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I+ +    P+G  NP P     + +L+ IR +     H++M+ + +D + L  + F 
Sbjct: 464 VEAIEEVGMLSPFGMQNPKPFIMIEDVRLEEIRTIGANQNHIKMSLKDED-QLLDCVGFH 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                         G R+ V G + +N W   K+ QL + DA   E   F  +
Sbjct: 523 QGQLK----EEVVTGSRISVIGEMSINEWNNRKKPQLMLKDARVDEWQLFDLR 571


>gi|260575454|ref|ZP_05843453.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter sp. SW2]
 gi|259022374|gb|EEW25671.1| single-stranded-DNA-specific exonuclease RecJ [Rhodobacter sp. SW2]
          Length = 581

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 247/590 (41%), Positives = 344/590 (58%), Gaps = 11/590 (1%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           M ++AFL VE S +G RWV    ++    A A+ Q   +P  +   LV R V+   A  +
Sbjct: 1   MTNRAFLNVEASATGRRWVGPGTEQD-RLAEAMAQVTHLPLALCHTLVKRGVAPGEAAAY 59

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L PS+R L+PDPL L D  KAA R VQA+   ++I +F DYDVDG AS AL++ +L    
Sbjct: 60  LAPSLRDLLPDPLSLRDMGKAAARFVQAVKARQRIAVFADYDVDGGASAALLLVWLRAMG 119

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
             A +YIPDRI +GYGPN   M   +     +II VDCG+ S++ +  A     DV+V+D
Sbjct: 120 QGATLYIPDRIDEGYGPNAPAM-AALAAAHDVIICVDCGTLSHEPIAAAKAA--DVLVLD 176

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLS 240
           HH       PA A+VNPNR D+    GHLCAA VVFL+LV   R LR +       DL++
Sbjct: 177 HHLGAETLPPALAVVNPNRQDEDGSLGHLCAASVVFLLLVEANRQLRAEG--TPGPDLMA 234

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           +LDLVALATV DV PL+G+NRA+V +GL V  R+   GLKAL +   +    T   LG++
Sbjct: 235 MLDLVALATVADVAPLLGVNRAFVRQGLRVMARRERIGLKALADVARMDQAPTPYALGFL 294

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           +GP INAGGRIG ++LG+RLL +DD  E   LA +LDVLN  RR +E+A+   A A+   
Sbjct: 295 LGPRINAGGRIGAADLGARLLATDDPHEAAALAERLDVLNTERREIEAAVRASALAQAEA 354

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
           +  D     ++   G+ WHPG+VG++AARLKE   RP+  I   +  +G GSGRS+ G D
Sbjct: 355 RGFDG---PLVWAAGEGWHPGVVGIVAARLKEGANRPAVVIG-FDGDEGKGSGRSVSGVD 410

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G  +     EG++ +GGGH MAAGL++ R       +                   +ID
Sbjct: 411 LGAAIQRLASEGLIGRGGGHKMAAGLSLSRAQLEPAMERLGALLAKQGAGQGGPADLRID 470

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
           G+L   A  +AL++ LE+AGPYGA +P P FAF + +  S R +  +HL+++F       
Sbjct: 471 GLLMPGAATMALVEQLEAAGPYGAASPAPRFAFAD-QAVSARRMGESHLRLSFSDGLGAR 529

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           L+A+AF  +  PLG  L      R H+ G L +N + G  + QLR+ DA+
Sbjct: 530 LEAVAFGAFDGPLGPMLENPGAARFHLAGRLEINSYGGRNKVQLRLEDAA 579


>gi|83858254|ref|ZP_00951776.1| single-stranded-DNA-specific exonuclease RecJ [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853077|gb|EAP90929.1| single-stranded-DNA-specific exonuclease RecJ [Oceanicaulis
           alexandrii HTCC2633]
          Length = 592

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 226/595 (37%), Positives = 332/595 (55%), Gaps = 6/595 (1%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
             +   GV  S+ G  W      +      AI +   + D + R++  R ++ + A  FL
Sbjct: 1   MSEPLFGVRQSLGGRSWRLKAADDN--AIQAICRATGVSDALGRLMAARGLTAEDAPAFL 58

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R   PDP  L   D+AARRI  A+   ++I +F DYDVDGA S A +  +L     
Sbjct: 59  APKLRDSFPDPSTLKGMDEAARRIWDALDAGDRIALFADYDVDGATSAAQLGGWLRTLGA 118

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
           +  +Y+PDRI +GYGPN   ++    +GA+L+IT+DCG+ S   L  A   G+ V+VIDH
Sbjct: 119 DPIIYVPDRIEEGYGPNAPALKSLKEQGARLVITLDCGAASVGPLTAAHEMGLPVVVIDH 178

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFDLL 239
           H +  E  PA ALVNPN+  D+SG GHL AAGV F++L  + R  R+          ++L
Sbjct: 179 HLMDGEIPPADALVNPNQPGDVSGCGHLAAAGVTFVLLAALNREGRRRGAFKGQAEPNVL 238

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
              DL AL T+CDVV L G+NRA V +GL V      PG+ AL     +  P +  + G+
Sbjct: 239 DFADLAALGTICDVVSLTGVNRAIVAQGLKVMSAWSRPGMAALAAAAGVQGPASPYHAGF 298

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGR+G+S+LG+RL+++ D +E   +A  LD LN  RR +E+ +L+QA+A+V 
Sbjct: 299 LLGPRINAGGRVGQSDLGARLMMTQDPKEAAHIAQTLDALNAERRAIETEVLDQAQAQVE 358

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEG 418
               +     +++  G+ WHPG++G++A R+KE+F RP+  I    E G G GSGRS  G
Sbjct: 359 ALKLE-DDTPILIASGEHWHPGVIGIVAGRIKERFNRPAIVIGVDPETGLGKGSGRSCTG 417

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
            ++G  V+ A EEG+LV GGGHAMA GLTV+    G L D+          A      + 
Sbjct: 418 VNLGAAVAAAREEGLLVAGGGHAMACGLTVDVNRIGELTDYLTARLKQEWIAAEEARTYS 477

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +D V++ SAV+    + L +A PYG GNP P FAF + +    + V   H++ TFES   
Sbjct: 478 VDAVISPSAVSFEFCEALSAAEPYGMGNPEPRFAFSSLRRTYAQRVGTDHVRFTFESPGG 537

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
             L  I+FR    P+G+ L+       HV G L     R  ++ +L + D +  +
Sbjct: 538 GRLTGISFRSADQPMGQALLNGPDGLWHVAGKLRAEDNRYGRKAELHLEDLAKAD 592


>gi|329114086|ref|ZP_08242850.1| Single-stranded-DNA-specific exonuclease RecJ [Acetobacter pomorum
           DM001]
 gi|326696625|gb|EGE48302.1| Single-stranded-DNA-specific exonuclease RecJ [Acetobacter pomorum
           DM001]
          Length = 611

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 229/599 (38%), Positives = 330/599 (55%), Gaps = 12/599 (2%)

Query: 2   NDQAFLGVECSISGFRWVSLLGQEGINRAL---AITQKHAIPDIVARVLVNRNVSIDYAK 58
           +  A LGVE S  G RWV   G E         A+ Q+  IP+IV R+L  R ++ D A 
Sbjct: 17  STPAVLGVEASFVGRRWVWRAGAEDPALMRLGAALAQQLGIPEIVGRLLAMRQITPDQAP 76

Query: 59  DFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSH 118
            FL P +R LMPDP  LTD DK A R+ +A+ N E I IFGDYDVDGA + A++  F   
Sbjct: 77  HFLEPKLRALMPDPSTLTDMDKVAARMAKAVQNREVIGIFGDYDVDGACASAILASFFEE 136

Query: 119 CSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIV 178
                + +IPDR+ +GYGPN + ++  + +GA ++I VDCG+ S D L   T++  DVIV
Sbjct: 137 LGCTVHTHIPDRMTEGYGPNVAALDNLVAQGASILICVDCGTASADILCQMTDK-ADVIV 195

Query: 179 IDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LN 235
           +DHH+ +    P  A VNPNR D  SG  H+CAA + FL  V   R LR+ +        
Sbjct: 196 LDHHKSEDALPPILATVNPNRPDCPSGLHHICAAALAFLAAVATTRDLRRADWFTANQPP 255

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DL+  LDLVALATVCDV+PL GLNRA+V +GL +  R+   GL AL+E   ++    A 
Sbjct: 256 PDLMRQLDLVALATVCDVMPLHGLNRAFVTQGLKIMARRQRTGLNALMEIAGVTKAPDAF 315

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
           + G+ +GP INAGGRI E+ LG RLL   D+ E   +A +LD +N+ R+ +E+ +L+ A 
Sbjct: 316 SCGFALGPRINAGGRIAEAALGLRLLRCPDNFEARQMAERLDAVNRRRQGVEADILDLAM 375

Query: 356 AKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRS 415
            +   Q       +VI++ G  WHPG+VG++A R+KE+F RP+   + +EDG   GSGRS
Sbjct: 376 QQAEAQ--KKAGHAVIMLAGKDWHPGVVGIVAGRIKERFNRPALVGAEQEDGTIKGSGRS 433

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           + G D+G ++  A + G+L  GGGHAMAAG ++          F               P
Sbjct: 434 VPGLDLGTVIIAARQAGMLKTGGGHAMAAGFSLTADKLEEFHTFLDTRLAQAATLPEKVP 493

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTF 533
              +D V+  S     L   + +  P+GAGNP P+ A P   +     +      L++  
Sbjct: 494 -LTVDAVVAISGATAELAQDMGALAPFGAGNPEPLLAIPRVTVIRADRIGRDGNTLRLLL 552

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           + +++  L+A+ FR +  PL   L  +    +H+ G+L    W G       + DA+  
Sbjct: 553 KGENNGRLKALLFRAHENPLAAKLEDTTRPALHLAGYLRAESWNGRTDATFFIQDAAAA 611


>gi|325105083|ref|YP_004274737.1| exonuclease RecJ [Pedobacter saltans DSM 12145]
 gi|324973931|gb|ADY52915.1| exonuclease RecJ [Pedobacter saltans DSM 12145]
          Length = 577

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 168/578 (29%), Positives = 275/578 (47%), Gaps = 19/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
            RW   L          + Q+  I DI+A +L NR ++    AK F  P ++ L  DP +
Sbjct: 14  KRWAEHLI-TNFEAVDKLAQELNISDILAHMLYNRGITSFSEAKAFFRPELQHLH-DPFL 71

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           +   ++A  RI +AI  +E I+++GDYDVDG  SVAL+  F      N + YIPDR ++G
Sbjct: 72  MNGMEEAVARIEEAIRENENILVYGDYDVDGTTSVALVYSFFKEIYPNISYYIPDRYIEG 131

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++   +    LII +DCG  + D ++YA ++GID I+ DHH    E   A A+
Sbjct: 132 YGISSQGIDFAADNDVSLIIALDCGIKAVDKVEYAKSKGIDFIICDHHLPGEEIPAAVAV 191

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P RLD       L   G+ F +                   +   LDLVA++   D+V
Sbjct: 192 LDPKRLDCNYPYKELSGCGLGFKLAQAYAEK-----NDVPFEKVCEYLDLVAVSIASDIV 246

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           P+ G NR     GL         GLKALIE    +   T  ++ + IGP INA GRI ++
Sbjct: 247 PITGENRVLAYYGLQKLNNNPCNGLKALIELSGKTDRFTISDIVFSIGPRINAAGRIDDA 306

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
               RLLI+  +Q  E     +++ N  R+  ++ + EQA   + +   ++      VV 
Sbjct: 307 KHSVRLLIASSTQLAEDAGFIINLKNTERKEYDTNITEQALNMIGS-SPEMIGRKSTVVY 365

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
              WH G++G++A+RL EK+ +P+  ++ + +G   GS RS+ G+D+ +         +L
Sbjct: 366 DKNWHKGVIGIVASRLTEKYYKPTVVLT-DSNGHVAGSARSVLGYDLYEA--LCECSDLL 422

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
            + GGH  AAGLT++  N  +  + F+    + +   +      ++  +  S +      
Sbjct: 423 EQFGGHKYAAGLTMKPENVNKFIERFETVVASSITEEMLVQQISVEKCIGLSDITPKFFR 482

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSI-RVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           +L    P+G  N  P+F            +V   HL+M+   +DS   + I F      L
Sbjct: 483 ILNQFAPFGPQNMVPIFMTREVYSYGYGSIVGNNHLKMSVRQKDSSVFECIGFG-----L 537

Query: 554 GEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           G++L Q +RG    +   +  N W+  +  QL +    
Sbjct: 538 GDYLEQINRGTPFDICYTIEENVWKDRRSIQLNIKGIK 575


>gi|254502532|ref|ZP_05114683.1| single-stranded-DNA-specific exonuclease RecJ [Labrenzia alexandrii
           DFL-11]
 gi|222438603|gb|EEE45282.1| single-stranded-DNA-specific exonuclease RecJ [Labrenzia alexandrii
           DFL-11]
          Length = 606

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 278/590 (47%), Positives = 374/590 (63%), Gaps = 3/590 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            +  LGV  S +   W   L       A+AI+Q+H +PD+++RV+  R V+   A  FL 
Sbjct: 11  GRLVLGVARSANDNAWRERLSAAETRAAMAISQQHGLPDVLSRVMAARGVAAADASAFLE 70

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           PS++ LMPDP  L D D A  R+  A+   +KI IFGDYDVDGA S A++  +L    ++
Sbjct: 71  PSLKTLMPDPSSLVDMDAAVARVADAVQTGKKIAIFGDYDVDGATSSAVLANYLQWLGLD 130

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
             ++IPDRI++GYGPN   +E     GA+L+IT+DCGSTS++A + A    +DV+VIDHH
Sbjct: 131 PVIHIPDRIIEGYGPNGPAIENLQAGGAELLITLDCGSTSFEAFETAKKLNLDVVVIDHH 190

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLS 240
           QV        ALVNPNR DDLSGQGHL A GV FL +V + R LRQ          DL++
Sbjct: 191 QVGETLPEVRALVNPNRQDDLSGQGHLAAVGVTFLFIVGLNRELRQRGAFSGRQAPDLMA 250

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
           LLDLVAL TVCDVVPL GLNRAYV +GL V  ++ N GL AL +   +S      +LG++
Sbjct: 251 LLDLVALGTVCDVVPLQGLNRAYVTRGLAVMHQRQNHGLTALSDTARVSGKPAPYHLGFL 310

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL + D  E   +A +LD LN  R+ ME+ MLEQA A+   
Sbjct: 311 IGPRINAGGRIGDAALGARLLTTADPHEARAIAERLDQLNTERQAMEAVMLEQAGAEAAI 370

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
             +     +V++   + WHPGIVGL+A+RLKE   RP+FAI+++E GKG GSGRSI G D
Sbjct: 371 AIEHR-DPAVLLTGSNDWHPGIVGLIASRLKEAHRRPAFAIAYDETGKGTGSGRSINGVD 429

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +GK V  AV++G+L KGGGHAMAAGLTV +     L  FF     + V A       KID
Sbjct: 430 LGKAVRKAVDDGLLEKGGGHAMAAGLTVRQEKAADLEAFFNDVLKDDVEAATAHRELKID 489

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
             L A+  N+ L++MLE AGPYGAG+  PVFAFP H++    VV   H++ T  + D   
Sbjct: 490 AALTATGANLDLMNMLEKAGPYGAGHSEPVFAFPAHRISFADVVGKGHVRATLAAGDGTA 549

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           L+ I F+    P G+ L++ RG+ +HV G L ++ W+G+ + QLR+LD +
Sbjct: 550 LKGICFKAEDKPHGQMLLEGRGRNLHVAGTLSIDTWQGTPKVQLRILDVA 599


>gi|212638568|ref|YP_002315088.1| Single-stranded DNA-specific exonuclease RecJ [Anoxybacillus
           flavithermus WK1]
 gi|212560048|gb|ACJ33103.1| Single-stranded DNA-specific exonuclease RecJ [Anoxybacillus
           flavithermus WK1]
          Length = 789

 Score =  432 bits (1110), Expect = e-118,   Method: Composition-based stats.
 Identities = 182/593 (30%), Positives = 292/593 (49%), Gaps = 31/593 (5%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
            S  RW     Q    +   I Q   I  +VA +LV+R   +++ A+ F     +     
Sbjct: 6   ASKTRWNIQ--QVNEQQVQMIAQALHITPLVASLLVSRGYHTVEAARSFFER--KQSFHS 61

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L D +KA  RI +AI N E I++FGDYD DG +S  +M+  L     N + YIP+R 
Sbjct: 62  PFLLNDMEKAVERIEKAITNDEHILVFGDYDADGVSSTVVMVSALREKGANVSFYIPNRF 121

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN         +G  LIITVD G ++      A   GID+I+ DHH+       A
Sbjct: 122 TEGYGPNEQAFRLAKQQGVSLIITVDTGISALHEANVAKQLGIDLIITDHHEPGPVLPEA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA ++P    +     HL   GV F +   +   +               LD+VA+ T+ 
Sbjct: 182 YATIHPKISPN-YPFKHLAGVGVAFKLAHALIGRVP-----------YEWLDVVAIGTIA 229

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAEN-LGYMIGPSINAGGR 310
           D+VPL   N      G+   R+    GL+AL ++  +S     E+ + +MIGP +NA GR
Sbjct: 230 DLVPLQDENHLLARLGIEQFRQTNRLGLQALCKQCGVSHTAVTEDTIAFMIGPRVNAAGR 289

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +  ++   +LL++ D+ E +MLA ++D +N+ R+ + + + E+A   V     D     V
Sbjct: 290 LDCADPAVQLLLTTDAHEADMLAEQIDAMNRERQQLVNEITEEAIQLVEQHYRD---DRV 346

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAV 429
           +VV  + W+ G++G++A+RL EKF RP+  +S  +E G   GS RSIEGFD+    + + 
Sbjct: 347 LVVAKEGWNVGVIGIVASRLVEKFYRPTIVLSIDQEKGIAKGSARSIEGFDL--FANLSN 404

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L     + A   +      P+  ID   + S V+
Sbjct: 405 CRDILPHFGGHPMAAGMTLSFHDVDELRRRLNEAAEQQLTDEHFIPITHIDLCCSISDVS 464

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           + LI+ +    P+G GNP P   F + +L ++R +     HL++   +++ +TL+AI F 
Sbjct: 465 LELIEQMNRLAPFGMGNPKPRVLFQHVQLDTLRKIGTDQNHLKLLL-AEEGKTLEAIGFG 523

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                       +   R+ + G L +N W   ++ QL + D +  E   F  +
Sbjct: 524 FGNIG----DEIAPNVRLSIVGELAINEWNNFRKPQLMIQDIAVNEWQLFDMR 572


>gi|295399344|ref|ZP_06809326.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978810|gb|EFG54406.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 785

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 183/589 (31%), Positives = 301/589 (51%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E I     + ++  I  ++A +LV+R V + + A  FL P ++    DP +L
Sbjct: 7   RWDVKRPDENI--VKHLVEQLRIDPLIATLLVHRGVRTAEEANVFLYP-LKQPFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              ++A  RI +AI + E I+++GDYD DG +S  +M+  L       + YIP+R  +GY
Sbjct: 64  DGMERAVVRIQRAIQDGEHILVYGDYDADGVSSTTVMVSALKEAGAIVDFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        ++G  LIITVD G  +   +  A   G+DVI+ DHH+V      AY ++
Sbjct: 124 GPNEKAFRWAKDQGFSLIITVDNGIAAVKEVALANELGMDVIITDHHEVGPTLPEAYEII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P +         L   GV F V   +   +              LLD+ A+ T+ D+V 
Sbjct: 184 HPKKPGSTYPFRELAGVGVAFKVAHALLGEVP-----------RYLLDVAAIGTIADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R+    GL+AL  +  I    I  + +G++I P +NA GR+GE+
Sbjct: 233 LTGENRVLVAQGLEQLRKTKRIGLRALCTQCGIDAEKIDEQTVGFIIAPRMNAAGRLGEA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +   RLL+++D +E + LA ++D LN+ R+ + + + E+A   +  Q    +   V+VV 
Sbjct: 293 DPAVRLLMTEDEEEAKRLAKEMDDLNRERQQLVAEIAEEAAQIIQEQFPPSENK-VLVVA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A+RL E+F RP+  +S + E G   GS RSI GFD+    S +    I
Sbjct: 352 KEGWNPGVIGIVASRLVEQFYRPTIVLSIDAEKGIAKGSARSIHGFDM--FSSLSTCRDI 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+  GGH MAAG+T+   + G L       A +++     TP+  ID V + S + +A+ 
Sbjct: 410 LLHFGGHPMAAGMTLSLEDVGELRRRLNALADDMLTDDDFTPITSIDAVCSVSDLTMAVA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + LE   P+G GN  P+F   N  ++++R V    +HL+  F +Q+   + ++ F     
Sbjct: 470 EQLEKFAPFGVGNAKPLFLMENVSVETMRRVGADQSHLKAVF-AQNGAAIDSVGFGFGYL 528

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   +   ++ V G L +N W   ++ QL + D +  E   F  +
Sbjct: 529 ----RDEIAPDAKVSVVGELVINEWNHLRKPQLMIYDMAVHECQLFDIR 573


>gi|308070367|ref|YP_003871972.1| Single-stranded-DNA-specific exonuclease recJ [Paenibacillus
           polymyxa E681]
 gi|305859646|gb|ADM71434.1| Single-stranded-DNA-specific exonuclease recJ [Paenibacillus
           polymyxa E681]
          Length = 798

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 179/592 (30%), Positives = 299/592 (50%), Gaps = 26/592 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDP 72
           S +RW     +  +  A  +T++  I  +++R+LVNR V+    A  FL  S+  +  DP
Sbjct: 4   SQYRW--KTPEANLEAAQLLTEELGISPLLSRLLVNRGVTTAGEANRFLYGSVDDVH-DP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L    +A  RI QA+   E I+I+GDYD DG +S +LM++ +     + ++YIP R  
Sbjct: 61  FLLLGMKEAVPRIRQALERGEHILIYGDYDADGVSSTSLMIQLMRFLKASYDIYIPHRSN 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++    +G  L+ITVD G ++ + + YAT+ GIDVIV DHH+  +    AY
Sbjct: 121 EGYGLHNHALDWAHQQGVTLVITVDTGISAVEQIAYATSLGIDVIVTDHHEPPAVLPEAY 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
            L+NP           L   GV   +   +   + +              ++ A+ TV D
Sbjct: 181 TLINPKLPGCPYPFKGLAGVGVALKLAQALLGEVPE-----------EWFEIAAIGTVAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE-NLGYMIGPSINAGGRI 311
           ++PL G NR  V KG+   R    PG++AL+    +        N+ + + P INA GR+
Sbjct: 230 LMPLHGENRTMVRKGIQSMRNSAFPGIRALLHVAGVDISTVTSVNIAFALAPRINASGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             +     LL ++  +E + LA  LD+LN+ R+ +   ++EQAE ++ ++ +  +  SVI
Sbjct: 290 DHAGRAVSLLTTEKEEEADQLAHALDLLNRERQQVVERIVEQAEQQLASKLNGGKLPSVI 349

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVE 430
           V+ G+ W+ G+VG++A++L +++ RP+  +  + E G   GS RSI   DI         
Sbjct: 350 VLAGEGWNVGVVGIVASKLLDRYYRPTIILGIDAETGTCKGSARSIPALDIYSA--LTDS 407

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             ++   GGH  AAG+T+ R N     +   ++A +I+      PV + D V     V++
Sbjct: 408 HELMEHFGGHPSAAGMTLSRDNLELFEEQLNRYAGSILTPEDLIPVAEADMVCRMDEVSL 467

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRV 548
            +++ LE   P+G GNP+P F     +L+  R +     H+++  E Q+   L AIAFR 
Sbjct: 468 QVVEELELLQPFGMGNPSPRFVLQGLQLREARKMGREKNHVKLLLE-QNGLPLDAIAFRR 526

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
               L +FL Q     + + G L +N W G +  QL + D        F  +
Sbjct: 527 GD--LADFLQQQT--EIDLLGELSINEWNGKRSLQLMMQDIRVQAPQIFDYR 574


>gi|305665887|ref|YP_003862174.1| single-stranded-DNA-specific exonuclease recJ [Maribacter sp.
           HTCC2170]
 gi|88710662|gb|EAR02894.1| single-stranded-DNA-specific exonuclease recJ [Maribacter sp.
           HTCC2170]
          Length = 562

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 169/578 (29%), Positives = 279/578 (48%), Gaps = 21/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E   +   ++    +  +V  +L+ R ++  D AK F  P +  L  DP ++
Sbjct: 2   RWTLKPKPEQK-QIEELSSALKVDGLVGTLLIQRGITTYDQAKKFFRPELTDLH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  RI +AI N E I+++GDYDVDG  SVAL+  +L     N   YIPDR  +GY
Sbjct: 60  KDMDLAVARIEKAIANDENILVYGDYDVDGTTSVALVSSYLLQGYPNVATYIPDRYDEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LI+ +DCG  + D + YA ++GID I+ DHH+   +   A A++
Sbjct: 120 GVSYKGIDFAEDNDFALIVALDCGVKAIDKVTYANDKGIDFIICDHHRPGDQLPDAIAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  +       NK     DL+  LDLVA A   D+VP
Sbjct: 180 DPKREDCDYPYDELCGCGVGFKLIQALAS-----NKGETIDDLVMYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V   +   G KA+I ++   + +T  ++ ++I P INA GR+    
Sbjct: 235 MTGENRVLAYFGLKVINAEPRIGFKAIINQIK-KNELTITDVVFIIAPRINAAGRMKHGQ 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL+ ++ ++ E++A +++  N +RR ++  +  +A  ++       ++    VV  
Sbjct: 294 HAVNLLVEENLEQAEVIAKEIEQFNFDRRNLDQEITAEALVRIKEN--KEEERFTSVVYK 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           D WH G++G++A+RL E + RP+   +   D K   S RS++GFD+   +    E   + 
Sbjct: 352 DSWHKGVIGIVASRLTETYYRPTLVFTKSGD-KLAASARSVKGFDVYNALQACSEH--IE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+    +      F++   + +   + TP   +D  ++ S +   L  +
Sbjct: 409 QFGGHKYAAGLTLLPEQYEPFKAKFEQVVADTIEPHLLTPEINVDNSISLSDITPKLYRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQ-SIRVV--NLAHLQMTFESQDSETLQAIAFRVYGTP 552
           +    P+G GN  PVF   N K     + V     HL++      S ++  I F +    
Sbjct: 469 IRQFAPFGPGNMTPVFMAENLKDSGYAKGVGEGEKHLKLAVTQNGSRSIGGIGFNLGD-- 526

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +  +    K       +  N W GS R QL++ D  
Sbjct: 527 --KMAIVKNTKPFDAVFSIDENEWNGSVRLQLKLRDIK 562


>gi|157693166|ref|YP_001487628.1| recombination protein J [Bacillus pumilus SAFR-032]
 gi|157681924|gb|ABV63068.1| recombination protein J [Bacillus pumilus SAFR-032]
          Length = 774

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 181/593 (30%), Positives = 284/593 (47%), Gaps = 29/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
           +S  RW          +  ++++   I  + A +LV R +   + A+ FL         D
Sbjct: 3   LSKMRWEY--EHPSEEKVKSLSENLNISALTASLLVKRGLEEVEEARSFLFDQKAEFH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L    +A  RI +AI   E I+IFGDYD DG  S ++++  L   S   + YIPDR 
Sbjct: 60  PFLLKGMKEAVERINKAIEEQESIVIFGDYDADGVTSTSVLLHTLKELSAKVDFYIPDRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN         +GA L+ITVD G  + +  + A   G+D+I+ DHH+   E   A
Sbjct: 120 KEGYGPNEQAFRYIKEQGASLVITVDTGIAAVNEARIAKEIGLDLIITDHHEPSEELPEA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A+V+P +         L   GV F V   +   L              LLDL A+ T+ 
Sbjct: 180 LAIVHPKQPGCEYPFKELAGVGVAFKVAHALLGKLP-----------TQLLDLAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGR 310
           D+VPL   NR    KGLM  R+    GLKAL++    +      E +G+ I P +NA GR
Sbjct: 229 DLVPLHDENRWLAKKGLMQLRQSNRLGLKALLKEAGATLEEANEETVGFQIAPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           I +++    LL+++D  E E LA  +  LN+ R+ + S + E+A   V    DD    S 
Sbjct: 289 IEQADPAVHLLMTEDKDEAEELARFVQELNKERQKIVSTITEEAIQMVEETGDDQ---SA 345

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAV 429
           IVV    W+PG+VG++A++L + F RP+  +  +E+ +   GS RSI GFD+   +S   
Sbjct: 346 IVVAKAGWNPGVVGIVASKLTDTFSRPAIVLGIDEETQMAKGSARSIPGFDLFFHLSKC- 404

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L +   ++A+  +      P+ ++D V     + 
Sbjct: 405 -RDILPHFGGHPMAAGMTLRADDVPLLRERLNQYANETLTEEDFIPIQRVDAVCKVDELT 463

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
           +  I+ +    P+G  NP P     + +L+ IR +     H++M+ + +D + L  + F 
Sbjct: 464 VEAIEEMGMLSPFGMQNPKPFIMIEDARLEEIRTIGANQNHIKMSLKDED-KLLDCVGFH 522

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                         G R+ V G + +N W   K+ QL + DA   E   F  +
Sbjct: 523 QGQLK----EEVVTGSRISVIGEMSINEWNNRKKPQLMLKDARVDEWQLFDLR 571


>gi|110640034|ref|YP_680244.1| single-strand DNA specific exonuclease [Cytophaga hutchinsonii ATCC
           33406]
 gi|110282715|gb|ABG60901.1| exonuclease RecJ [Cytophaga hutchinsonii ATCC 33406]
          Length = 574

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 160/577 (27%), Positives = 284/577 (49%), Gaps = 17/577 (2%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            RW++        +A ++ +   I   ++ +LV RN+ + + AK+F  PS+  L  DP +
Sbjct: 6   KRWITKTLPAQ-EKARSLAEALNINAYISAMLVQRNIETFEEAKNFFRPSLSQLH-DPFL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D +KA  R++QAI  +E+I+I+GDYDVDG  SV++   FL +   N   YIPDR  +G
Sbjct: 64  MRDMEKAVTRLMQAIAGNERILIYGDYDVDGTTSVSVFYGFLKNYYTNIEYYIPDRYKEG 123

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG + + +E   +  A LI+++DCG  + + + YA + GID I+ DHH   +E   A A+
Sbjct: 124 YGVSKAGIEYARDTNATLIVSLDCGIRAVEMVAYANSFGIDFIICDHHNPGNELPDAVAI 183

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P + +       L   GV F +L  +            +  L   +DL+A++   D+V
Sbjct: 184 LDPKQNNCSYPYKELSGCGVGFKLLQALCTRAG-----YSSELLFEQIDLLAISICSDIV 238

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           P+ G NR     GL        PG++A+++   +   I    + + IGP INA GRI  +
Sbjct: 239 PITGENRILTYFGLQKLNESPRPGIQAIVDVSGLKKAIDVNTVVFTIGPRINAAGRIDHA 298

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL++++  +    A  ++  N  RR  +  +  +A   + +  +    +S  V+ 
Sbjct: 299 FAAVELLLAENKTDAANFAANINDHNLVRREFDETITGEALGMIQSNANAATASST-VLY 357

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + WH G++G++A+R  E + RP+  ++ + +GK  GS RS+  +D+ + +       +L
Sbjct: 358 KNDWHKGVIGIVASRCIEHYHRPTIILT-QSNGKVAGSARSVPDYDLYEAIDKC--SDLL 414

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           ++ GGH  AAGLT+E  N       F++     +      P+  ID  L  + ++    +
Sbjct: 415 IQFGGHKYAAGLTMEEKNIEAFRTKFEEVVSATIRKEQLIPMISIDLELPLNQIDSRFFN 474

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQS-IRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           ++   GP+G  N  P+F   N       R++   HL++    QDS T  AI ++++    
Sbjct: 475 IVRQMGPFGPQNMQPIFVSRNVMDDGTSRILKDKHLKLNIRQQDSVTYPAIGWQMHAF-- 532

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +      +   +   L  N + G K  QL + D  
Sbjct: 533 --YDRIKNKEPFDICYSLEENEFNGKKTIQLMIRDIQ 567


>gi|302383023|ref|YP_003818846.1| single-stranded-DNA-specific exonuclease RecJ [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193651|gb|ADL01223.1| single-stranded-DNA-specific exonuclease RecJ [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 605

 Score =  431 bits (1108), Expect = e-118,   Method: Composition-based stats.
 Identities = 222/589 (37%), Positives = 321/589 (54%), Gaps = 7/589 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V  S+SG  W     +  + RA    Q   + + +AR L  R V  +   DFL P++
Sbjct: 14  FLDVARSLSGRAWRQRPAEASVIRAH--MQGLGLDEPLARALAARGVKPEQGADFLEPTL 71

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           + L PDP    D D AA  IV AI + E I +F DYDVDGA+S AL++R+      +  +
Sbjct: 72  KALFPDPSSFMDMDLAAEAIVSAIQSGESIHVFADYDVDGASSAALLVRWFRALGRDLPI 131

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           Y+PDR+ +GYGP+P   ++    GA+L+ITVDCG+ + +A+ +A   G+ V+VIDHH ++
Sbjct: 132 YVPDRLTEGYGPSPMAFDRLKASGAELVITVDCGAAANEAIAHACGIGLKVVVIDHHMMR 191

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLD 243
            E     A+VNPNR  D SGQG+L AAGVVF++L  + R  R+          D+   LD
Sbjct: 192 EEPPRCLAVVNPNRPGDTSGQGNLAAAGVVFVLLAALNREARKRGLFVETPEPDIRQWLD 251

Query: 244 LVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE-NLGYMIG 302
           L AL  +CDV  L G NRA    GL V     NPGLKAL+             + G+++G
Sbjct: 252 LAALGAICDVTGLTGFNRALTGLGLRVMSGWRNPGLKALLAVAGAEPGPAKSNHAGFILG 311

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG ++LG+RLL +DD  E   LA +LD LN  RR +E  + E A  +V    
Sbjct: 312 PRINAGGRIGRADLGARLLSTDDPLEARALAEELDALNVARREVEREVTETATRRVEATG 371

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE-DGKGIGSGRSIEGFDI 421
                ++V+VV G+ WHPG+VG++A RL+E++ +P   I  +     G GSGRS  G ++
Sbjct: 372 QHADGSAVVVVSGEDWHPGVVGIVAGRLRERWRKPVIVIGVDAVAHVGKGSGRSQPGMNL 431

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G+ +  A  EG+L+ GGGHAMAAGLT+       L DF                  ++D 
Sbjct: 432 GRAIQSAWREGLLLAGGGHAMAAGLTIRPDGIDALRDFLNATMAGEQADADALDWVEVDA 491

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
           +++  A + AL +  E   P+G  NP P+FA    + +    +N  H++      D  ++
Sbjct: 492 LIDPGAASRALFEGFERLAPFGPANPEPLFALSGVQSREPVQMNGGHVRCRLVGADGASV 551

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +AIA+R    P G  L+  +G  + V G L  + W G K  Q  + D +
Sbjct: 552 KAIAWRCADLPSGRALLAGQGG-LSVVGRLKADDWNGRKGVQFEIEDVA 599


>gi|159044818|ref|YP_001533612.1| single-stranded-DNA-specific exonuclease [Dinoroseobacter shibae
           DFL 12]
 gi|157912578|gb|ABV94011.1| single-stranded-DNA-specific exonuclease [Dinoroseobacter shibae
           DFL 12]
          Length = 585

 Score =  431 bits (1107), Expect = e-118,   Method: Composition-based stats.
 Identities = 247/595 (41%), Positives = 344/595 (57%), Gaps = 11/595 (1%)

Query: 1   MNDQ-AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD 59
           M D  AFLGVE S++G RW+ L   +    A  + Q   +PD V R L  R V+ + A+D
Sbjct: 1   MTDGPAFLGVESSLTGRRWIGLSPDQD-RAAERLVQITGLPDAVCRTLARRGVAPEEAED 59

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FL P++R L+PDP  L D ++AA R+  AI  +E+I IF DYDVDG +S AL++ +L   
Sbjct: 60  FLAPTLRALLPDPRSLRDMERAAARVNAAIARNERIAIFADYDVDGGSSAALLIDWLRAQ 119

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
              A +Y+PDRI +GYGPN   ME   +    LII VDCG+ S+D +  A   G DV+++
Sbjct: 120 GRTATLYVPDRIDEGYGPNIPAMEALAD-AHDLIICVDCGTLSHDPVAAAQ--GTDVVIL 176

Query: 180 DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLL 239
           DHH  +     A+A+VNPNR D+     HLCAA VVFL+LV   R  R   +     DL+
Sbjct: 177 DHHLAEECLPAAHAVVNPNRQDEDGSLSHLCAAAVVFLLLVEANRQQRAAGQ--PGQDLM 234

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           +LLDLVALATV DV PL G+NRA+V +GL V  R+  PGL AL +   +    ++ +LG+
Sbjct: 235 ALLDLVALATVADVAPLSGVNRAFVRQGLTVMGRRERPGLTALSDSAGLDRAPSSYHLGF 294

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIG ++LG+RLL + D  E   LA +L+ LN  RR +E+ +   A  +  
Sbjct: 295 VLGPRINAGGRIGAADLGARLLATRDPHEAAALAERLEKLNAERRDIEAQVRASALEQAE 354

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
           T+      A +    G+ WHPG+VG++A+RLKE   RP+  I   E  +G GSGRS+ G 
Sbjct: 355 TRGL---NAPLAWAAGEGWHPGVVGIVASRLKETANRPAIVIGL-EGDEGKGSGRSVPGI 410

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G  +     EG+L+KGGGH MAAGLTV R           +         +      +
Sbjct: 411 DLGAAIQRLAHEGLLLKGGGHKMAAGLTVRRDLLEPAMARLSELLAAQGADRLGPKGLHV 470

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DGVL+  A+   LI  +E AGP+GA  P P FA P+  ++  + V  +HL+ +F      
Sbjct: 471 DGVLSPRAITTELITRIEDAGPFGASAPAPRFALPSVTIRYAKPVGESHLRFSFAGPCGT 530

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
            +  IAF  + TP+G  L QS     H+ G L +N W G  + QLR+ DA+  E 
Sbjct: 531 RMDGIAFGAFDTPIGPALSQSARGTFHLAGRLEINSWGGQHKAQLRLDDAAAAEA 585


>gi|67459155|ref|YP_246779.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia felis
           URRWXCal2]
 gi|67004688|gb|AAY61614.1| Single-stranded-DNA-specific exonuclease RecJ [Rickettsia felis
           URRWXCal2]
          Length = 587

 Score =  430 bits (1106), Expect = e-118,   Method: Composition-based stats.
 Identities = 222/587 (37%), Positives = 329/587 (56%), Gaps = 14/587 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           + SI+G  W   L  E I     + +   I D++AR++  R  +++  ++FL P I+ L+
Sbjct: 4   QASINGKIWQQKLINEDI--VTELCRSFKISDLLARIVSLRVNNLEEVENFLIPKIKNLL 61

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D  KA  R V+AI N++KI IF DYDVDGA S AL+       ++  ++Y+PD
Sbjct: 62  PDPFHLLDMKKAVDRTVKAILNNQKICIFADYDVDGATSAALLKNVFRDLNILCDIYVPD 121

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           RI +GYGP P  M+K  + G +L+ITVDCG+ +++AL+YA +  +DVIVIDHH       
Sbjct: 122 RIAEGYGPTPFAMQKIKDNGTELLITVDCGAMAHEALKYAKDLNLDVIVIDHHIATEILP 181

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL---NFDLLSLLDLVA 246
            A A+VNPNR+D+ S   HL A GV FL    I   L++ N         +L+  LDLVA
Sbjct: 182 DAVAIVNPNRIDEKSECKHLAAVGVAFLFATAILSNLKKQNYFTQTMLQPNLMKYLDLVA 241

Query: 247 LATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSIN 306
           L TVCD++ L GLNRA+V  GL V +++ N G+K L +   ++      +LG+++GP IN
Sbjct: 242 LGTVCDMMKLTGLNRAFVASGLKVMQQRQNIGIKTLYDMAELNEIPKCYHLGFILGPRIN 301

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           AGGR+G+S+LG+ LL +  S E   LA +L+  N  R+++E  M+E+A    LTQ    Q
Sbjct: 302 AGGRVGKSSLGANLLSTSCSNEASKLAEELEKHNNERKVIELLMIEEATEIALTQ----Q 357

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
            +S++ +  + WHPG++G++A RLKEKF +P   ++  + G G  S RSI G D G  + 
Sbjct: 358 DSSLLFIVKEGWHPGVIGIVAGRLKEKFDKPVAVVALND-GIGKASCRSILGIDFGAEII 416

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
            A  + +L+ GGGHAMAAG TV       L +FF       +  L      + D  L  +
Sbjct: 417 NAKSKDLLIAGGGHAMAAGFTVTAEKLQELQNFFNNAFRISINKLENYKHAEYDIDLTVN 476

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQ 542
            VN  L+  L +  P+G GN  P+F F +  +    +V   H++           ++ L 
Sbjct: 477 GVNFPLMKELNTLEPFGQGNHEPIFKFDDLFVLKADIVGSKHIKCMLAPNKRGFGNKALS 536

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AIAF   GT   E L+  + K +   G L  N W+ +   QL + D 
Sbjct: 537 AIAFNSVGTSFEEVLLSPKAKNIAAIGTLKTNNWQDNYTIQLIIRDI 583


>gi|239827849|ref|YP_002950473.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           WCH70]
 gi|239808142|gb|ACS25207.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           WCH70]
          Length = 785

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 180/589 (30%), Positives = 299/589 (50%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E I     + ++  +  ++A++LV+R V +++ A  FL P ++    DP +L
Sbjct: 7   RWDVKRPDENI--VTHLVEQSHMDPLIAKLLVHRGVRTVEEANAFLYP-LKQPFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              ++A  RI +AI + E I+++GDYD DG +S  +M+  L       + YIP+R  +GY
Sbjct: 64  DGMERAIERIQRAIQHGEHILVYGDYDADGVSSTTVMVSALKEAGAIVDFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN +       +G  LIITVD G  +   +  A   G+DVI+ DHH+V      AY ++
Sbjct: 124 GPNENAFRWAKEQGFSLIITVDNGIAAVKEVALANELGMDVIITDHHEVGPALPEAYEII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P +         L   GV F V   +           L       LD+VA+ T+ D+V 
Sbjct: 184 HPKKPGSTYPFRELAGVGVAFKVAHAL-----------LGDVPRHFLDVVAIGTIADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R     GL+AL ++  I    I  + +G++I P +NA GR+GE+
Sbjct: 233 LTGENRLLVAQGLEQLRNTKRIGLRALCKQCGIEAKEINEQTVGFVIAPRMNAVGRLGEA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
               RLL+++  +E + LA ++D LN+ R+ + + + E+A   V  Q    +   V+V+ 
Sbjct: 293 TPAVRLLMTEKEEEAQRLAKEMDDLNRERQQLVAKIAEEAAQIVNEQFPPSENK-VLVIA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A+RL E+F RP+  +S + E G   GS RSI GFD+    S +    I
Sbjct: 352 KEGWNPGVIGIVASRLVEQFYRPTIVLSIDSEKGIAKGSARSIHGFDM--FSSLSTCRDI 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L       A +++ A   TP+  ID V + S + +++ 
Sbjct: 410 LPHFGGHPMAAGMTLSVDHIDELRQRLNALADDMLTADDFTPITPIDAVCSVSDLTLSVA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + LE   P+G  N  P+F   N  +++IR +    +HL+  F +Q+   + ++ F     
Sbjct: 470 EQLEKFAPFGVDNAKPLFLMENVSVETIRRIGADQSHLKAVF-AQNGAAIDSVGFGFGYL 528

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   +   ++ V G L VN W   ++ QL + D +  E   +  +
Sbjct: 529 ----CDEIAPDAKVSVVGELMVNEWNNLRKPQLMICDVAVHECQLYDIR 573


>gi|58039949|ref|YP_191913.1| single-stranded-DNA-specific exonuclease RecJ [Gluconobacter
           oxydans 621H]
 gi|58002363|gb|AAW61257.1| Single-stranded-DNA-specific exonuclease RecJ [Gluconobacter
           oxydans 621H]
          Length = 599

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 222/600 (37%), Positives = 326/600 (54%), Gaps = 14/600 (2%)

Query: 2   NDQAFLGVECSISGFRWVSLLG---QEGINRALAITQKHAIPDIVARVLVNRNVSIDYAK 58
           +  A LGV  S    RW+       +     ALA+ Q+  IP+++AR+L  R V+   A 
Sbjct: 5   DTGAVLGVTRSAGHRRWIWRDPRLAEADNRLALALAQQAGIPELLARILSARGVAPPDAS 64

Query: 59  DFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSH 118
            FLNP +R  MPDP  L D D+AA R+ QA+ N E + +FGDYDVDGA   AL+   L  
Sbjct: 65  SFLNPRLRDAMPDPSCLQDMDRAAERLAQAVRNREHVGLFGDYDVDGACGTALVCDTLRE 124

Query: 119 CSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIV 178
                + +IPDR+ +GYGPN + +E  +++GA L++ +DCG+ + D L   T++  D+IV
Sbjct: 125 LGCTVSTHIPDRLTEGYGPNTAALENLLSQGATLLVCIDCGTAAIDILNGLTDR-ADIIV 183

Query: 179 IDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--- 235
           +DHH+     +P   +VNPNRLD  SG G +CA  V FL +V   R LR+ N    +   
Sbjct: 184 LDHHKPDGAALPKGIVVNPNRLDCTSGLGSICATAVAFLTMVATIRHLRRCNWFDEDQVI 243

Query: 236 FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAE 295
            DLL  LDL ALAT+CDV+PL GLNRA V++GL V  R    GL  L     +    +A 
Sbjct: 244 PDLLKRLDLTALATICDVMPLTGLNRALVMQGLRVMSRGERLGLATLSSVAGVKEEASAM 303

Query: 296 NLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAE 355
             G+ +GP INAGGRI +++LG +LL+SDD  E   LA +LD +N+ R+ +ES +L+ A 
Sbjct: 304 ACGFALGPRINAGGRIAQADLGLKLLLSDDVVEARALAEQLDRVNRQRQTVESTILDSAM 363

Query: 356 AKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRS 415
            +   Q       +VI + G+ WHPG+VG++A RLKE++ RP+   +  + G   GS RS
Sbjct: 364 EQAQQQL--DAGHAVIFLHGETWHPGVVGIVAGRLKERYNRPALVAALTD-GVIKGSARS 420

Query: 416 IEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTP 475
           + G D+G  +  A + G+L+ GGGHAMAAG ++          +        +  L    
Sbjct: 421 VPGLDLGTAIIAARQNGLLLSGGGHAMAAGFSLSADRADEFHSWLDSQLSGALT-LPKQD 479

Query: 476 VFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL--AHLQMTF 533
             K+DG++  +  ++A+ D L    P+G GN  PV A  N +      +      L++  
Sbjct: 480 ALKLDGIMTLAGASVAVADQLARLEPFGPGNEEPVLAISNVRCVKSERIGKDGNTLRVIL 539

Query: 534 ESQDSET-LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           + +D  T L+ + FR    P    L       +HV G L    W+  K     + DA+P 
Sbjct: 540 QGEDGGTRLRGLVFRAADKPFAALLEDRSMPLVHVAGTLRAETWQERKNLSFFISDAAPA 599


>gi|146298353|ref|YP_001192944.1| single-stranded-DNA-specific exonuclease RecJ [Flavobacterium
           johnsoniae UW101]
 gi|146152771|gb|ABQ03625.1| single-stranded-DNA-specific exonuclease RecJ [Flavobacterium
           johnsoniae UW101]
          Length = 568

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 177/580 (30%), Positives = 288/580 (49%), Gaps = 24/580 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW     +   ++   + Q   + D VA +L+ R + + + AK+F  PS+  L  DP ++
Sbjct: 2   RWTLKP-KPSEDKIKHLAQALNVEDFVATLLIQRGIETFEDAKNFFRPSLEHLH-DPYLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA  RI +AI N E IM+FGDYDVDG  +V+L+  +L     +   YIPDR  +GY
Sbjct: 60  KDMDKAVARIERAIENQENIMVFGDYDVDGTTAVSLVSSYLKSHYPHIATYIPDRYDEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   + G  LII +DCG  S D + YA  + ID IV DHH+       A A++
Sbjct: 120 GISYKGIDYADDNGISLIIALDCGIKSIDHIAYAKAKNIDFIVCDHHRPGEILPDAVAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  + +     N+     DL+  LDLVA A   D+VP
Sbjct: 180 DPKREDCSYPYDELCGCGVGFKLIQALGQ-----NRNETIEDLVPYLDLVATAIAADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V   +  PG+KAL+ +      +   ++ ++I P INA GRI   N
Sbjct: 235 ITGENRVLAYFGLKVINSEPRPGIKALVHQAK-KKVLDITDVVFIISPRINAAGRIKHGN 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   D ++ +  A +++  N +R+ ++  + ++A  ++L    + ++    VV  
Sbjct: 294 HAVELLTEFDLEQAQQFASEIEQYNADRKDLDKKITKEAFQQILQN--NEEERFSTVVFQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   D K   S RS++GFD+   +    E   L 
Sbjct: 352 EDWHKGVIGIVASRLIETYYRPTLVFTKSGD-KYAASARSVKGFDVYNALDACSEH--LE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAG+T++  N+    D F+K     +   + TP  +ID  ++ S +   LI +
Sbjct: 409 QFGGHMYAAGMTLKAENYQLFKDAFEKCVQETIQPEMRTPEIEIDAEIDFSDITPKLIRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQ-SIRVVN--LAHLQMTFESQDSE-TLQAIAFRVYGT 551
           L+   P+G  N  PVF   + K     + +     HL++  +       + AI F     
Sbjct: 469 LKQFEPFGPQNMTPVFMTKDIKDTGYAKTLGAEEEHLRLFVKQSLGTDGIAAIGFG---- 524

Query: 552 PLGEFLMQSRGK-RMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            LG+ L  ++ +    +   +  N W G+   QL + D  
Sbjct: 525 -LGKKLNIAQNQNPFQLAYTIAENEWNGNISTQLMLKDIR 563


>gi|327439551|dbj|BAK15916.1| single-stranded DNA-specific exonuclease [Solibacillus silvestris
           StLB046]
          Length = 773

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 180/592 (30%), Positives = 286/592 (48%), Gaps = 27/592 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDP 72
           S   W     ++        +++  I  I A++L+ R  + I+ AK  L         DP
Sbjct: 4   SQKVWTI--TKQDEQLVKQFSEQLNISTIAAKILIARGCTLIEEAKPLLKID-ETQYHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++   + A  RI QA+ N EKI+++GDYD DG  S  +++  L     + +  IPDR +
Sbjct: 61  YLMAGMEDAVMRIEQALDNGEKILVYGDYDADGITSTTVLLNALLDLGADVSFVIPDRFI 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
            GYGPN  L +K   +G  LIITVD G +  + ++ A   G+DVI+ DHH+  +    A 
Sbjct: 121 HGYGPNEELFKKAYEDGVNLIITVDNGISGIEQVKMARELGMDVIITDHHEAGNILPDAN 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
            +++P   +     G L   GV F +   +Y  L              L + VA+ T+ D
Sbjct: 181 VIIHPRVPEGHYPFGELAGVGVAFKLAHALYGELPD-----------HLFEYVAVGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRI 311
           +VPL+G NR  V +GL   ++  NP +KA+ +        I  E +G+  GP +NA GR+
Sbjct: 230 LVPLVGENRYLVQRGLQALKQSPNPWVKAICDASGANKKDINEETVGFYFGPRLNAIGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
           G +  G   L+S+D  +   LA +L+  N  R+ +   +  +A A +  +   ++ + V+
Sbjct: 290 GSAEPGVHFLMSEDPLQANTLATQLNDKNTERKKIVEDITNEAMAMI-EEDASLKDSLVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           VV G+ W+PG+VG++A+RL EK+ RP+  +S   E G   GS RSIEGF +      A  
Sbjct: 349 VVAGEGWNPGVVGIVASRLVEKYYRPTIILSLNLEKGIAKGSARSIEGFHL--FNELAKN 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T+   +   L     + A   +         +ID  +  S + +
Sbjct: 407 RDILPHFGGHPMAAGMTLPIEHVASLRTRLNEQAKLCLTEEQLVQNMQIDVPIELSEITV 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRV 548
             I+ L    P+G   P PVF   + K++S+R +     HL+M  E     TL AI F  
Sbjct: 467 EAIEELRQLAPFGTEFPKPVFGIQDVKVKSMRKIGSGENHLKMELEDPY-RTLDAIGFNK 525

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                      S G  + + G L +N W+G+K+ Q  + D S  E   +  +
Sbjct: 526 GFLH----DEISYGVALSLVGDLQINEWQGNKKPQFMIQDVSVNEWQLYDYR 573


>gi|124009844|ref|ZP_01694512.1| single-stranded-DNA-specific exonuclease RecJ [Microscilla marina
           ATCC 23134]
 gi|123984165|gb|EAY24526.1| single-stranded-DNA-specific exonuclease RecJ [Microscilla marina
           ATCC 23134]
          Length = 569

 Score =  429 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 166/579 (28%), Positives = 286/579 (49%), Gaps = 19/579 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            RW+             +     I + +A +LV R++ + D AKDF  PS++  + DP +
Sbjct: 3   KRWIFKET-PDPQLVNQLASSLEISESMATLLVQRDIKTFDAAKDFFRPSLKNHLHDPFL 61

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D +KA  R+ +AI + EK+MI+GDYDVDG  SVAL+  FL +     + YIPDR ++G
Sbjct: 62  MQDMEKAVIRLEKAIEHKEKMMIYGDYDVDGTTSVALVYGFLQNYHSLLDYYIPDRYLEG 121

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++    +G  L+I +DCG  S + + YA  QG+D I+ DHH    E   A+A+
Sbjct: 122 YGISKISIDWAKEQGITLVIALDCGIKSVELMDYANEQGVDYIICDHHMPGQEIPRAHAV 181

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R D       L   GV F ++         D        L   LDL+ ++  CD+V
Sbjct: 182 LDPKRKDCAYPFKELSGCGVGFKLMQAYCLRNNID-----LEKLYPFLDLLVISIACDIV 236

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI--SSPITAENLGYMIGPSINAGGRIG 312
           P+IG NR     GL    +    G+KALI+       + +   N+ + +GP INA GRI 
Sbjct: 237 PIIGENRVMAFYGLRQLNQTQRTGIKALIDVAKFSDDTVLDISNVVFGLGPRINAAGRIQ 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            +     LL+S++ +E + +A  ++  N  RR ++S++ E+A + +  + + ++++   V
Sbjct: 297 HAKKAVMLLVSNNKKEADYVAELINKDNLQRRDLDSSITEEALSMI--EQNRLEKSKTTV 354

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WH G++G++A+R  E + RP+  ++    GK  GS RS+ GFD+ + +       
Sbjct: 355 LFKENWHKGVIGIVASRCIETYHRPTVILTQHN-GKATGSARSVPGFDLYEAIDAC--AD 411

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L + GGH  AAGLT+           F+      +     TP+ +ID  +    +    
Sbjct: 412 LLEQFGGHTHAAGLTLTLDKIEPFRQKFENIVAKQIDEEQLTPLIEIDAKIELKDITGKF 471

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET-LQAIAFRVYGT 551
             +L+   P+G  N  PVF   +      +++   H++     + S+    AI F +   
Sbjct: 472 YRILQQFAPFGPANMRPVFVSEHLYADYPKLLKEKHVKFRTRQEGSDAFFDAIGFGMPE- 530

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
               +   + G+R  +  ++  N +RG    QL++ D  
Sbjct: 531 ---HYERIASGERFALCYNIDENRYRGQTSLQLKIKDIK 566


>gi|298291363|ref|YP_003693302.1| single-stranded-DNA-specific exonuclease RecJ [Starkeya novella DSM
           506]
 gi|296927874|gb|ADH88683.1| single-stranded-DNA-specific exonuclease RecJ [Starkeya novella DSM
           506]
          Length = 606

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 271/591 (45%), Positives = 367/591 (62%), Gaps = 4/591 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            +AFLGV  S +G  W   L   G    LAI Q+  +P+I+ARVL  R V ID  + +L+
Sbjct: 12  PRAFLGVARSATGRFWRERLDLRGAQATLAIVQRTGVPEILARVLAGRGVGIDEVEAWLD 71

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P+++ L+PDP  LTD      R+  A+   EK+ +FGDYDVDGA S AL++  L    ++
Sbjct: 72  PTVKRLLPDPDTLTDMGPCVARLADAVTTGEKVAVFGDYDVDGATSTALLVEVLRAGGLD 131

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
              YIPDRI +GYGPN   +E     GA L++ VDCG+ S++    A   G+DV+VIDHH
Sbjct: 132 PAFYIPDRIFEGYGPNIPAIEGLAAGGASLLVPVDCGTMSFEPFARARELGLDVVVIDHH 191

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV---PLNFDLL 239
           Q         ALVNPNR+DDLSG GHLCA G+VF+V V + R L Q           +LL
Sbjct: 192 QAGETLPEVAALVNPNRVDDLSGLGHLCAVGLVFVVAVGLLRELEQRGWWNAARPKPNLL 251

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           + LDLVAL TV DVVPL+GLNRAYV KGL+  R++  PGL AL++   +S P  A +LG+
Sbjct: 252 ADLDLVALGTVADVVPLLGLNRAYVTKGLLQLRKRERPGLTALMDAARLSGPPKAWHLGF 311

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           ++GP INAGGRIG++ LG+RLL++ D  E   +A +LD LN  R+ +E A++ QAEA+  
Sbjct: 312 LLGPRINAGGRIGDAALGTRLLLTRDPIEAAAIAAELDRLNAERQQVERAIVAQAEAEAE 371

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
                  + +VI+  G  WHPG+VGL+AARLKEKFGRP+FAI+F  +    GS RSI G 
Sbjct: 372 AALGRAGEGAVILSSGQGWHPGVVGLVAARLKEKFGRPAFAIAFTGESG-AGSARSIPGV 430

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G+ V  AVE GILVKGGGHAMAAGLTV R   G L    ++     V          I
Sbjct: 431 DVGRAVRAAVELGILVKGGGHAMAAGLTVAREKLGELRAHLEEVLAVSVEEARAVDETVI 490

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG L+A+     L++++E AGP+GAGNP P+FAFP H++      N   +++     D  
Sbjct: 491 DGALSAAGATPDLVELIEKAGPFGAGNPQPIFAFPAHRIVYAEPGNSDQVRVRLRGSDGT 550

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            L  +AFR   TPLG+ L+ +RG++ HV G L ++ W+G  +  LR+ D +
Sbjct: 551 VLSGVAFRAANTPLGQALIAARGQQAHVAGMLELDSWQGRTQVNLRICDVA 601


>gi|260061414|ref|YP_003194494.1| putative single-stranded-DNA-specific exonuclease [Robiginitalea
           biformata HTCC2501]
 gi|88785546|gb|EAR16715.1| putative single-stranded-DNA-specific exonuclease [Robiginitalea
           biformata HTCC2501]
          Length = 571

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 179/578 (30%), Positives = 284/578 (49%), Gaps = 21/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RWV    + G   A  +  +  I  ++A +LV R +   + A+ F  P +  L  DP+ +
Sbjct: 6   RWVFKP-EPGREAASRLAGELGIDPLLAGLLVQRGIRDFESARRFFRPELSHLH-DPMQM 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D ++A  R+  A+   E+I+++GDYDVDG  SVALM  +L   S     YIPDR  +GY
Sbjct: 64  QDMEQAVDRLEVALTRGERILVYGDYDVDGTTSVALMAAYLREYSDAVATYIPDRYREGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   +E   + G  LI+ +DCG  + +  +YA ++GID+I+ DHH+       A A++
Sbjct: 124 GLSRQGIEFADDNGMGLIVALDCGVKAIEQARYARSKGIDLIICDHHRPGETLPEAVAVL 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  ++     D       +LL  LDLVA A   D+VP
Sbjct: 184 DPKRDDCPYPYKELCGCGVGFKLIQALHERRGLD-----PAELLPYLDLVATAIGADIVP 238

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR  V  GL V      PG++AL+  ++  +     +L + + P INA GR+    
Sbjct: 239 ITGENRVMVHYGLQVINGGARPGIRALLRGLDRKNY-QVSDLVFRVAPRINAAGRMQHGE 297

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
              RLL   D      LA +++ LN  RR  E A+ ++A   V ++  + + ++V  V  
Sbjct: 298 DAVRLLTETDPARAGALADEIESLNSQRRETEQAITDEALEMVRSEGGEARMSTV--VFK 355

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   D K   S RS+ GFD+ + +        + 
Sbjct: 356 EDWHKGVIGIVASRLIETYYRPTLVFTRSGD-KLAASARSVRGFDLYEALEAC--SDCIE 412

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+E   F    D F+K     +     TP  +ID  ++ S ++  L+ +
Sbjct: 413 QFGGHTYAAGLTLEASRFQDFKDRFEKVVSERITEDSLTPEIQIDLKIHLSQIHPKLVRI 472

Query: 496 LESAGPYGAGNPNPVF-AFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTP 552
           L   GP+G GNP PVF A P       R V     HL++      S  +  I F +    
Sbjct: 473 LSQFGPFGPGNPAPVFVAGPLVDTGYARTVGEGGAHLKLAVTQDGSGPIGGIGFGLGDR- 531

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                +   G+  +    +  N+W+G    QL++ D  
Sbjct: 532 ---LDLIQGGREFYAVFSIEENHWQGRTSTQLKIRDIR 566


>gi|77919486|ref|YP_357301.1| single-stranded-DNA-specific exonuclease RecJ [Pelobacter
           carbinolicus DSM 2380]
 gi|77545569|gb|ABA89131.1| exonuclease RecJ [Pelobacter carbinolicus DSM 2380]
          Length = 574

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 194/578 (33%), Positives = 286/578 (49%), Gaps = 18/578 (3%)

Query: 18  WVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLILT 76
           W+     E ++   A+ Q   +  + +  L+ R + S+D  + FL   +   MPDP ++ 
Sbjct: 9   WLERDVSEQLDAV-ALQQCLGLSRLASEALLRRGLGSLDEVQAFLQAKLSS-MPDPCLMA 66

Query: 77  DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYG 136
           D DKA  R+ QA+ N EKI + GDYDVDG +  AL++  L       + +IP R+ DGYG
Sbjct: 67  DMDKAVERLAQAVCNREKIAVHGDYDVDGISGTALLVETLRAFGARVSYHIPLRLKDGYG 126

Query: 137 PNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVN 196
            + + +E     GA L +TVDCG +++     A   G+D+I+ DHHQV      A A+VN
Sbjct: 127 VSAAALEDCATHGATLAVTVDCGVSAHAQAMRAAELGLDLIITDHHQVPETLPAALAIVN 186

Query: 197 PNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFDLLSLLDLVALATVCDVV 254
           P+R D      +L   GV FL+LV + + LR           DL   LDLVAL T+ D+V
Sbjct: 187 PSRPDCGYPFKNLAGVGVAFLLLVALRKHLRDLGHWKTVCEPDLRYGLDLVALGTIADIV 246

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           PL GLNRA    GL +    G  GL+AL +   +        +G+ + P INA GR+ + 
Sbjct: 247 PLKGLNRALTKAGLELLSHSGRAGLQALKKVAGVDKVTCGS-IGFRLAPRINAAGRLEDG 305

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            +G  LL+ +  Q+    A  LD +N +R+ +E   LEQA+ +   +         IV+ 
Sbjct: 306 AVGVELLLQESVQDAMATAEMLDRVNSDRQAIEQQTLEQADERWRQRSSGA--THSIVLA 363

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            +RWHPG++G++A+RL EK+ RP+  I+  E G G GSGRSI+G  + + +S       L
Sbjct: 364 DERWHPGVIGIVASRLVEKYHRPTILIALNE-GVGKGSGRSIKGLHLYQALSDCQAF--L 420

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
              GGH  AAGLT++          F+K A   +           DG ++   +++  ID
Sbjct: 421 QGFGGHEYAAGLTIDAGRVEAFARDFEKLARQTLSPEDLRFRQFHDGEVSLEEIDLDSID 480

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLG 554
            L    P+G GNP PV+      LQS++ V   HL+     Q    L  IAF +      
Sbjct: 481 ELSRLAPFGPGNPQPVYLARGVHLQSVQRVGDKHLRF-IACQGGHGLPCIAFGMAERQAQ 539

Query: 555 EFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
               Q       +      N WR     QL+V D  PV
Sbjct: 540 LAGPQ------DILFTPQRNEWRERVSVQLQVRDIRPV 571


>gi|284036115|ref|YP_003386045.1| single-stranded-DNA-specific exonuclease RecJ [Spirosoma linguale
           DSM 74]
 gi|283815408|gb|ADB37246.1| single-stranded-DNA-specific exonuclease RecJ [Spirosoma linguale
           DSM 74]
          Length = 584

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 176/589 (29%), Positives = 276/589 (46%), Gaps = 27/589 (4%)

Query: 16  FRWVSLLGQEGINR---ALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
            RW++    +   +      +T    +   +A +LV R V + + A+ F  P I  L  +
Sbjct: 10  KRWITKPLPDSAEQRSAIETLTSSLGVSPFLAALLVQRGVQTYEEARTFFRPEINHLH-N 68

Query: 72  PLILTDCDKAARRIVQAI--YNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           P  + D DKA  R+  A+     EKI+I+GDYDVDG  SVAL+  FL       + YIPD
Sbjct: 69  PFEMKDMDKAIMRLQMAMLPERQEKILIYGDYDVDGTTSVALVYGFLKSYHPAIDYYIPD 128

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R  +GYG +   ++     G  LII +DCG  S D +  A   G+D I+ DHH+   +  
Sbjct: 129 RYKEGYGISKQGIQWAAENGFSLIIALDCGIKSIDRVAEAKALGVDFIICDHHRPGDQIP 188

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALAT 249
            A A+++P R D       L   GV F +L         D       +L   LDLVA++ 
Sbjct: 189 DAAAVLDPKRDDCAYPYKELSGCGVGFKLLQAFCLHKGID-----LNELYPSLDLVAVSI 243

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGG 309
             D+VPL G NR     GL         GLKALI+    S  +   NL + +GP INA G
Sbjct: 244 ASDIVPLTGENRVLAHYGLKHLNASPRTGLKALIKIAGFSRELDITNLVFGLGPRINAAG 303

Query: 310 RIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQAS 369
           RI  +    +LL+++  +E +  AM ++  N +RR  +S+M EQA   +      +Q  S
Sbjct: 304 RIQHAKAAVQLLLAESEEEADEFAMAINKHNNSRREFDSSMTEQALEMIRGNESLLQAKS 363

Query: 370 VIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV 429
             V+    WH G++G++A+R  E F RP+  ++ + + K  GS RS+ GFD+ + +    
Sbjct: 364 T-VLFDASWHKGVIGIVASRCIEHFHRPTIILT-QSNDKAAGSARSVPGFDVYEAIEEC- 420

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              +L + GGH  AAG+T+   N       F++   + +     TP+  ID  L+ S ++
Sbjct: 421 -ADLLEQFGGHTFAAGMTMSVDNIDAFRKKFEEVVASRIKEEHLTPLIDIDLPLDFSEIS 479

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVNLAHLQMTFESQD------SETLQ 542
             L  ++   GP+G  N  P F   +   +    ++   HL++     D       +T  
Sbjct: 480 DKLYRIVRQMGPFGPHNLQPTFMTEDVYLVSEPIIMKEKHLKINVRQGDTTARRSGQTFT 539

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           AI F +         + S GK   +   +  N++ G+   QL + D   
Sbjct: 540 AIGFGMAHI----ADLLSPGKPFSICYQVDQNHFNGNVSLQLMLKDIKV 584


>gi|189500724|ref|YP_001960194.1| single-stranded-DNA-specific exonuclease RecJ [Chlorobium
           phaeobacteroides BS1]
 gi|189496165|gb|ACE04713.1| single-stranded-DNA-specific exonuclease RecJ [Chlorobium
           phaeobacteroides BS1]
          Length = 568

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 171/578 (29%), Positives = 277/578 (47%), Gaps = 19/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +RW  L   E    A A++++  +   +AR L NR ++  + AK+F  PS+  L P P +
Sbjct: 4   YRWNILATDE--TAAAALSREINVSMPLARALSNRGIAGFEEAKEFFRPSLEQL-PSPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
             D  KA  R+  A+   EKI+I+GDYDVDG A  AL+  FL     +   YI DR  +G
Sbjct: 61  FRDMQKAVARVRTAVAEKEKILIYGDYDVDGTAGTALLCLFLQSLGADVFYYINDRFSEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG + S +     +   L+ITVDCG ++   ++    +GIDVIV DHH+      PA+A+
Sbjct: 121 YGLSESGVSHACEQKTSLVITVDCGISAGREIEQLRKEGIDVIVCDHHEPGEL-PPAFAI 179

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP           LC  GV   ++  +   L               LD+VA+AT  D+V
Sbjct: 180 LNPKVPGCGYPFRELCGCGVALKLVHALSESLG-----SAEEAWQQYLDIVAVATSADMV 234

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGE 313
           PL   NR Y+ KG+ + ++    G++ ++  ++I    +   ++ + I P INA GR+  
Sbjct: 235 PLEKENRVYMHKGMDLLQKSPRAGIQEMLTLMDIEPKALGTGHIAFGIAPRINAAGRMQT 294

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +      LI+    E ++ A +LD LN+ RR ++S M + A+A V          S IV+
Sbjct: 295 ARTAVEWLIAGSRDEAKVHAEELDRLNRERREIDSGMFKSADAMVDGYFASY--CSSIVL 352

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL +++  P+  +   + G   GS RS++G +I +++        
Sbjct: 353 YNEAWHLGVLGIVASRLLDQYYLPTVIMGGSD-GLVKGSVRSVQGLNIYEVLQQCERF-- 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAG+T++  N       F       +         +ID  L    V    +
Sbjct: 410 LENFGGHDAAAGITLKPENIAGFRRKFDTICSEKLTMEHRQKELQIDSSLLPGEVTGRFL 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQS-IRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
           D+L   GP+G GN  P+F   N +L    R++   H++   +      L  IAF      
Sbjct: 470 DVLRQFGPFGQGNREPLFFSANMRLSGLPRLLKGKHVKFAVKDVSGRILDVIAFGRED-- 527

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +   L +   +   +   L  N W G K  QL++ D +
Sbjct: 528 IYRELERGSRRMFSMVYALDENEWNGRKSMQLKLKDMA 565


>gi|322419800|ref|YP_004199023.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter sp. M18]
 gi|320126187|gb|ADW13747.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter sp. M18]
          Length = 572

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 180/581 (30%), Positives = 281/581 (48%), Gaps = 20/581 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPD 71
           I+   W +          LA   +  +P ++AR+L NR VS    A+ +LNP +  L  D
Sbjct: 4   ITHRCWQARSADADTVAGLA---RCGVPPLLARLLANRGVSGPADAEAYLNPVLSGLH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P++L     A  R+++A+   E++ + GDYDVDG  S AL++ F     ++   YIP R+
Sbjct: 60  PMLLKGMAPAVDRLLKALSQGERVCVHGDYDVDGVTSCALLIGFFRKIGLDCFHYIPKRL 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYG +   +      GA +++TVDCG T+    +     GID+IV DHH    E   A
Sbjct: 120 TEGYGLSEQGVTAAARGGAGVLVTVDCGITAVAEARLCQEAGIDLIVTDHHTPADELPDA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPL--NFDLLSLLDLVALAT 249
            A++NP +         L   GV F +++ +   LR D         DL   LDLVAL T
Sbjct: 180 LAIINPLQPSCPFPFKALAGVGVAFHLVIALRARLRADGHFARGGEPDLKEYLDLVALGT 239

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGG 309
           + DVVPL+G+NR  V  GL        PG++AL +   IS  +    +G+ + P INA G
Sbjct: 240 IADVVPLLGVNRVLVSCGLKQLSAGCRPGVEALKQVAGISGEVGCGAVGFRLAPRINAAG 299

Query: 310 RIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQAS 369
           R+ ++ +G  LL+  D      +A +LD  N  R+ +E A  E+A + +  +        
Sbjct: 300 RLEDAAVGLELLLCKDPVRARDIATELDEANAERQSLERATFEEARSML--EQGACSGRK 357

Query: 370 VIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV 429
            IV+  + WHPG++G++A+R+ E F RP    +  E G G GSGRSI  F +   +    
Sbjct: 358 SIVLGSELWHPGVIGIVASRIVELFHRPVILFA-FEGGTGRGSGRSISRFHLLDAIKGC- 415

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
               L++ GGH+ AAGL++ R    R    F++ A   + A    P    D  L    ++
Sbjct: 416 -ADHLLRFGGHSHAAGLSIARDELERFALRFEEAAQQTLDAEALVPTLAYDLELAPCDID 474

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVY 549
             L+  +E   P+G GNP P+F      ++  RV+   H+++    Q   +  AIAF + 
Sbjct: 475 QDLVQEIERMKPFGMGNPEPLFVLKGAVVEESRVLKGGHVKLRV-GQGGISFDAIAFGLA 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              + +        R+ +     +N W G    QL V D  
Sbjct: 534 EKGIPK-------GRVDLLFSPGINVWNGRSSLQLTVKDLR 567


>gi|163794637|ref|ZP_02188607.1| Single-stranded DNA-specific exonuclease [alpha proteobacterium
           BAL199]
 gi|159179910|gb|EDP64435.1| Single-stranded DNA-specific exonuclease [alpha proteobacterium
           BAL199]
          Length = 592

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 243/597 (40%), Positives = 342/597 (57%), Gaps = 9/597 (1%)

Query: 2   NDQAFLGVECSISGFRWVSL--LGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKD 59
                LGVE S++G RW++    G E     LAI Q+H +P+IV R++  R + +D  + 
Sbjct: 1   MTTPILGVERSVTGKRWIARGGAGVEIERLGLAIAQRHGVPEIVGRLIAQRGIELDGVER 60

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FL P+++  +PDP +L D D AA R+  A+   + I +F DYDVDGA S ALM R+L   
Sbjct: 61  FLEPTLKAELPDPSVLKDMDAAAGRLSDAVQGGQPIGLFADYDVDGATSAALMTRYLRAV 120

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
              + +++PDRI +GYGPN   +E    +GA +++ +DCG  + + L  A   GID++V+
Sbjct: 121 GATSLLHVPDRIDEGYGPNLPAIEGLAGQGAGVVVCLDCGILAVETLGEARAAGIDMMVV 180

Query: 180 DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFD 237
           DHH    E   A A+VNPNRLD+  G G L A GV FLVLV + R LR+          D
Sbjct: 181 DHHLAGPELPSAVAVVNPNRLDEPGGYGQLAACGVTFLVLVALNRELRRRGWFKQRPEPD 240

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
           L  LLDLVAL TVCDVVPL GLNRA+V +G+ V   +GNPGL AL +   +       +L
Sbjct: 241 LRVLLDLVALGTVCDVVPLAGLNRAFVAQGIRVMAGRGNPGLAALGDIAKLDRRPDPYHL 300

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAK 357
           G+++GP INAGGR+G ++LG+RLL +DD+ E   LA +LD  N  RR +E+         
Sbjct: 301 GFVLGPRINAGGRVGRADLGARLLATDDAAEAATLAAELDRYNGERRTIEAE----VLEA 356

Query: 358 VLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIE 417
            + Q +     + +VV G+ WHPG+VG++A+RLK++F RP+  I   EDG G GSGRS+ 
Sbjct: 357 AIAQAEAQADGAALVVVGEGWHPGVVGIVASRLKDRFHRPACVIG-VEDGIGKGSGRSVA 415

Query: 418 GFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVF 477
           G  +G  +  A + G+L+KGGGHAMAAG TV          F  +     +     T   
Sbjct: 416 GVQLGAAIIAAQQAGVLIKGGGHAMAAGFTVAADRVEAFKAFLCERVAAELADGDRTATL 475

Query: 478 KIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQD 537
            +D  L  S     L+  +   GP+G GN  P FAFP  ++    VV   H++ T    D
Sbjct: 476 SVDAALAPSGATGDLVRTVGRIGPFGTGNAEPRFAFPAVRVVGAGVVGENHVRCTLTGSD 535

Query: 538 SETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
              ++AIAFR     LG+ L+++     HV GHL  + +RG  + QL V DA+P  G
Sbjct: 536 GARVKAIAFRALDGDLGQSLLKAGSTPFHVVGHLRADDFRGGDQVQLIVDDAAPATG 592


>gi|163754680|ref|ZP_02161802.1| single-strand DNA specific exonuclease [Kordia algicida OT-1]
 gi|161325621|gb|EDP96948.1| single-strand DNA specific exonuclease [Kordia algicida OT-1]
          Length = 562

 Score =  428 bits (1101), Expect = e-117,   Method: Composition-based stats.
 Identities = 170/578 (29%), Positives = 277/578 (47%), Gaps = 21/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E   +   + +   + +IVA +L+ R + + + AK+F  PSI  +  DP ++
Sbjct: 2   RWTLKPKPE-TAKIQHLQEVLQVDEIVATLLLQRGIETFEEAKNFFRPSIEQIH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  RI +AI N E IM++GDYDVDG  SVAL+  +L         YIPDR  +GY
Sbjct: 60  KDMDVAVARIDKAIENGENIMVYGDYDVDGTTSVALVSSYLKTIYPQIATYIPDRYEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LIIT+DCG  + D + YAT +GID+++ DHH+  +E   A A++
Sbjct: 120 GLSFQGIDYASDNDISLIITLDCGIKAIDKVAYATEKGIDIVICDHHRPGNELPKAVAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  +     +        DL   LDLVA A   D+VP
Sbjct: 180 DPKRDDCAYPYDELCGCGVGFKLIQALASKRGK-----TVTDLFPYLDLVATAIAADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           L G NR     G+ V  +    G+KA+I ++      T  ++ +++ P INA GRI +  
Sbjct: 235 LTGENRTLAYFGMKVINKSPRAGIKAIISQLKKKE-FTITDVVFVVAPRINAAGRISQGL 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL  ++ +  +  A  ++  N  RR ++  + ++A  ++  +  + Q+    VV  
Sbjct: 294 HAVELLTENNLEVAKQYAASIEKYNSERRTLDQEITKEAFQQI--EKLEEQERFTTVVYD 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   D K   S RS++GFD+   +    E   + 
Sbjct: 352 ENWHKGVIGIVASRLIETYYRPTLVFTKSGD-KLAASARSVKGFDVYNALEQCKEH--IT 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT++  N+    D F++   N +   + TP   ID  +    +      +
Sbjct: 409 QFGGHKYAAGLTLKEENYQAFKDAFEEVVKNTIDKNLLTPEILIDKEITLKEITPKFYRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQS-IRVVN--LAHLQMTFESQDSETLQAIAFRVYGTP 552
           L+   P+G  N +P+F     K     + V     HL++    + S  +  I F +    
Sbjct: 469 LKQFAPFGPQNMSPIFMSTQLKDTGFAKCVGAEKDHLKLCAVQRKSPRINGIGFNLGD-- 526

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +       K       +  N W G    QLR+ D  
Sbjct: 527 --KLSKVQDKKTFDAVYSIDENTWEGKTTLQLRLRDIR 562


>gi|227537505|ref|ZP_03967554.1| single-strand DNA specific exonuclease [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227242642|gb|EEI92657.1| single-strand DNA specific exonuclease [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 566

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-based stats.
 Identities = 167/578 (28%), Positives = 274/578 (47%), Gaps = 18/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            RWV     E  N+ + ++ +  I  +++ +L+ R + + D A+ F  PS+  L  DP +
Sbjct: 3   KRWVLKSKSEH-NKVIKLSDELGISTVLSELLIAREIETFDQARTFFRPSLEELH-DPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  RI +AI N+EKI+I+GDYDVDG  +VA++  F          YIPDR  +G
Sbjct: 61  MKDMDIAISRIEKAIGNNEKILIYGDYDVDGTTAVAVVYNFFREFHSRIEFYIPDRYAEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + D + YA  + +D I+ DHH        A A+
Sbjct: 121 YGISMQGVDYAAENGFSLIIALDCGIKANDKIDYANARNVDFIIGDHHLPGDVLPNAIAV 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R D       L   G+ F ++    +    D            LDLVA++   D+V
Sbjct: 181 LDPKREDCPYPYKELSGCGIGFKIIQAFIQKNGMD-----IQQCYQFLDLVAVSIASDIV 235

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIER-VNISSPITAENLGYMIGPSINAGGRIGE 313
           P+ G NR     GL         GL+ALI    N +   T  ++ + IGP INA GRI  
Sbjct: 236 PITGENRILTHFGLQKLNTNPCCGLQALINLSSNKTGTFTVNDIVFQIGPRINAAGRIDH 295

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +    +LLIS   QE +  +  +D  N  R+  +  + E+A A +  + ++++     V+
Sbjct: 296 AKDAVKLLISKSLQEAKDFSESIDDQNNVRKDFDLRITEEALALI-DESENLKARKSTVL 354

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WH G++G++A+RL EK+ RP+  ++    G   GS RS+ GFD+ + +S      +
Sbjct: 355 FKSDWHKGVIGIVASRLTEKYYRPTIILTQTN-GHVAGSARSVIGFDLYEALSEC--SDL 411

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L + GGH  AAGLT++  N       F+   + ++   +      I+  +  + +     
Sbjct: 412 LDQFGGHKYAAGLTMKLENVTSFQQKFEDVVNTLIKPEMLQQEVLIELTIPLTEITSRFF 471

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
            +L+   P+G  N  P+F      +  +  +V   H++MT   +DS   + I F +    
Sbjct: 472 KILKQFEPFGPQNDAPIFLTKKVVVIGNAYLVGTNHIKMTIRQEDSAAFECIGFGLAE-- 529

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                  + GK   +   +  N WRG K  QL +    
Sbjct: 530 --HIAHINSGKPFDICYVIEENNWRGKKNLQLNIKAIR 565


>gi|222056528|ref|YP_002538890.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter sp.
           FRC-32]
 gi|221565817|gb|ACM21789.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter sp.
           FRC-32]
          Length = 574

 Score =  428 bits (1099), Expect = e-117,   Method: Composition-based stats.
 Identities = 182/578 (31%), Positives = 279/578 (48%), Gaps = 18/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRN-VSIDYAKDFLNPSIRLLMPDPLI 74
            RW     +        +        ++AR+L+NR       A  F   S+  L  DP +
Sbjct: 7   KRWELRKSEPDD--VERLVSAGVATPLLARLLLNRVPCDCKAAASFFTSSLAELH-DPYM 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L   + A  R+++A    EKI I GDYDVDG  SV L++ F     ++A   IPDR+VDG
Sbjct: 64  LLGMESAVERLLRAAVGKEKICIHGDYDVDGITSVVLLLTFFQTIGIDACYIIPDRLVDG 123

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++K       +++TVDCG T+    +     GID+I+ DHH        A A+
Sbjct: 124 YGLSADAVDKAARLKTDVMVTVDCGITALAEAKLCAEAGIDLIITDHHTPGEALPDACAV 183

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLDLVALATVCD 252
           +NPN+         L   GV F +++ +   LR +         +L   LDLVAL T+ D
Sbjct: 184 INPNQKGCNYPFKALAGVGVAFNLVIALRSRLRAEGFFSGRAEPNLREYLDLVALGTIAD 243

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           VVPLI  NR     GLM   +   PG++AL     I+  +    +G+ + P +NA GR+ 
Sbjct: 244 VVPLIDQNRILAKYGLMELSQSHRPGIQALKRVAGITGDVGCGAVGFRLAPRLNAAGRLE 303

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            + +   LL+  D +  E LA  LD  N  R+ +E  +L  A   V       +    IV
Sbjct: 304 NAAMAVELLLCKDLKSAEPLAAALDASNAERQAVEREILNDALQMVRDDA-AFKGRKSIV 362

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WH G++G++A+RL + + RP+  I+ ++ G G GSGRSI GF + + ++   E  
Sbjct: 363 LASEEWHSGVIGIVASRLVDLYHRPTILIALKD-GNGKGSGRSIAGFHLHEALTACAEH- 420

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
            LVK GGH  AAGL +         + F + A  ++      PV  ID  L A  + + L
Sbjct: 421 -LVKFGGHKHAAGLAIAEETLQAFVERFNEIADGLLTPEDLIPVLLIDAELKAEDLTLDL 479

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
           +  LE   P+G GNP PVF   + ++   R+V   HL++  + + ++  +AIAF + G  
Sbjct: 480 VSELERMKPFGMGNPEPVFLLQDAEVLESRIVKDTHLKLRLQVE-AKKFEAIAFSMAGR- 537

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                  S G+R+ +     +N W G    QL V D  
Sbjct: 538 ------VSVGERIDLAFSPAINNWNGRSSLQLTVKDLR 569


>gi|312888553|ref|ZP_07748122.1| exonuclease RecJ [Mucilaginibacter paludis DSM 18603]
 gi|311298867|gb|EFQ75967.1| exonuclease RecJ [Mucilaginibacter paludis DSM 18603]
          Length = 572

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 172/582 (29%), Positives = 280/582 (48%), Gaps = 19/582 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
            RW     + G    + ++ +  I  +++ +L++R +S  + A+ F  P I  L  DP +
Sbjct: 3   KRWSIK-RKPGEAEIIKLSAELNIDPVLSTLLLHRQISNLEQARYFFRPDINHLH-DPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D +KA  RI QA    EKIMI+GDYDVDG  SVAL+  F  +   N + YIPDR  +G
Sbjct: 61  MKDMEKAILRIEQAFAAGEKIMIYGDYDVDGTTSVALVYSFFKNYYPNLDYYIPDRYKEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  S D + YA   GID I+ DHH        A A+
Sbjct: 121 YGISTQGIDFAHQHGISLIIALDCGIKSVDKIAYANTLGIDFIICDHHTPGEIIPDATAV 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P RLD       L   G+ F ++    +             L+S L+LVA++  CD+V
Sbjct: 181 LDPKRLDCEYPYKELSGCGIGFKLIQAYAQK-----NNIPFEQLMSYLELVAISIACDIV 235

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
            + G NR     GL+        G+K L+     +   T  ++ + IGP INA GRI ++
Sbjct: 236 HITGENRVLAHYGLIKINSNPCIGVKTLMLAAGRTENYTVSDIVFTIGPRINAAGRIDDA 295

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LLI+   +        +++ N  R+  + ++ + A + + +    + + S  VV 
Sbjct: 296 KHAVELLIACTDEVATAKGSIINLKNIERKEHDLSITDAALSMIDSDPVMVARKST-VVF 354

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
              WH G++G++A+RL EK+ RP+  ++ + +G   GS RS+ GFD+ +         +L
Sbjct: 355 NADWHKGVIGIVASRLTEKYYRPTIVLT-KSNGHVAGSARSVYGFDLYEA--LCGCSDLL 411

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           ++ GGH  AAGLT+   N       F++  +  +   +     +ID  L    ++     
Sbjct: 412 IQFGGHKYAAGLTMAPENVEAFSQRFEEVVNATITDEMLVQEIRIDAELKFKQIDAKFFR 471

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           +L   GP+G  N +PVF   N  +  +  +V   H++MT    DS +   IAF +     
Sbjct: 472 ILSQFGPFGPENMSPVFLTKNVYVSGNATLVGANHIKMTVIQNDSASFDCIAFNM----- 526

Query: 554 GEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
           GE+L + S+G    +   +  N WR  +  QL +      E 
Sbjct: 527 GEYLPKISKGIPFDICYTIEENVWRERRSIQLNIKGIKTYEA 568


>gi|300770902|ref|ZP_07080779.1| single-stranded-DNA-specific exonuclease RecJ [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300762175|gb|EFK58994.1| single-stranded-DNA-specific exonuclease RecJ [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 573

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 167/578 (28%), Positives = 274/578 (47%), Gaps = 18/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            RWV     E  N+ + ++ +  I  +++ +L+ R + + D A+ F  PS+  L  DP +
Sbjct: 10  KRWVLKSKSEH-NKVIKLSDELGISTVLSELLIAREIETFDQARTFFRPSLEALH-DPFL 67

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  RI +AI N+EKI+I+GDYDVDG  +VA++  F          YIPDR  +G
Sbjct: 68  MKDMDIAISRIEKAIGNNEKILIYGDYDVDGTTAVAVVYNFFREFHSRIEFYIPDRYAEG 127

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + D + YA  + +D I+ DHH        A A+
Sbjct: 128 YGISMQGVDYAAENGFSLIIALDCGIKANDKIDYANARNVDFIIGDHHLPGDVLPNAVAV 187

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R D       L   G+ F ++    +    D            LDLVA++   D+V
Sbjct: 188 LDPKREDCPYPYKELSGCGIGFKIIQAFIQKNGMD-----IQQCYQFLDLVAVSIASDIV 242

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIER-VNISSPITAENLGYMIGPSINAGGRIGE 313
           P+ G NR     GL         GL+ALI    N +   T  ++ + IGP INA GRI  
Sbjct: 243 PITGENRILTHFGLQKLNTNPCCGLQALINLSSNKTGTFTVNDIVFQIGPRINAAGRIDH 302

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +    +LLIS   QE +  +  +D  N  R+  +  + E+A A +  + ++++     V+
Sbjct: 303 AKDAVKLLISKSLQEAKDFSESIDDQNNVRKDFDLRITEEALALI-DESENLKARKSTVL 361

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WH G++G++A+RL EK+ RP+  ++    G   GS RS+ GFD+ + +S      +
Sbjct: 362 FKSDWHKGVIGIVASRLTEKYYRPTIILTQTN-GHVAGSARSVIGFDLYEALSEC--SDL 418

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L + GGH  AAGLT++  N       F+   + ++   +      I+  +  + +     
Sbjct: 419 LDQFGGHKYAAGLTMKLENVTSFQQKFEDVVNTLIKPEMLQQEVLIELTIPLTEITSRFF 478

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
            +L+   P+G  N  P+F      +  +  +V   H++MT   +DS   + I F +    
Sbjct: 479 KILKQFEPFGPQNDAPIFLTKKVVVIGNAYLVGTNHIKMTIRQEDSAAFECIGFGLAE-- 536

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                  + GK   +   +  N WRG K  QL +    
Sbjct: 537 --HIAHINSGKPFDICYVIEENNWRGKKNLQLNIKAIR 572


>gi|326798144|ref|YP_004315963.1| single-stranded-DNA-specific exonuclease RecJ [Sphingobacterium sp.
           21]
 gi|326548908|gb|ADZ77293.1| single-stranded-DNA-specific exonuclease RecJ [Sphingobacterium sp.
           21]
          Length = 566

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 168/578 (29%), Positives = 283/578 (48%), Gaps = 19/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            RWV        +   ++++   I  ++AR+LV R V   + A+ F  PS+  L  +P +
Sbjct: 3   KRWVERNT-VDTDVVTSLSKALNIHKVLARLLVQRGVFDFEQARKFFRPSLDDLH-NPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A RRI QAI   E I+++GDYDVDG  +V+++  FL     +   YIPDR  +G
Sbjct: 61  MKDMDLAIRRIEQAIGMKENILVYGDYDVDGTTAVSVLYSFLKRFYNHIGYYIPDRYKEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++        LII +DCG  S D ++YA  +GID I+ DHH   +E   A A+
Sbjct: 121 YGISFQGIDYAAENNYSLIIALDCGIKSVDKIEYAAQKGIDFIIGDHHTPGNELPKATAV 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R D       L   G+ F ++    +  + +       ++   LDLVA++   D+V
Sbjct: 181 LDPKRKDCNYPYKELSGCGIAFKIIHAFAKTNQLEE-----AEVFQYLDLVAVSIASDIV 235

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           P+ G NR     GL       + GL+AL++    +  +   ++ + IGP INA GRI  +
Sbjct: 236 PITGENRVLAYYGLKKLNNNPSFGLRALVDLSTKAGEMNLTDVIFQIGPRINAAGRIDHA 295

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
               +LLIS   +E +     +DV N  R+  ++ +  +A  +++ + + + +    VV 
Sbjct: 296 KDAVKLLISKSLEEAKNCCGLIDVQNMQRKDFDARITAEAL-EIIQKSETLIKRKTTVVY 354

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + WH G++G++A+RL EK+ RP+  ++ + +G   GS RS+ GFD+ + +S      +L
Sbjct: 355 QEDWHKGVIGIVASRLTEKYYRPTIVLT-KSNGHVAGSARSVAGFDLYEALSEC--SDLL 411

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
            + GGH  AAGLT++  N   L   F+      +   +  P   ID  ++ + +      
Sbjct: 412 EQFGGHKYAAGLTMKAENVPALQSKFEAVVAQSIAPELLEPEISIDAKIHLADITPKFFR 471

Query: 495 MLESAGPYGAGNPNPVFAFPNH-KLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           +L+   P+G  N  PVF   N   +   ++V   HL+M    + +     I F      L
Sbjct: 472 VLKQFAPFGPENNAPVFIAKNVYSVGEAQLVGANHLKMYITQEGAPAFDCIGFG-----L 526

Query: 554 GEFLM-QSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           GE++   ++G        +  N WR  K  QL +    
Sbjct: 527 GEYITHINKGIPFTACFSIEENVWRDKKNIQLNLKGIR 564


>gi|220920253|ref|YP_002495554.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           nodulans ORS 2060]
 gi|219944859|gb|ACL55251.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium
           nodulans ORS 2060]
          Length = 597

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 274/589 (46%), Positives = 364/589 (61%), Gaps = 3/589 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRAL-AITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            +  L V  S+ G  W     + G   A   I Q H +P+++ARVL  R V+      FL
Sbjct: 8   PRPLLDVHRSVLGRPWRDRCAEAGPQAAAVTIAQSHGLPEVLARVLAGRGVAPGEVPGFL 67

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP IL D + AA R+  A+   EK+ IFGDYDVDGAAS AL+   L    V
Sbjct: 68  EPRLRDLMPDPSILVDMEAAADRLAHAVLRREKVAIFGDYDVDGAASAALLAGTLRDLGV 127

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   +     EGA L++TVDCG+  +  L  A   G+DV+V+DH
Sbjct: 128 PFRLHIPDRITEGYGPNGEAIRMLAGEGASLLVTVDCGTAGHGPLAEAARLGLDVLVLDH 187

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSL 241
           H       PA A+VNPNRLDDLSG GHLCAAGVVFL LV + R LR+D       DL++ 
Sbjct: 188 HGAPETLPPARAVVNPNRLDDLSGLGHLCAAGVVFLTLVALKRRLRRDGV--EVPDLMAG 245

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATV DVVPL+GLNRA+V +GL V R +G  GL AL++   ++ P  A +LG+++
Sbjct: 246 LDLVALATVADVVPLLGLNRAFVRQGLAVMRGRGRRGLAALLDAAGLAEPPQAWHLGFLV 305

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LG+RLL+ +D  E   +A +LD LN+ R+ +E+A + +AEA    +
Sbjct: 306 GPRINAGGRIGDATLGARLLLCEDPIEAAGIAAQLDQLNRERQAIEAAAVAEAEALAALR 365

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
            +      VIV     WHPG+VGL+AARLKE+FGRP+FA +  EDG   GSGRSI G D+
Sbjct: 366 LERDPDQPVIVAGSPDWHPGVVGLIAARLKERFGRPAFAFALREDGTATGSGRSIIGADL 425

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G+ V  AVE G+  KGGGHAMAAG+T+  V+  R  D   +     V          +DG
Sbjct: 426 GRAVRRAVEAGLAAKGGGHAMAAGVTLAAVDLDRFRDGLSQELAAAVGDARAAQALLVDG 485

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
           VL+A  V   L+  +E AGP+G G P PVFA   H++   R+V   H++     +D  T+
Sbjct: 486 VLSAGGVQPDLVAAVERAGPFGQGAPEPVFALARHRIADARIVGTGHVKAQLRGRDGVTV 545

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            AIAFR    PLG+ L++S G+ +H  G L  + WRG +R QLR+ DA+
Sbjct: 546 GAIAFRAAEGPLGQLLLRSIGRDIHAAGTLSRDRWRGGERVQLRLCDAA 594


>gi|288802718|ref|ZP_06408156.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella
           melaninogenica D18]
 gi|288334868|gb|EFC73305.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella
           melaninogenica D18]
          Length = 574

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 162/585 (27%), Positives = 283/585 (48%), Gaps = 22/585 (3%)

Query: 16  FRWVS-LLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W         +N A  + +K  I  I+A +L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWNYTPPADTQVNAAKDLGEKLGISPILASLLIRRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+ + E+I+++GDYDVDG  +VAL+ +FL     N + YIPDR  +
Sbjct: 62  LMKDMDAAVDRLNDAMGHKERILVYGDYDVDGCTAVALVYKFLRQFYSNIDYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G +LII +DCG  + + + YA  QGID I+ DHH       PA A
Sbjct: 122 GYGVSKKGIDFAKETGVKLIIILDCGIKAIEEITYAKEQGIDFIICDHHVPDEVMPPAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD     +LC  GV F  +    +     N       L+ LLD  A++   D+
Sbjct: 182 ILNPKRPDDSYPFKNLCGCGVGFKFMQAFAK-----NNNIPFSRLVPLLDFCAVSIAADL 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP++  NR     GL    +  + GLKA+++   ++   ++  ++ + IGP INA GR+ 
Sbjct: 237 VPVVDENRILTFHGLKQLNQNPSLGLKAIVDICGLNSRELSMSDIIFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  +       A  +D  N+ R+ ++  M E+A  +++ + +  +  S IV
Sbjct: 297 NGKKSVDLLVEREYSLALDQAKHIDEYNEQRKDVDRQMTEEA-NQIVARLESQKHQSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  ++  ++    GS RS+ GFD+   +       
Sbjct: 356 LYDEHWKKGVIGIVASRLTEIYFRPTVVLT-RDENLATGSARSVAGFDVYAAIKSC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L+  GGH  AAGLT++  +       FQ +    +       +  ID V++   +   L
Sbjct: 413 LLLNFGGHTYAAGLTMKWADVKEFRKRFQAYVEEHIEPEQREAILDIDAVIDFKDITKKL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
              L+   P+G GNP P+F   +     + +VV     H+++     + +  +  IAF  
Sbjct: 473 HTDLKRFAPFGPGNPKPLFCTLDVYDFGTSKVVGREQEHIKLELVDSKSNNVMNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
             +           +   +   +  N ++     QL++ D  P E
Sbjct: 533 SAS----ARYIKSKRSFDIAYTIEDNVFK-RGAVQLQIEDIRPTE 572


>gi|311031522|ref|ZP_07709612.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus sp. m3-13]
          Length = 781

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 182/593 (30%), Positives = 298/593 (50%), Gaps = 27/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPD 71
            S  RW     +        + +   I  ++A +LVNR     D AK+FL  + +    D
Sbjct: 3   ASKSRWNV--SESNKELVDQLAESLDIAPLIASLLVNRGFDTIDAAKEFLYTNDQEFH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P ++ D DK   R+ QAI   EKI++FGDYD DG +S  +M+  L       + YIP+R 
Sbjct: 60  PFLMEDMDKLVERVNQAIAKEEKILVFGDYDADGVSSTTVMVTALQEVGALVDFYIPNRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGPN +  ++    G  +IITVD G ++    + A   G+D+I+ DHH+   E   A
Sbjct: 120 TEGYGPNENAFKQAKENGYSVIITVDTGISALYEAKVAKELGLDLIITDHHEPGPELPDA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           YA+++P +         L   GV + V   +     +            LLD+ A+ T+ 
Sbjct: 180 YAIIHPKKETCSYPFDDLAGVGVAYKVAHALLGKNPE-----------HLLDVAAIGTIA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGR 310
           D+VPL+G NR    KG+   ++    GLKAL+++  +    +T E +G+ IGP INA GR
Sbjct: 229 DLVPLVGENRLLASKGIKKMQQTTRVGLKALLQKCGVELHTVTEETVGFSIGPRINAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +  ++    LL+++D +E +MLA +++  N+ R+ + + + E+A  +V  +    +    
Sbjct: 289 LDNADPAVHLLMTNDQEEAKMLAEEMESYNKERQQIVTQITEEAIQQV-EEKYPPEDNGF 347

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAV 429
           I+VEG+ W+ G++G++A+RL ++F RP+  +S  E+ G   GS RSI GFD+ + +S   
Sbjct: 348 IIVEGNNWNAGVIGIVASRLVDRFYRPTIVLSLDEDKGLAKGSARSIVGFDLFENLSEC- 406

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T++  +   L     + A  I+     TP+ ++D       V 
Sbjct: 407 -RDILPHFGGHPMAAGMTLKIEDVNELRQRMNQKALEILTKEDFTPITEVDIECTVGEVT 465

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFR 547
           +A I+ LE   P+G  NP P     +   Q IR +     HL++  E Q+  +L  + F 
Sbjct: 466 LATIEQLEMLAPFGVANPKPKVLVKDVLPQQIRQIGNKSNHLKLVIE-QEGSSLDCVGFG 524

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
              T    +   S G  + V G L +N W   ++ QL + D    +   F  +
Sbjct: 525 FGET----YHHVSPGASLDVLGELSINEWNNFRKPQLFLKDIRVTDWQLFDIR 573


>gi|189502726|ref|YP_001958443.1| hypothetical protein Aasi_1422 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189498167|gb|ACE06714.1| hypothetical protein Aasi_1422 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 566

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 178/579 (30%), Positives = 282/579 (48%), Gaps = 17/579 (2%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
            RWV     E      ++     +   +A +LV + V+  + AKD+  PS+  L  DP I
Sbjct: 3   KRWVFQTMPE-PTVVASLANAIGVDSSIAALLVQKGVTDFNQAKDYFRPSLADLH-DPFI 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D DKA  R+++AI N E+I+I+GDYDVDG  SV+L+  FL         YIPDR  +G
Sbjct: 61  MKDMDKAVGRLLRAIENQEEILIYGDYDVDGVTSVSLVYGFLKQYHSKLQFYIPDRYKEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   +   I  G  LIIT+DCG  + + +Q A   GIDVIV DHH+      PAYA+
Sbjct: 121 YGVSKQAINWAIETGISLIITLDCGIKATECIQQAQIAGIDVIVCDHHEPGEGLPPAYAI 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P +         L   GV F +L           +      L   LDLVA++  CD+V
Sbjct: 181 LDPKQKTCPYPFKELSGCGVGFKLLQAFV-----LKQNISLDILYRYLDLVAISIACDLV 235

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           PL   NR     GL       + G++A+I+  N+   +    L + +GP +NA GR+   
Sbjct: 236 PLTDENRILAYHGLKRLNNSPSFGIQAIIQVANLPWTLGISQLVFGLGPRLNAAGRVDHG 295

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +L   LL+++DS     LA +++  N  RR ++S +  +A  +++   D    A   V+ 
Sbjct: 296 SLAVNLLLAEDSVTASSLARQIEDKNGFRRYLDSTITAEAL-QLMKASDASLIAKTTVLF 354

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + WH G++G++A+R  E + RP+  ++     K  GS RS+ G++I + ++   E  +L
Sbjct: 355 KEDWHKGVIGIVASRCIEHYYRPTIILTASG-NKATGSARSVAGYNIYEAITECAE--LL 411

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
            + GGHA AAGLT+   N     + F++   + +   +  PV KID +L    V     +
Sbjct: 412 EQYGGHAHAAGLTLPLENIISFQERFEQVVSSTISQELLIPVQKIDLLLPLEKVTNKFYN 471

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF-ESQDSETLQAIAFRVYGTPL 553
           +L    P+G GN  PVFA         R++   HL++T  E      + AI F +     
Sbjct: 472 ILNQMAPFGNGNMRPVFATELVIATKYRILKENHLKLTVQEPASGICIDAIGFGLAKYAH 531

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
               +    K   +   +  N ++G    QL +    P+
Sbjct: 532 ----LVCDRKPFKIAYTIERNNYQGQVNLQLNIKGLQPI 566


>gi|332291722|ref|YP_004430331.1| single-stranded-DNA-specific exonuclease RecJ [Krokinobacter
           diaphorus 4H-3-7-5]
 gi|332169808|gb|AEE19063.1| single-stranded-DNA-specific exonuclease RecJ [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 563

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 166/579 (28%), Positives = 272/579 (46%), Gaps = 22/579 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E   +   + ++  + + ++R+L+ R++   + AK F  PS+  L  DP ++
Sbjct: 2   RWTLKPKPE-AQKVTNLAKELGVEEPISRLLIQRDIDTFEKAKQFFRPSLDDLY-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  RI QAI   E I++FGDYDVDG  SVALM  +L         YIPDR  +GY
Sbjct: 60  KDMDVAVARIEQAIAQGENILVFGDYDVDGTTSVALMSSYLDTIHPQVATYIPDRYAEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + + + YA  +GID I+ DHH+   +   A A++
Sbjct: 120 GVSYMGIDFAADNDMTLIIALDCGVKAIEKVAYAKEKGIDFIICDHHRPGDQLPDAVAIL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  I    +Q+       +LL  LDLVA A   D+VP
Sbjct: 180 DPKREDCSYPYDELCGCGVGFKLISAIALSRKQN-----FEELLPYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V       G +A+I++V     +T  ++ ++IGP INA GR+   N
Sbjct: 235 ITGENRILAYHGLNVINHAPRAGFEAIIKQVK-KQTLTITDVVFIIGPRINAAGRMVHGN 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   +       A +++  N +R+  + ++ +QA  +++      +     VV  
Sbjct: 294 HAVTLLRETNLDAAIKFASEIEQYNSDRKEADKSITQQALDQIIE--SKEEGNKTTVVFQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   D K   S RS++GFD+   +    E   + 
Sbjct: 352 EDWHKGVIGIVASRLIETYYRPTLVFTRSGD-KYAASARSVKGFDVYNALHECAEH--IE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+    +    + F++         +  P   ID  ++ + +      +
Sbjct: 409 QFGGHKYAAGLTLAPEQYEAFKEKFEQVVAASCDERLLVPEIAIDSEIDLADITPKFHRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVN--LAHLQMTFESQD-SETLQAIAFRVYGT 551
           L+   P+G  N +P F   N       + V     HL+ T    +  + +  I F +   
Sbjct: 469 LKQFAPFGPQNMSPTFMTQNLIDTGYGKKVGADQTHLKATVIQNNRGQRIGCIGFNLGD- 527

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              ++ +    K       L  N W G+   QLR+ D  
Sbjct: 528 ---KYELIEDKKIFKAAYSLDENEWNGNVSLQLRLKDIQ 563


>gi|302345680|ref|YP_003814033.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella
           melaninogenica ATCC 25845]
 gi|302150163|gb|ADK96425.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella
           melaninogenica ATCC 25845]
          Length = 574

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 162/585 (27%), Positives = 282/585 (48%), Gaps = 22/585 (3%)

Query: 16  FRWVS-LLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W         +N A  + +K  I  I+A +L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWNYTPPADTQVNAAKDLGEKLGISPILASLLIRRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+ + E+I+++GDYDVDG  +VAL+ +FL     N + YIPDR  +
Sbjct: 62  LMKDMDAAVDRLNDAMGHKERILVYGDYDVDGCTAVALVYKFLRQFYSNIDYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G +LII +DCG  + + + YA  QGID I+ DHH       PA A
Sbjct: 122 GYGVSKKGIDFAKETGVKLIIILDCGIKAIEEITYAKEQGIDFIICDHHVPDEVMPPAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD      LC  GV F  +    +     N       L+ LLD  A++   D+
Sbjct: 182 ILNPKRPDDTYPFKDLCGCGVGFKFMQAFAK-----NNNIPFSRLVPLLDFCAVSIAADL 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP++  NR     GL    +  + GLKA+++   ++   ++  ++ + IGP INA GR+ 
Sbjct: 237 VPVVDENRILAFHGLKQLNQNPSLGLKAIVDICGLNGRELSMSDIIFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  +       A  +D  N+ R+ ++  M E+A  +++ + +  +  S IV
Sbjct: 297 NGKKSVDLLVEREYSLALDQAKHIDEYNEQRKDVDRQMTEEA-NQIVARLESQKHQSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  ++  ++    GS RS+ GFD+   +       
Sbjct: 356 LYDEHWKKGVIGIVASRLTEIYFRPTVVLT-RDENLATGSARSVAGFDVYAAIKSC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L+  GGH  AAGLT++  +       FQ +    +       +  ID V++   +   L
Sbjct: 413 LLLNFGGHTYAAGLTMKWADVKEFRKRFQAYVEEHIEPEQREAILDIDAVIDFKDITKKL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
              L+   P+G GNP P+F   +     + +VV     H+++     + +  +  IAF  
Sbjct: 473 HTDLKRFAPFGPGNPKPLFCTLDVYDFGTSKVVGREQEHIKLELVDSKSNNVMNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
             +           +   +   +  N ++     QL++ D  P E
Sbjct: 533 SAS----ARYIKSKRSFDIAYTIEDNVFK-RGAVQLQIEDIRPTE 572


>gi|95929295|ref|ZP_01312039.1| single-stranded-DNA-specific exonuclease RecJ [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134793|gb|EAT16448.1| single-stranded-DNA-specific exonuclease RecJ [Desulfuromonas
           acetoxidans DSM 684]
          Length = 576

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 188/579 (32%), Positives = 304/579 (52%), Gaps = 16/579 (2%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
             W               + +     +V ++L  R +S  + A+ FL  S+  L PDP+ 
Sbjct: 7   RSWKER-QSAKPVDWQQWSARLGCAPLVCQLLSQRGISTLEEAQAFLTASLSQL-PDPMA 64

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L   + A  R+VQA+   E I + GDYDVDG +  AL+ + L    VN   +IP R+ DG
Sbjct: 65  LRGMESAVDRLVQAVKAGEPIAVHGDYDVDGISGTALLTQCLRWFGVNVTYHIPLRMRDG 124

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   + + + +G +L+++VDCG +++   Q A + GI++I+ DHHQ       + + 
Sbjct: 125 YGLSEVALRRTLEQGIRLVVSVDCGISAHAEAQLAADLGIELIITDHHQPPETLPVSLSC 184

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP-LNFDLLSLLDLVALATVCDV 253
           +NP   D       L   GV F+V++ +   LR+   +P    DL  +LDLVAL TV D+
Sbjct: 185 INPWLPDCSYPDKRLSGVGVAFMVMIALRARLRETGNLPDPEPDLRYVLDLVALGTVADL 244

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGE 313
           VPL G+NRA V  GL +  +Q   GL AL++   + + +TA  +GY + P +NA GR+ +
Sbjct: 245 VPLQGVNRALVSSGLRLMAQQPRVGLAALVKVAEVRA-VTAGVVGYQLAPRLNAAGRLED 303

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           + LG  LL+ + SQ    +A +L+  N  RR +E  +L+QA  ++     D   A  IV+
Sbjct: 304 ATLGVDLLLDEVSQSAMPVAEQLNQFNHQRRQIEQQVLDQAIERIERDLTD--DALTIVL 361

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             +RWH G++G++A+RL E++ RP+  I+  E+G+G GS RSI+GF + +      E   
Sbjct: 362 ADERWHAGVIGIVASRLVERYHRPTVLIA-LEEGQGKGSARSIKGFHLYQAFEACQE--P 418

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++     R  + F+++A + +  ++   V + D  L    ++  L 
Sbjct: 419 LSGFGGHEFAAGLSIDAACVSRFTEQFERYAQSHLNPVMLGAVREYDAELVLEEIDETLY 478

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           D L++  P+G GNP PVF      +     V   HL+ + + QD  ++  IAF +     
Sbjct: 479 DELQALAPFGMGNPEPVFVVRQVHVHRPSCVAEKHLRFSLQ-QDGYSVPCIAFGMA---- 533

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            +   +  G+ + V   + +N WRG K  QL V D  P 
Sbjct: 534 -QRQDEVVGQAVDVLFQVGMNTWRGQKSLQLIVKDIMPS 571


>gi|89100792|ref|ZP_01173645.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus sp. NRRL
           B-14911]
 gi|89084495|gb|EAR63643.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus sp. NRRL
           B-14911]
          Length = 788

 Score =  426 bits (1096), Expect = e-117,   Method: Composition-based stats.
 Identities = 183/592 (30%), Positives = 294/592 (49%), Gaps = 27/592 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDP 72
           S  RW+    Q   ++A  +  +  I  IVA +LVNR + + + A+DFL  +      DP
Sbjct: 4   SKTRWIVR--QSDKDKADTLISELKISPIVASLLVNRGLDTPESAQDFLYGN-NGEFHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L   D A  RI +AI  +E I+I+GDYD DG  S ++MM  L     N + YIP+R  
Sbjct: 61  FLLAGMDAAVSRINKAINENEPILIYGDYDADGVTSTSVMMITLRSLGANVDFYIPNRFT 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN          G +L+ITVD G ++      A   G+D+I+ DHH+       A 
Sbjct: 121 EGYGPNEGAFRHAAEIGTKLLITVDTGISAVHEASIAKELGMDLIITDHHEPGPVLPEAL 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+++P     L     L   GV F V   +   + +            LL++ A+ TV D
Sbjct: 181 AIIHPKLEGSLYPFRELAGVGVAFKVAHALLGNIPE-----------ELLEIAAIGTVAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRI 311
           +V L G NR  V +G+   +     GL AL +  N+    +  E +G+M+ P +NA GR+
Sbjct: 230 LVSLKGENRLLVQRGIKKLKVTKRAGLLALFKLANVEQAAVDEETIGFMLAPRLNAAGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             ++    LL++DD +E  M+A ++D +N+ R+ + S + E+A  +V  +    +  +V+
Sbjct: 290 DSADPAVHLLLTDDREEAAMIAEEIDSMNKERQSIVSQIAEEAIKEVEEKYPAGEN-AVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVE 430
           V+  + W+ G++G++A+RL +KF RP+  +SF+ E G   GS RSI GFD+ K +S    
Sbjct: 349 VIGKEGWNAGVIGIVASRLVDKFYRPAIVLSFDKEKGTAKGSARSIAGFDLYKNLSAC-- 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T+   + G L +     A   +      PV  +D  ++   V++
Sbjct: 407 RDILPHFGGHPMAAGMTLGLGDVGELRERLNGLAKEQLSDEDFIPVASLDAEVSLEDVSL 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFRV 548
             I+ ++   P+G  NP P     +  + S+R +     HL+M    + S  L  I F +
Sbjct: 467 PAIEQMQLLSPFGMDNPKPRVLIKDAPIASMRKIGSGQNHLKMAL-GEGSSALDGIGFGL 525

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                  F   S   R+ V G L +N W   ++ Q+ + D S  E   F  +
Sbjct: 526 GEL----FHHISADSRISVIGELSINEWNNIRKPQIFLHDLSVAEWQLFDLR 573


>gi|323702156|ref|ZP_08113823.1| single-stranded-DNA-specific exonuclease RecJ [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532843|gb|EGB22715.1| single-stranded-DNA-specific exonuclease RecJ [Desulfotomaculum
           nigrificans DSM 574]
          Length = 889

 Score =  426 bits (1096), Expect = e-117,   Method: Composition-based stats.
 Identities = 171/579 (29%), Positives = 284/579 (49%), Gaps = 21/579 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            +W        +     I+ +  +  I+A++L+NR + ++D A+ FL   +  L   P +
Sbjct: 5   KKWRVKSPNPALQHI--ISTELGVSHILAQLLINRGIYTVDQARAFLGSELNRLF-SPWL 61

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D +KA  RI+ A    E I+++GDYDVDG     +++  L       + +IP R+ +G
Sbjct: 62  MKDMEKAVERILLAREKGEYILVYGDYDVDGITGTTILVLALRKLGCQVDYFIPHRLEEG 121

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   +E+ + +G  L++TVDCG +    +  A    +D+++ DHH+      PA A+
Sbjct: 122 YGLNKEALERAVEQGVTLVVTVDCGISGAAEVAAARELSLDIVITDHHEPPDILPPAVAV 181

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           VNP R D       L   GV   ++  +++      +     +    LDLV L TV D+V
Sbjct: 182 VNPKRNDCHYPFKELAGVGVALKLIQGLFQRAGLGQR-----EWEEYLDLVCLGTVADIV 236

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGE 313
           PL G NR  V  GL        PGL+ALI+   I S  +    LG+ + P +NA GR+G+
Sbjct: 237 PLQGENRIIVKHGLDKISNTCRPGLQALIKISGIRSESLGTRELGFGLAPRLNAAGRMGD 296

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           + LG  LL++ D    E LA  L+  NQ R+ +E+ +L +A A +      + +  V+V+
Sbjct: 297 ATLGVELLLASDPTCAEELATTLNKGNQERQQVEAKVLSEAMALLEAHPT-MAEDKVLVL 355

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WHPG++G++A+RL ++F RP   IS  EDGKG GS RSI GF++ + +     +  
Sbjct: 356 SSANWHPGVIGIVASRLVDRFYRPVLMIS-LEDGKGKGSARSIPGFNLYQAMVNC--QDY 412

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L + GGHAMAAG +++            K+A  ++   + TP   +D ++  + +++  +
Sbjct: 413 LQQFGGHAMAAGFSIDADKIDDFRLAINKYADEVLTEELLTPNLDLDAMVQLTDLSLDTV 472

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
             L+   P+G  NP P+       + + R V     HL++     D   L  I F +   
Sbjct: 473 QELDQLSPFGHCNPGPILGCCEATVINCREVGKNGGHLKLRVR-GDHVILDGIGFNMASY 531

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                 M +    + +     +N W G    QL V +  
Sbjct: 532 S----EMLATNDTIDMAFVPSINVWHGRASVQLEVKEFK 566


>gi|150024966|ref|YP_001295792.1| single-stranded-DNA-specific exonuclease RecJ [Flavobacterium
           psychrophilum JIP02/86]
 gi|149771507|emb|CAL42976.1| Single-stranded-DNA-specific exonuclease RecJ [Flavobacterium
           psychrophilum JIP02/86]
          Length = 562

 Score =  426 bits (1096), Expect = e-117,   Method: Composition-based stats.
 Identities = 173/577 (29%), Positives = 282/577 (48%), Gaps = 21/577 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW     +    +   + +   I D VA +L+ R + + D AK F  PS+  L  +P ++
Sbjct: 2   RWTIKP-KPAEEKVKHLVEVLNIKDFVASLLIQRGIETYDQAKTFFRPSLDDLH-NPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA RRI +AI N+E IM+FGDYDVDG  +V+L+  +L     N   YIPDR  +GY
Sbjct: 60  KDMDKAVRRIEKAIANNENIMVFGDYDVDGTTAVSLVSSYLKSYYKNVATYIPDRYDEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  S + + YA  + ID I+ DHH+       A A++
Sbjct: 120 GISYKGIDYADDNNITLIIALDCGIKSVEHVAYAKAKNIDFIICDHHRPGVFLPEAVAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  +      +N+     D +  LDLVA A   D+VP
Sbjct: 180 DPKRPDCFYPYDELCGCGVGFKLIQAL-----GENRNQTITDFIPYLDLVATAIAADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V      PG+KALI+ +     +T  ++ ++I P INA GRI   N
Sbjct: 235 ITGENRVLAKFGLEVINTNPRPGIKALIQNIK-KETLTITDVVFIIAPRINAAGRIKHGN 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
              +LL   +  + E  A ++++ N +R+ ++  + ++A  ++  + +  +     VV  
Sbjct: 294 YAVQLLTEFNLPQAEEFATQIEIFNADRKDLDKQITKEALQQI--ENNKEENNFTTVVYQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E   +P+   +   D K   S RS++ FD+   +        L 
Sbjct: 352 EDWHKGVIGIVASRLIETHYKPTIVFTKSGD-KLAASARSVKDFDVYNALEE--SAAFLE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAG+T++  N+ +  + F++   N +   +  P   ID  L  S +N  L+ +
Sbjct: 409 QFGGHMYAAGMTLKEENYKKFKNKFEEVVKNSIQPDLLIPEIAIDAELKLSDINEKLVRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNL--AHLQMTFESQDSETLQAIAFRVYGTP 552
           L+   P+G  N  PVF   N       + +     HL++  +  +SE   AI F +    
Sbjct: 469 LKQFEPFGPENMTPVFISKNINDTGYAKTLGKDEEHLRLFVKQNNSEGFAAIGFNLANKK 528

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
                +    K      ++  N W G+   QLR+ D 
Sbjct: 529 A----LTENQKPFDAVYYIDENIWNGNVTLQLRLRDI 561


>gi|16125635|ref|NP_420199.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter
           crescentus CB15]
 gi|221234387|ref|YP_002516823.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter
           crescentus NA1000]
 gi|13422741|gb|AAK23367.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter
           crescentus CB15]
 gi|220963559|gb|ACL94915.1| single-stranded-DNA-specific exonuclease recJ [Caulobacter
           crescentus NA1000]
          Length = 606

 Score =  426 bits (1095), Expect = e-117,   Method: Composition-based stats.
 Identities = 227/593 (38%), Positives = 343/593 (57%), Gaps = 8/593 (1%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           ++  AFLGVE S+SG  W        +     I Q+H + + +A+ LV+R V++++A+ +
Sbjct: 9   ISSSAFLGVERSLSGRAWRERP--ADLAVVREIQQRHGLIEPLAKALVSRGVTLEHAEHY 66

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           L P+++ L PDP + TD D+AA  ++ A+      M+F DYDVDGA S A ++R+  H  
Sbjct: 67  LRPTLKALFPDPSLFTDMDRAAEILIDALERGRPTMVFADYDVDGATSAAQLVRWFRHMG 126

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           V   +YIPDR+ +GYGP+P+   K  + GA+L++T+DCG+ +YDA+  A   G++V+VID
Sbjct: 127 VELPIYIPDRLTEGYGPSPAAFRKIRDGGAELVVTLDCGAAAYDAIASAGEIGLEVVVID 186

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFD 237
           HH ++ +   A A+VNPNR    SGQG L AAGV F++L  + R  R+           D
Sbjct: 187 HHLMREDPPAAAAVVNPNRPGCPSGQGVLAAAGVTFVLLTALNREARKRGLFTEDRPQPD 246

Query: 238 LLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENL 297
               LDLVAL  VCDV  L+G NRA    GL       NPGLKAL E    S   +    
Sbjct: 247 PRQWLDLVALGEVCDVTQLVGFNRALTALGLRAMGAWANPGLKALFEVGKGSGEPSVFTA 306

Query: 298 GYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAK 357
           G+++GP INAGGR+G S+LG+RLL +DD  E   LA +LD LN  R+ +E+A++E+A A 
Sbjct: 307 GFILGPRINAGGRVGRSDLGARLLSTDDPLEARALAEELDSLNTERKAVEAAVVEEAAAM 366

Query: 358 VLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSI 416
           +    +    A VIVV GD WHPG++G++A RL+E++ +P   I        G GSGRS 
Sbjct: 367 LERGSNFNPDAPVIVVAGDDWHPGVIGIVAGRLRERYRKPVVVIGIDRAANVGKGSGRSQ 426

Query: 417 EGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPV 476
            G ++G+ +  A E G+L+ GGGHAMAAGL++          F ++     + A+     
Sbjct: 427 SGVNLGRAIQAAFEAGLLMAGGGHAMAAGLSIRPEMIPEFRAFLEERLAGEMEAVGVEA- 485

Query: 477 FKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ 536
            ++D ++   A N AL+D  +   P+G GNP P+FA    + + +  +   H++M     
Sbjct: 486 VEVDALVQPRAANRALLDDFQRLAPFGPGNPEPLFALSQVRPERVSALKGGHVRMDLVGP 545

Query: 537 DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
             + ++AI++R   TPLG+ L+ + G  + V G L  + + G    QL + DA
Sbjct: 546 TGDRIKAISWRSAETPLGQRLL-AGGGPLDVVGKLKPDDYMGRNGVQLEIEDA 597


>gi|170741326|ref|YP_001769981.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium sp.
           4-46]
 gi|168195600|gb|ACA17547.1| single-stranded-DNA-specific exonuclease RecJ [Methylobacterium sp.
           4-46]
          Length = 597

 Score =  426 bits (1094), Expect = e-117,   Method: Composition-based stats.
 Identities = 276/592 (46%), Positives = 364/592 (61%), Gaps = 3/592 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALA-ITQKHAIPDIVARVLVNRNVSIDYAKDFL 61
            +  L V  S+ G  W          +A A I Q H +P+++ARVL  R V+      FL
Sbjct: 8   PRPLLDVHRSVLGRPWRERCADGPPQQAAATIAQSHGLPEVLARVLAGRGVAPRDVPLFL 67

Query: 62  NPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV 121
            P +R LMPDP +L D + AA R+  A+   EK+ IFGDYDVDGAAS AL+   L    V
Sbjct: 68  EPRLRDLMPDPAVLLDMEAAADRLAHAVLRREKVAIFGDYDVDGAASAALLAGALRDLGV 127

Query: 122 NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDH 181
              ++IPDRI +GYGPN   +     EGA+L++TVDCG+  +  L  A   G+DVIV+DH
Sbjct: 128 PYRLHIPDRITEGYGPNVEAVRVLAGEGARLLVTVDCGTAGHAPLAEAARLGLDVIVLDH 187

Query: 182 HQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSL 241
           H       PA A+VNPNRLDDLSG GHLCAAGVVFL LV + R LR+D       DL++ 
Sbjct: 188 HGAPESLPPARAVVNPNRLDDLSGLGHLCAAGVVFLTLVALKRRLRRDGV--DLPDLMTG 245

Query: 242 LDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMI 301
           LDLVALATV DVVPL GLNRA+V +GL V R +G  GL AL++   +  P  A +LG+++
Sbjct: 246 LDLVALATVADVVPLAGLNRAFVRQGLAVMRGRGRLGLAALLDAAGLGEPPQAWHLGFLV 305

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP INAGGRIG++ LG+RLL+ +D  E   +A +LD LN+ R+ +E+A + +AEA    +
Sbjct: 306 GPRINAGGRIGDATLGARLLLCEDPIEAAGIAAQLDQLNRERQAIEAAAVAEAEALTALR 365

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDI 421
            +     +VIV     WHPG+VGL+AARLKE+FGRP+FA +  +DG   GSGRSI G D+
Sbjct: 366 LEREPDQAVIVTGSPDWHPGVVGLIAARLKERFGRPAFAFALRQDGSATGSGRSIVGADL 425

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G+ V  AVE G+  KGGGHAMAAG+T+  V+  R  D   +     V          IDG
Sbjct: 426 GRAVRRAVECGLAAKGGGHAMAAGVTIAAVDLDRFRDALARDLAASVGEARAAEALLIDG 485

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
            L+A  V   LI  LE AGP+G G P PVFA   H++   R+V   H+++    +D  T+
Sbjct: 486 TLSAGGVQPDLIAALERAGPFGQGAPEPVFALARHRVADARMVGTGHVKVQLRGRDGVTV 545

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
            AIAFR    PLG FL++  G+ +H  G L  + WRGS+R QLR+ DA+   
Sbjct: 546 PAIAFRAAEGPLGRFLLRGIGRDIHAAGTLARDRWRGSERVQLRLCDAAEAT 597


>gi|220932058|ref|YP_002508966.1| single-stranded-DNA-specific exonuclease RecJ [Halothermothrix
           orenii H 168]
 gi|219993368|gb|ACL69971.1| single-stranded-DNA-specific exonuclease RecJ [Halothermothrix
           orenii H 168]
          Length = 814

 Score =  425 bits (1093), Expect = e-117,   Method: Composition-based stats.
 Identities = 183/587 (31%), Positives = 317/587 (54%), Gaps = 29/587 (4%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
            +W  +  +   +        + +  ++  +L +R ++  D    FL+  I+ L   P +
Sbjct: 3   KKWQFIKQKLDGSL-------NDLEPVLQSILYSRGITDRDEINRFLSCRIQDLH-SPFL 54

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFL-SHCSVNANMYIPDRIVD 133
           + D  KA  RI+ AI + EKI+++GDYDVDG  S AL+  +         + Y+P+R+ +
Sbjct: 55  MKDMGKAVDRILTAIESGEKIIVYGDYDVDGITSTALLFLYFKKRLGYEVDYYLPNRLKE 114

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG N   ++K IN+   L++TVDCG +  + ++YAT +G++VIV DHHQ   +  PA A
Sbjct: 115 GYGLNKEALDKIINKNYDLMLTVDCGISGLEEVEYATRKGLEVIVTDHHQPAKKLPPAIA 174

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++P+R DD     +L   GV F +   + + ++       +  LL L+D+V+L ++ D+
Sbjct: 175 VLDPHRKDDKYPFKYLAGVGVAFKLCQALEKEIKGHEI---SDFLLRLIDIVSLGSIADI 231

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VPL+G NR  V +GL       N GL+ L++++++    + A ++GY++ P +NA GR+ 
Sbjct: 232 VPLLGENRIIVKRGLSELNDTSNKGLRVLMDKLSLDGKDLNAGHIGYIMAPPLNAAGRME 291

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           + +LG  LL +D   + + +A +L  LN++R+  E  + E A   +  +  D+ +   IV
Sbjct: 292 DPSLGIELLTTDSIDKAKEIANRLINLNKSRQAEEEEIFEDAVKMI-EKTVDLNKDKGIV 350

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +    WH G++G++A+RL EK+ RP   IS  EDG G GS RSIEG +I K + F     
Sbjct: 351 LASPDWHHGVIGIVASRLVEKYYRPVIMIS-LEDGIGKGSCRSIEGLNIYKALDFC--SS 407

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
            L+  GGH  AAGL + + +  +  D F  +  +++      PV K+D +L    +N+  
Sbjct: 408 YLLSYGGHEQAAGLAINKEDIEQFRDTFLDYVDSVLSPEDLIPVLKLDSILKPGQINLNF 467

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYG 550
              L+   PYG GNP P F   N +   +R V     HL+ T +      L+ I F    
Sbjct: 468 YKTLKQLEPYGVGNPKPRFFLSNMQFNKLRTVGRDGKHLKFTLDKG----LKGIGF---- 519

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
              G+ L++ + K++ +  +L +N W G++  +L++LD +  E  ++
Sbjct: 520 -DFGDKLIEFKNKKVDLAFYLTLNTWNGAEEVELQLLDVNVKESINY 565


>gi|194334478|ref|YP_002016338.1| single-stranded-DNA-specific exonuclease RecJ [Prosthecochloris
           aestuarii DSM 271]
 gi|194312296|gb|ACF46691.1| single-stranded-DNA-specific exonuclease RecJ [Prosthecochloris
           aestuarii DSM 271]
          Length = 570

 Score =  425 bits (1093), Expect = e-116,   Method: Composition-based stats.
 Identities = 165/583 (28%), Positives = 272/583 (46%), Gaps = 19/583 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           FRW              ++++  +   +AR L NR +   D AK F  P    ++P P +
Sbjct: 4   FRWTIR--DSDDEACERLSREINVSLPIARALCNRGICDFDQAKAFFRPDPA-VIPSPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
             D   A  R+++A+   E I+++GDYDVDG    AL+M FL       + YI DR  +G
Sbjct: 61  FRDMQCAVERVMKALEQGEHILLYGDYDVDGTTGTALLMLFLRSQGAEVSYYINDRFTEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG + + +   +  GA L+ITVDCG  +   ++    QGIDVIV DHH+  +    A A+
Sbjct: 121 YGLSDAGVGCAVERGAGLVITVDCGIRAVKEVEAFNVQGIDVIVCDHHEPGTLPA-ASAI 179

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP           LC  GV F ++  +   + +D       +    LDLVA+AT+ D+V
Sbjct: 180 LNPKVPGCSYPFRELCGCGVAFKLVQALIEQMGRD-----AAEWEQYLDLVAVATLADMV 234

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGE 313
            L   NR Y+ +GL   +      ++ LI  +      ++A  + + I P INA GR+  
Sbjct: 235 ALKEENRIYMHQGLQRLKAAPRMSIQELISCMGARLESLSAGVIAFGIAPRINAAGRMQN 294

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +      L+SD   E    A +LD LN  RR +++ +L+ AE  V          S +V+
Sbjct: 295 AATAVEWLMSDSRDECRKHAEELDRLNGERREIDAGILKLAEGMVNGYFASY--CSSLVL 352

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL+EK+  P+  +   + G   GS RS+ G ++ +++      G+
Sbjct: 353 YHEDWHLGVLGIVASRLQEKYYLPTVVLGGSD-GLIKGSVRSVGGLNVMEVLQEC--SGL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L K GGH  AAG+T++  N       F   +   +          ID  L    V+   I
Sbjct: 410 LEKFGGHEAAAGVTLKPENLQLFRKRFDALSAERLSYEQRQKEVIIDTQLQLDEVSPKFI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
           ++L    P+G GNP PVF     ++    R++   H++ + ++        I F      
Sbjct: 470 NVLSQFAPFGFGNPEPVFLSRGLRISGYPRLLKGRHVKFSVKTGSGRIFDVIGFSRED-- 527

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
           +   L +   +   +   L  N W G K  Q+++ D +  +  
Sbjct: 528 IYRALERGSKQVFSMVYTLEENEWNGRKTIQMKLKDMAVEKSQ 570


>gi|15613803|ref|NP_242106.1| single-strand DNA-specific exonuclease [Bacillus halodurans C-125]
 gi|10173856|dbj|BAB04959.1| single-strand DNA-specific exonuclease [Bacillus halodurans C-125]
          Length = 784

 Score =  425 bits (1092), Expect = e-116,   Method: Composition-based stats.
 Identities = 186/592 (31%), Positives = 291/592 (49%), Gaps = 27/592 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDP 72
           S  RW     ++   R   + +   I  IVA++LV R +   + AK FL      L+ DP
Sbjct: 4   SKARWNV--AEQLDERIRPLLEHLHIEPIVAKLLVIRGIDTVEEAKTFLQVD-ESLLHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             L   ++   R+ QAI   EKI+I+GDYD DG +S ++M+  L       + YIP+R  
Sbjct: 61  YELDGMEQVVARVRQAIKAEEKILIYGDYDADGVSSTSVMVYTLRELGAQFDYYIPNRFT 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN + +     EG QL+ITVD G  +    + A   G+D IV DHH+       A 
Sbjct: 121 EGYGPNENALRWAKEEGYQLVITVDTGIAAVHEAEVAKEIGLDFIVTDHHEPPPVLPDAV 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A++NP +        HL   GV F +   +   +              LLDLVA+ T+ D
Sbjct: 181 AIINPKKPGCSYPCKHLAGVGVAFKLAHALLERVP-----------YDLLDLVAIGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRI 311
           +VPL   NR    +GL        PG++AL +        + AE++G+ IGP INA GR+
Sbjct: 230 LVPLTDENRWLAKEGLKAIETTTKPGIQALKKVCGFHEDNVQAEHVGFGIGPRINAAGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             +     LLI+D  +  + LA ++D+LN+ R+ + S +  +A   V  +    +   V+
Sbjct: 290 DSAKPAVELLITDQVETGQQLAEQIDLLNKERQAIVSEIAAEAINLV-KELYPPEDNHVL 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVE 430
           VV G  W+PG++G++A+RL E F RP+  +S++E+ G   GS RSIEGFD+      +  
Sbjct: 349 VVGGHGWNPGVIGIVASRLVETFYRPTIVLSYDEEKGIAKGSARSIEGFDM--FHELSKN 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             +L   GGH MAAGLT+   +   L       A   +      P+ +ID   +   +++
Sbjct: 407 RELLPHFGGHPMAAGLTMSLQDVDELRKRMNAQAREALRPEDFIPITRIDVQASVDEISV 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRV 548
           + I+ + +  PYG GNP P     + K++ +R +     HL++TF+ Q+  TL  + F +
Sbjct: 467 STIEKMNALAPYGVGNPEPKVMLTDVKIEGMRKIGAASNHLKVTFQ-QNGTTLDGVGFHL 525

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                      S   R+   G L +N W G  + QL + D +  E   F  +
Sbjct: 526 GHLS----DEISPTARVSAVGVLSINEWNGHVKPQLMIEDLAVNEWQLFDWR 573


>gi|260887826|ref|ZP_05899089.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           sputigena ATCC 35185]
 gi|330838607|ref|YP_004413187.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           sputigena ATCC 35185]
 gi|260862432|gb|EEX76932.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           sputigena ATCC 35185]
 gi|329746371|gb|AEB99727.1| single-stranded-DNA-specific exonuclease RecJ [Selenomonas
           sputigena ATCC 35185]
          Length = 656

 Score =  425 bits (1092), Expect = e-116,   Method: Composition-based stats.
 Identities = 180/584 (30%), Positives = 311/584 (53%), Gaps = 26/584 (4%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
             W  L   +   RA+  +Q+       A +L++R ++  + A+ FL+P  +    DP +
Sbjct: 3   KEWSLLP--DTSARAVEFSQRIGTTPFTAALLLHRGITSDEEARAFLHPE-KQPFHDPFL 59

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D +KA  RI QAI   E+I+++GDYDVDG  + +L+ R L      A+ +IP R  DG
Sbjct: 60  MRDMEKAVSRIEQAIEAQERIVVYGDYDVDGITATSLLCRNLRQLGAAADYFIPHRQKDG 119

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   +++ I  GA+LI+TVDCG ++ +    A ++ +D+I+ DHH    E   A A+
Sbjct: 120 YGLHKETLDEIIAGGARLIVTVDCGISAVEEAAAAKDK-VDLIITDHHLPGKELPKALAV 178

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P+R D      ++   GV F +   +++ +R              LD+VAL TV DVV
Sbjct: 179 IDPHRADCSYPDKNIAGVGVAFKLCQALWQKMRGKAFTGD-------LDIVALGTVADVV 231

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           PL+G NR  V +GL V ++   PG++AL+         ITA ++G+++ P +NA GR+  
Sbjct: 232 PLLGENRKIVQQGLRVLKKSKRPGIQALLAVTELQEKEITAGHIGFVLAPRLNAAGRLAS 291

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +  G  LL+++D +E + +A +LD  N+ R+ +E  +L+ AE ++  +  D+++A V+V+
Sbjct: 292 ALRGVELLLTEDGEEAQAIAEELDAANRERQAVEQEILQVAEKQI--EEIDVKRAHVLVL 349

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            G+ WHPG++G++A+R+ E++ RP+  I+ EEDG G GS RSI GF + + +S   E   
Sbjct: 350 HGEGWHPGVIGIVASRIVERYYRPTVIIA-EEDGIGKGSCRSIRGFHMFEALSACGEH-- 406

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+  GGHA AAGL++   +     +  + +A  ++      P+  I+  L    +   L+
Sbjct: 407 LLGFGGHAQAAGLSLRSADVASFREAMEAYAAKVLTEEDFVPILDIELELAPEKITEQLM 466

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
             ++   PYG GNP P+F+    +    R +     HL+   +  D  ++  +A+     
Sbjct: 467 TEIKLLEPYGMGNPKPLFSTHGVRGSYARQIGKEGQHLKFELDGLD-ASIDVLAWG---- 521

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
             GE       +R+ +      + WR  +  QL + D  P    
Sbjct: 522 -KGEEAPLVNRERIDIAYFPEYHVWREKRSLQLMLEDFRPARAE 564


>gi|317128218|ref|YP_004094500.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           cellulosilyticus DSM 2522]
 gi|315473166|gb|ADU29769.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           cellulosilyticus DSM 2522]
          Length = 781

 Score =  424 bits (1091), Expect = e-116,   Method: Composition-based stats.
 Identities = 192/589 (32%), Positives = 290/589 (49%), Gaps = 29/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E   + + +  +  I  I AR LV R       A+ FL+     ++ DP +L
Sbjct: 7   RWKITEANEN--QVMELANQLNISMIAARFLVQRGYDDVHKAQSFLHMD-ASMIHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D +KA +RI  AI  +E I++FGDYD DG  S +LM   L     N   Y+P+R  +GY
Sbjct: 64  KDMEKAVKRIHTAIKENENILVFGDYDADGVTSTSLMYLTLKQLGANVGFYVPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN         E   LIITVD G  +    + A   G+D+I+ DHH+       AYA++
Sbjct: 124 GPNEQAFRHAKEENVSLIITVDTGIAANHEAEVAKELGVDLIITDHHEPPPTIPDAYAVI 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP + D      +L   GV F V   +   +               +DLVA+ ++ D+VP
Sbjct: 184 NPKQDDCFYPNKNLAGVGVAFKVAHALLNRVP-----------TEYIDLVAIGSIADLVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           LI  NR    +G+    R+  PGLKAL+E  NI+   +  E++G+MIGP +NA GR+  +
Sbjct: 233 LIDENRFLAAEGIHSLTREQRPGLKALMEHCNINPLELNEEHIGFMIGPRLNAAGRLDSA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +   +LL+S+D  E   LA+ +D LN+ R+ + + M ++AE +V          SV++V 
Sbjct: 293 DPAIQLLLSEDDIEAYELAIMIDDLNKERQTIVNEMAKEAEEQV---LAKDTVPSVLIVG 349

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEE-DGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
              W+ G++G++A+RL EKF RP+  +S +E  G   GS RSIEGFD+ + +S   E   
Sbjct: 350 QAGWNAGVIGIVASRLVEKFYRPTIVLSLDESTGLAKGSARSIEGFDLFQALSQCREW-- 407

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAGLT++  N   L +     A   V          +D  +  S V    I
Sbjct: 408 LPHFGGHPMAAGLTMKIENINLLQEKMCNIAETTVAEENWIKSLAVDLPVKVSEVTTEAI 467

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
             L+   P+G GNP P     N +L   + +     HL+++ + ++S  L  IAFR+   
Sbjct: 468 THLQEMAPFGVGNPAPKALIENVELAMTKKIGAKEDHLKLSLKDEES-VLDGIAFRMGNI 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G L +N W G  + Q+ + D    E   F  +
Sbjct: 527 ----ADELSPIAKLSVVGQLSINEWNGHVKPQMIIEDIKVDEWQLFDLR 571


>gi|86137916|ref|ZP_01056492.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           MED193]
 gi|85825508|gb|EAQ45707.1| single-stranded-DNA-specific exonuclease RecJ [Roseobacter sp.
           MED193]
          Length = 581

 Score =  424 bits (1091), Expect = e-116,   Method: Composition-based stats.
 Identities = 226/599 (37%), Positives = 330/599 (55%), Gaps = 31/599 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLGVE S++G RW+ L        A  + Q+  +P  + +VL  R V    A+ FL P 
Sbjct: 2   SFLGVENSLTGRRWLGLGID-LERAAEHMAQQTGLPSPLCQVLARRGVPAHEAQGFLTPH 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           ++ L+PDP  + D + AA R ++A+   ++I IF DYDVDG +S AL++ +L    + A 
Sbjct: 61  LKDLLPDPRRMKDMELAAARFLEAVQTRQRIAIFADYDVDGGSSAALLLVWLRAMGLQAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M         LI+ VDCG+ S+  +  A  +G DV+V+DHH  
Sbjct: 121 LYIPDRIDEGYGPNEEAMAGLAQ-AHDLIVCVDCGTLSHGPI--AAAKGADVVVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                   A+VNPNR D+    G+ CAAGVVFL+LV + R  R+   +    DL+ LLDL
Sbjct: 178 GETLPECVAVVNPNRQDEDGELGYFCAAGVVFLMLVEVRRQAREKG-LSTGPDLMGLLDL 236

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+G NRA V +GL V   +  PGL AL +   + +  +  +LG+++GP 
Sbjct: 237 VALATVADVAPLVGANRALVRQGLKVLGARQRPGLVALADVSRMDAAPSTYHLGFLLGPR 296

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG+++LG+RLL +++  E   LA +LD LN  RR +E+A+   A  +   +  D
Sbjct: 297 VNAGGRIGKADLGARLLATENPHEAAALAERLDQLNTERRDIENAVRAAAMEQAEARGFD 356

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              A ++   G+ WHPG+VG++A+RLKE  GRP+  I     G+G GSGRS+ G D+G  
Sbjct: 357 ---APLVWAAGEGWHPGVVGIVASRLKEAAGRPAVVIGLHN-GEGKGSGRSVSGIDLGIA 412

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTV         +             +     K+DG+L 
Sbjct: 413 IQRTAAEGLLIKGGGHKMAAGLTVAEDKLEAAMERLGDLLAKQGAGSLGPADLKLDGMLM 472

Query: 485 ASAVNIALIDMLES-----------AGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
             A NI LI+ +E                        ++FP+  ++  + +   HL+++ 
Sbjct: 473 PGAANIDLIEQIEQAGPFGAGAAAP-----------RYSFPDLAIRFAKRIGETHLKLSL 521

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
                  L AI F  + T LG  L++  G R H  G L +N W G +  QLR+ DA+  
Sbjct: 522 TDGVGGNLDAICFGAFDTALGPRLLEHGGARFHFAGRLEINSWGGRQSPQLRLEDAAEA 580


>gi|86131037|ref|ZP_01049636.1| single-stranded-DNA-specific exonuclease RecJ [Dokdonia donghaensis
           MED134]
 gi|85818448|gb|EAQ39608.1| single-stranded-DNA-specific exonuclease RecJ [Dokdonia donghaensis
           MED134]
          Length = 563

 Score =  424 bits (1091), Expect = e-116,   Method: Composition-based stats.
 Identities = 167/579 (28%), Positives = 275/579 (47%), Gaps = 22/579 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E   +   + Q+  +   +A +L+ R++   + AK+F  PS+  L  DP ++
Sbjct: 2   RWTLKPKPE-AQKVAKLAQELGVEAPIATLLIQRDIDTYEKAKNFFRPSLDALH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA  RI QAI   E I++FGDYDVDG  SVALM  +L         YIPDR  +GY
Sbjct: 60  KDMDKAVARIEQAIAQGENILVFGDYDVDGTTSVALMSSYLDTIHPQVATYIPDRYAEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + + + YA  +GID I+ DHH+   +   A A++
Sbjct: 120 GVSYMGIDFAADNDMTLIIALDCGVKAIEKVAYAKEKGIDFIICDHHRPGDQLPDAVAIL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  I    +Q+       +LL  LDLVA A   D+VP
Sbjct: 180 DPKREDCPYPYDELCGCGVGFKLISAIALSRKQN-----FEELLPYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V  +    G +A+I++V     +T  ++ ++IGP INA GR+   N
Sbjct: 235 ITGENRILAYHGLNVINQAPRAGFEAIIKQVK-KETLTITDVVFIIGPRINAAGRMVHGN 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   D       A +++  N +R+  + ++ +QA  +++   ++  + +V  V  
Sbjct: 294 HAVTLLRETDLATATKFASEIEQYNSDRKEADKSITQQALDQIIENQEEGNKTTV--VFQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   D K   S RS++GFD+   +    E   + 
Sbjct: 352 EDWHKGVIGIVASRLIETYYRPTLVFTRSGD-KYAASARSVKGFDVYNALHECAEH--IE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+    +      F++         +  P   ID  +N + +      +
Sbjct: 409 QFGGHKYAAGLTLLPEQYEAFKAKFEEVVAASCDERLLVPEISIDSEINLADITPKFHRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVN--LAHLQ-MTFESQDSETLQAIAFRVYGT 551
           ++   P+G  N +P F   N       + V     HL+    ++     +  I F +   
Sbjct: 469 IKQFAPFGPRNMSPTFMTKNLTDTGYGKKVGADQTHLKAAVVQNSRGSQIGCIGFNLGD- 527

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              ++ + +  K       +  N W G+   QLR+ D  
Sbjct: 528 ---KYDLITNKKPFMAAYAIDENEWNGNVSLQLRLKDIK 563


>gi|332519367|ref|ZP_08395834.1| single-stranded-DNA-specific exonuclease RecJ [Lacinutrix algicola
           5H-3-7-4]
 gi|332045215|gb|EGI81408.1| single-stranded-DNA-specific exonuclease RecJ [Lacinutrix algicola
           5H-3-7-4]
          Length = 563

 Score =  424 bits (1091), Expect = e-116,   Method: Composition-based stats.
 Identities = 163/578 (28%), Positives = 274/578 (47%), Gaps = 21/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW     +  +     +     + + VA +L  R + + + AKDF  P+++ L  DP ++
Sbjct: 2   RWTLKP-KPNLETVQFLQHALQVEEPVATLLAQRGIETYEQAKDFFRPNLKHLH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D  KA +RI  AI N+E I+++GDYDVDG  +V+LM  +L     N   YIPDR  +GY
Sbjct: 60  KDMLKAVKRIEVAIANNENILVYGDYDVDGTTAVSLMSSYLKSEYPNVATYIPDRYGEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + D + YA  + ID I+ DHH+   +   A A++
Sbjct: 120 GISFQGIDFAEDNNFTLIIALDCGIKAIDKIAYAEEKNIDFIICDHHRPGDKVPNAVAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P + D       LC  GV F ++  +     +        DL   LDLVA A   D+VP
Sbjct: 180 DPKQSDCNYPYKELCGCGVGFKLIQALASKKGK-----TVEDLQEYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V       G KA+I ++     +T  ++ ++I P INA GR+    
Sbjct: 235 ITGENRILAYFGLQVINSAPRAGFKAIINQIK-KETLTITDVVFVIAPRINAAGRMKHGQ 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   + Q  ++ A +++  N +RR  +  +  +A  ++  + ++ +     VV  
Sbjct: 294 YAVDLLTETNVQTAQVYAQEIENFNTDRREADKQITIEALQQI--ENNNEKDRLTSVVYQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
             WH G++G++A+RL E + RP+   +     K   S RS++GFD+   +    E   + 
Sbjct: 352 QDWHKGVIGIVASRLIETYYRPTLVFTKSG-NKLAASARSVKGFDVYNALEACAEH--IE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT++  N+      F++     +   + TP   ID  +  + ++     +
Sbjct: 409 QFGGHKYAAGLTLKEENYEAFKQKFEEVVQATIDKKLLTPEITIDRQIELNDISDKFYRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVNL--AHLQMTFESQDSETLQAIAFRVYGTP 552
           L    P+G GN +PVF   N +     + V     HL++T +   S  +  I F +    
Sbjct: 469 LSQFAPFGPGNMSPVFMTNNLQDTGYGKCVGEDDKHLRITVKQPGSNAIVCIGFGLGD-- 526

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +  +    KR      +  N W+G+   QL++ D  
Sbjct: 527 --KLNLIKNNKRFKAVYSIDENEWQGNVSLQLKLRDLK 562


>gi|288555360|ref|YP_003427295.1| single-strand DNA-specific exonuclease [Bacillus pseudofirmus OF4]
 gi|288546520|gb|ADC50403.1| single-strand DNA-specific exonuclease [Bacillus pseudofirmus OF4]
          Length = 789

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 186/589 (31%), Positives = 299/589 (50%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E   +A  +  +  + ++VA++LVNR + + + A+ FL     +   DP +L
Sbjct: 7   RWKIQEQDEH--KAGRLVSELGVDELVAQLLVNRGIETPEAARTFLYTK-EMTYHDPYLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              DKA  RI +AI N EKI+IFGDYD DG +S ++M+  L+      + YIP+R  +GY
Sbjct: 64  KGMDKAVARIKEAIANQEKILIFGDYDADGVSSTSVMIYTLNELGAVFDYYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN   + +   EG  L++TVD G ++      A    +D IV DHH+       AYA+V
Sbjct: 124 GPNEPALRRAKEEGYSLVVTVDTGISAVHEANVAKEIDLDFIVTDHHEAPPVLPEAYAIV 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP + D       L   GV F V   +   + +            LLD+V + T+ D+VP
Sbjct: 184 NPKQPDCTYPFKGLAGVGVAFKVSQALLGRIPK-----------ELLDIVVIGTIADLVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGES 314
           LI  NR    +GL        PGL+AL++   I    +T +++G+ IGP INA GR+  +
Sbjct: 233 LIDENRLMAKEGLKALESTSKPGLRALMKVCGIGQDALTGDHVGFGIGPRINAAGRLDSA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +    L+I++DS E E LA ++D LN+ R+ + + + E+A   V ++    +   V+++ 
Sbjct: 293 DPAVELMITNDSNEAEHLAAEIDSLNKQRQSIVNTITEEAVEVVESKYPPDEND-VLIIA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEED-GKGIGSGRSIEGFDIGKMVSFAVEEGI 433
           G  W+ G++G++A+RL E+F RP+  +S +E+ G   GS RSIEGFD+      +    I
Sbjct: 352 GAGWNAGVIGIVASRLVERFYRPTIVLSIDEEKGLAKGSARSIEGFDM--FKELSKSRDI 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAGLT++  +   L +     A  ++      P+ KID       +++ +I
Sbjct: 410 LPHFGGHPMAAGLTMKEPDLNLLRERLNNQAKEVLTEEDFKPLTKIDLSTTVDRISLTVI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
             LE+  P+G  NP P        +  +R +     HL+M+F  Q+  +L  I F +   
Sbjct: 470 KQLEALAPFGVNNPTPKVMLEGVHIDQMRRIGSESNHLKMSFV-QNGASLDGIGFHLGHL 528

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S+  ++   G L +N W G  + Q+ + D +  E   F  +
Sbjct: 529 H----DEISQTAKLSAIGTLSINEWNGHVKPQMMLEDLAVKEWQLFDWR 573


>gi|302391501|ref|YP_003827321.1| single-stranded-DNA-specific exonuclease RecJ [Acetohalobium
           arabaticum DSM 5501]
 gi|302203578|gb|ADL12256.1| single-stranded-DNA-specific exonuclease RecJ [Acetohalobium
           arabaticum DSM 5501]
          Length = 1210

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 186/595 (31%), Positives = 310/595 (52%), Gaps = 21/595 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPD 71
           I    W  L           ++    I  ++A +L +R ++     ++FL   +  L   
Sbjct: 2   ILDREWKLL--NRSTEEEPNLSDSLNISSVLAEILSSRGLNSKQKVENFLEVELDGLH-S 58

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L   ++A  RI  A+ + E I I+GDYDVDG  S  L++ +  H  V    +IP+R+
Sbjct: 59  PFLLEGIEQAVDRISTAMESQEIIGIYGDYDVDGITSTGLLINYFQHLGVEPKYHIPNRL 118

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYG N   +E     G +L+ITVDCG + Y  ++YA   GIDVI+ DHH+V +   PA
Sbjct: 119 EEGYGLNKDAIESLAQSGVELLITVDCGISDYQEVKYANQLGIDVIITDHHEVPARIPPA 178

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A++N  + +       LC AGV + +++ +     +D +V         LDL+A+  V 
Sbjct: 179 EAVINAKQSNCNYPFSQLCGAGVAYKLILALA---DKDQQVNQKEIKEYYLDLLAMGIVA 235

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGR 310
           D+VPL+  NR  V  GL + +   N GL ALIE V+   + I   ++GY++ P +NA GR
Sbjct: 236 DIVPLVDENRIMVKYGLELLQNPNNLGLSALIEAVDLTETEINTGHIGYILAPRLNAAGR 295

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           IG  +L   LLI+DD  +   +A +L+ +N  RR +E+ + ++AE  V  +  D++Q   
Sbjct: 296 IGNPDLALELLITDDPSQAADIAAELEEINHRRRDIEADIRQEAELMV--EGMDLEQTKA 353

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           +V+  + WH G+VG++A+ ++EK+ RP+  I+ E+DG G GS RSI+GF+I + V     
Sbjct: 354 LVLASENWHSGVVGIVASDIQEKYYRPTIMIAIEDDGIGRGSARSIKGFNIYQAVK--NS 411

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           E +L K GGH  AAGL++ + +  +  D   ++A + +     TP  K+D  +  S ++ 
Sbjct: 412 EDLLPKFGGHEQAAGLSIAKEDIAQFRDEINQYADDRLSDKDLTPRLKLDCEVELSELSK 471

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRV 548
            L+  ++   P+G GNP P  A     +     V     HL++    +   T++ I F +
Sbjct: 472 ELVQEIDYLAPFGFGNPRPKLAVREVTVADFATVGSNGEHLKLAVTDEAGTTVECIGFNM 531

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE----GHHFAK 599
            G       + S+ + + +   + +N W+G    QL++ D +  E       FAK
Sbjct: 532 AGF---RQKLISQQEEIDLACTVEINNWQGKSELQLKLKDINFPEVSFIDQLFAK 583


>gi|293394607|ref|ZP_06638901.1| recombination protein J [Serratia odorifera DSM 4582]
 gi|291422916|gb|EFE96151.1| recombination protein J [Serratia odorifera DSM 4582]
          Length = 577

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 185/565 (32%), Positives = 277/565 (49%), Gaps = 20/565 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +  ++ R+   R V  +     L  S++ ++P   +L   D A   + QA+ +  +IMI
Sbjct: 21  NLHPLLRRLYAQRGVQGEQE---LERSVKGMLP-WQLLDGIDAAVDILQQALADGRRIMI 76

Query: 98  FGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L     N     +P+R  DGYG +P ++E+    GAQLI+TV
Sbjct: 77  VGDFDADGATSTALTVLALRSMGGNNVQYLVPNRFEDGYGLSPEVVEQAATRGAQLIVTV 136

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S+  ++ A  +G+ V+V DHH        A A+VNPN  +       L   GV F
Sbjct: 137 DNGISSHAGVEVAHAKGMQVLVTDHHLPGETLPAAEAIVNPNLRECAFPSKSLAGVGVAF 196

Query: 217 LVLVLIYRILRQDNKVPL----NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   LR             +L  LLDLVAL TV DVVPL   NR  V +GL   R
Sbjct: 197 YLMLALRARLRDSGWFEQRAMAMPNLAELLDLVALGTVADVVPLDANNRILVYQGLNRIR 256

Query: 273 R-QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PG++AL+E  N     + A +LG+ +GP +NA GR+ + ++G  LL+SDD  +  
Sbjct: 257 AGKCRPGVRALLEVANRDARQLAANDLGFALGPRLNAAGRLDDMSIGVALLLSDDIAQAR 316

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLT-QCDDIQQASVIVVEGDRWHPGIVGLLAAR 389
           MLA  LD LNQ RR +E  M  +A       +         + +    WH G+VG+LA+R
Sbjct: 317 MLANDLDALNQTRREIEQGMQVEALQLCDQLERTSTTLPYGLAMYHPEWHQGVVGILASR 376

Query: 390 LKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV--EEGILVKGGGHAMAAGLT 447
           +KE+F RP  A +   DG   GSGRSI G  +   +        G+++K GGHAMAAGL+
Sbjct: 377 IKERFHRPVIAFAPAGDGILKGSGRSIAGLHMRDALERLDTLNPGLMLKFGGHAMAAGLS 436

Query: 448 VERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNP 507
           +E   F      F +     +   +   V   DG L    + +   ++L   GP+G   P
Sbjct: 437 LEEARFDEFRQRFGELVGEWLDPAMLEGVIWSDGELAMQELTLETAELLREGGPWGQAFP 496

Query: 508 NPVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMH 566
            P F     ++   R+V   HL++  E       L  IAF V  T   +    S  + + 
Sbjct: 497 EPTFDGR-FRILQQRLVGEKHLKLMVEPLGGGPLLDGIAFNVDTTLWPD----SSVREVE 551

Query: 567 VTGHLCVNYWRGSKRCQLRVLDASP 591
           +   L VN +RG++  QL +    P
Sbjct: 552 LAYKLDVNEFRGNRSVQLLIQHIWP 576


>gi|56421115|ref|YP_148433.1| single-strand DNA-specific exonuclease [Geobacillus kaustophilus
           HTA426]
 gi|56380957|dbj|BAD76865.1| single-strand DNA-specific exonuclease [Geobacillus kaustophilus
           HTA426]
          Length = 773

 Score =  424 bits (1089), Expect = e-116,   Method: Composition-based stats.
 Identities = 181/589 (30%), Positives = 288/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E       + ++  +  ++AR+LV R V +   A  FLNP +R    DP +L
Sbjct: 7   RWEVERLDE--QAVRRLAEEAGVTPLLARLLVRRGVRTASEAAAFLNP-LRQPFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              ++A +R+ +AI   E+++++GDYD DG  S ++M+  L     +   YIP+R  +GY
Sbjct: 64  DGMERAIQRLKRAIDAGERVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN +        G  +I+TVD G  +   +  A   G+DVIV DHH+       A+A++
Sbjct: 124 GPNMAAFRSAKERGVSVIVTVDNGIAAVKEIAAANEWGMDVIVTDHHEPGPVLPEAHAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P +         L   GV F V   +   +              LLDLVA+ T+ D+VP
Sbjct: 184 HPKQPGSTYPFRDLAGVGVAFKVAHALLGRVP-----------RHLLDLVAIGTIADLVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L+G NR +V  GL   R     GL+AL  +  I  + I  + +G++I P +NA GR+G +
Sbjct: 233 LVGENRLFVAHGLEALRATERIGLRALFRQCRIDAAAINEQTVGFVIAPRLNAAGRLGGA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +    LL++DD  E   LA ++D LN+ R+ + + + E+A   V  Q    +   V+VV 
Sbjct: 293 DPAVALLMTDDENEAVQLAAEMDELNRERQQLVAQIAEEAADMVRRQFPPEEHR-VLVVA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
           G+ W+ G+VG++A++L E+F RP+  +S   E G   GS RSI GFD+    S +    +
Sbjct: 352 GEGWNAGVVGIVASKLVEQFYRPAVVLSIDREKGIAKGSARSIHGFDL--FASLSQCRDL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L       A   +     TP   ID   + + + ++  
Sbjct: 410 LPHFGGHPMAAGMTLSLDDVEELRQRLNDIAAETLSEDDFTPPTFIDASCSIAELTLSAA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
             LE   P+G GNP P+       ++++R V     H++  F SQD   + AI F +   
Sbjct: 470 RSLERFAPFGVGNPRPLVLIEGASVETMRRVGANGAHMKAVF-SQDGAAIDAIGFGLG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   +   R+   G L VN W G  + QL + D +  +   F  +
Sbjct: 527 --PLCEEIAPDARISAVGELSVNEWNGFAKPQLSLCDLAVSDCQLFDVR 573


>gi|163786824|ref|ZP_02181272.1| single-strand DNA specific exonuclease [Flavobacteriales bacterium
           ALC-1]
 gi|159878684|gb|EDP72740.1| single-strand DNA specific exonuclease [Flavobacteriales bacterium
           ALC-1]
          Length = 563

 Score =  424 bits (1089), Expect = e-116,   Method: Composition-based stats.
 Identities = 174/578 (30%), Positives = 279/578 (48%), Gaps = 21/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW      E + +   + +   + DIVA +L+ R +   + AK F  PS   L  DP ++
Sbjct: 2   RWTLKPKPEAL-KVEVLKKALQVDDIVATLLLQRGLDTYETAKTFFRPSFEDLH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  RI +AI + E I+++GDYDVDG  SVALM  +L     +   YIPDR  +GY
Sbjct: 60  KDMDSAVTRIEKAIKDGENILVYGDYDVDGTTSVALMSSYLKTRIDSVATYIPDRYDEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   + G  LII +DCG  + D + YA  +GID I+ DHH+   +   A A++
Sbjct: 120 GVSYKGIDFADDNGFSLIIALDCGVKAIDKVAYAKEKGIDFIICDHHRPGDQLPDAIAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  +       N+     DL+  LDLVA A   D+VP
Sbjct: 180 DPKREDCEYPFKELCGCGVGFKLITALAS-----NQGQTVQDLVEYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           ++  NRA    GL V   +  PG+KA+I  V     +T  ++ ++I P INA GR+   N
Sbjct: 235 IVEENRALAYFGLQVINTKPRPGMKAIIAEVKKDE-LTITDVVFIIAPRINAAGRMKHGN 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   D       A+ +D  N +RR  +  +  +A  ++  + ++ Q+    VV  
Sbjct: 294 HAVTLLTETDFNLAAEYAVDIDQFNTDRRETDKRITAEALIQI--EENNEQEGFTTVVYK 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   D K   S RS++GFD+   +    E   + 
Sbjct: 352 EDWHKGVIGIVASRLTETYYRPTLVFTKSGD-KLAASARSVKGFDVYNALEACSEY--IE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+   N+      F+      +   +  P  K+D  +  S +N  L+ +
Sbjct: 409 QFGGHKYAAGLTLLPENYEAFKAKFESVVKETIDPKLLIPEIKVDLEIELSQINDKLMRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVNL--AHLQMTFESQDSETLQAIAFRVYGTP 552
           L+   P+G GN +P F   N K     + V     H++ T     ++ +  I F +    
Sbjct: 469 LKQFAPFGPGNMSPTFMSQNIKDTGYGKCVGEDDKHIRFTATQSFNDKIVCIGFGLGD-- 526

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +  +    +       +  N+W G+   QL++ D  
Sbjct: 527 --KLDIIKNKRPFSAAYSIDENHWNGNISLQLKLKDIK 562


>gi|193215962|ref|YP_001997161.1| single-stranded-DNA-specific exonuclease RecJ [Chloroherpeton
           thalassium ATCC 35110]
 gi|193089439|gb|ACF14714.1| single-stranded-DNA-specific exonuclease RecJ [Chloroherpeton
           thalassium ATCC 35110]
          Length = 567

 Score =  424 bits (1089), Expect = e-116,   Method: Composition-based stats.
 Identities = 163/577 (28%), Positives = 281/577 (48%), Gaps = 20/577 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           F W     +       A+++   +   +A  L+ R VS    AK F  P++ +L   P +
Sbjct: 4   FNWTLYRPEA--ASVKALSESINVSAPIATALLGRGVSNFQEAKAFFRPNLDMLH-SPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D  KA+ R++QA+ N EKI+I+GDYDVDG    A+++ FL     N   Y+ DR  +G
Sbjct: 61  MKDMKKASGRVLQAVRNGEKILIYGDYDVDGTTGTAMLVLFLKKLGANVAYYVNDRHSEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG + S + K  +E   L+I+VDCG ++ + +++    GID I+ DHH+  S+   AYA+
Sbjct: 121 YGISSSGIAKAKDEQTDLVISVDCGISAVEPVRFCNEHGIDFIICDHHE-PSDLPDAYAI 179

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP   D       LC  GV F ++  +  ++          ++ + LD VALA   D+V
Sbjct: 180 LNPKLPDSGYPYRELCGCGVAFKLIQAVASLVEI-----APAEVYAYLDYVALAIAADIV 234

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGE 313
            L G NR  + +GL   + +    L  + +   +  S +++  + + I P INA GR+  
Sbjct: 235 NLTGENRVMMAEGLKTIQCRPRQCLAVMSKVCGLDLSNVSSSQIVFSIAPRINAAGRLNH 294

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +      +I++D  E   LA +L+ +N+ RR +++   ++AE     +   +  AS IV+
Sbjct: 295 ARQAIEWMIAEDEHEAVALAEELEFVNRERREIDTETFKEAEQLA--EVYALNYASSIVL 352

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             D WH G++G++A+R+ EK+ RP+  ++  + G   GS RS++G ++ + +    E   
Sbjct: 353 YKDSWHVGVIGIVASRILEKYYRPTLILTAAD-GVLKGSARSVQGVNVYEALQACEEF-- 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L++ GGH  AAGLT+   N       F +         +  P  K+D  +    +     
Sbjct: 410 LLQFGGHEHAAGLTLAPSNLESFRKAFDRAVEEQFTIEMRVPEIKVDAEVVLEQITPNFF 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQS-IRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
            +L    P+G  NP PVF   N KL S  +++   HL+ +           + F +    
Sbjct: 470 KVLSQFAPFGPKNPRPVFLTRNVKLCSLPQLLKEKHLKFSICDALGRRFDVVGFNMPEYF 529

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
                +Q+  +R+ +   L  N W      Q+R+ D 
Sbjct: 530 KP---LQTPDRRISLVYSLTENVWNRRTSIQIRLRDL 563


>gi|90580581|ref|ZP_01236386.1| putative single-stranded-DNA-specific exonuclease RecJ [Vibrio
           angustum S14]
 gi|90438239|gb|EAS63425.1| putative single-stranded-DNA-specific exonuclease RecJ
           [Photobacterium angustum S14]
          Length = 574

 Score =  423 bits (1088), Expect = e-116,   Method: Composition-based stats.
 Identities = 185/562 (32%), Positives = 281/562 (50%), Gaps = 20/562 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           IP I+ R+  +R +  D     L  S + L+ +   L     A + +V A+  + +I+I 
Sbjct: 19  IPPILQRIYASRGIKND---AELERSAKGLL-NYNQLHGMTSAVQLLVDALSQNTRIIIV 74

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L      N +  +P+R  DGYG +P ++E+ I  GA+LI+TVD
Sbjct: 75  GDFDADGATSSALSVLALRMLGCKNVDYLVPNRFDDGYGLSPEVVEQAIERGAELIMTVD 134

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S   +  A  +G+ V+V DHH        A A+VNPN  +       LC  GV F 
Sbjct: 135 NGVSSIAGVAVAKEKGLTVLVTDHHLPGDCLPIADAIVNPNLNECGFPSKALCGVGVAFY 194

Query: 218 VLVLIYRILRQDNKVPL----NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR 273
           +++ +   LRQ            +L  LLDLVAL TV DVV L G NR  V +GL   R 
Sbjct: 195 LMLALRAELRQRGWFEQQGIAMPNLAELLDLVALGTVADVVALDGNNRILVHQGLQRIRA 254

Query: 274 -QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
            +  PG++ALIE  N     +   +LG+ +GP INA GR+ + + G  LL+ D+ Q    
Sbjct: 255 GKCRPGIQALIEVANRDPARLVTSDLGFALGPRINAAGRLDDMSFGVELLLCDNIQSARR 314

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV-EGDRWHPGIVGLLAARL 390
           +A +LD LNQ R+ +E  M ++A A       + Q     +V     WH G++G+LA+R+
Sbjct: 315 MASELDGLNQTRKEIEQGMKDEALAICERLKFNQQDMPYGLVLFQRDWHQGVIGILASRI 374

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGLTV 448
           K+K+ RP  A +   +G+  GS RSI G  +   +        G+++K GGHAMAAGLT+
Sbjct: 375 KDKYHRPVIAFADAGNGEIKGSCRSIPGLHMRDALDLVDTQNPGMILKFGGHAMAAGLTI 434

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
                      F     N++       V   DG L    +N+ + ++L + GP+G   P 
Sbjct: 435 PEDKLDAFSKAFDAVVRNVLDEEALKGVLMTDGELGCHELNLDVAEILRAGGPWGQQFPE 494

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P F     +L   ++V   HL+M  E       + AIAF V      +    +  +++ +
Sbjct: 495 PTFDGT-FRLLHQKLVGGKHLKMMVEPLGGGTVIDAIAFNVDVKRWPD----ASVQQVEL 549

Query: 568 TGHLCVNYWRGSKRCQLRVLDA 589
              L VN +RG++  QL V D 
Sbjct: 550 VYRLDVNEYRGNRSVQLMVEDL 571


>gi|319952857|ref|YP_004164124.1| exonuclease recj [Cellulophaga algicola DSM 14237]
 gi|319421517|gb|ADV48626.1| exonuclease RecJ [Cellulophaga algicola DSM 14237]
          Length = 562

 Score =  423 bits (1088), Expect = e-116,   Method: Composition-based stats.
 Identities = 160/578 (27%), Positives = 267/578 (46%), Gaps = 21/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E   +   +     + D+VA++L+ R + + + AK F  P +  L  DP ++
Sbjct: 2   RWTIKAKPEE-EKIKELASALNVEDLVAQLLLQRGISTFEEAKLFFRPQLSDLH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  RI  AI   E I++FGDYDVDG  +VALM  +L     N   YIPDR  +GY
Sbjct: 60  KDMDIAVARIETAINEGENILVFGDYDVDGTTAVALMSSYLLSFYPNVATYIPDRYAEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + D + YA  +G+D I+ DHH+  +    A A++
Sbjct: 120 GVSYKGIDFAEDNNFSLIIALDCGVKAVDKVAYAKEKGVDFIICDHHRPGATLPDAIAIL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  +     +        DL+  LDLVA A   D+VP
Sbjct: 180 DPKRSDCTYPYDELCGCGVGFKLIQALGSRQGE-----TIEDLIPYLDLVATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V       G KA+I ++   + +T  ++ ++I P INA GR+    
Sbjct: 235 ITGENRVLAYYGLKVINSDPRAGFKAIINQIK-KTILTITDVVFVIAPRINAAGRMVHGQ 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   +  + E  A +++  N +RR ++  + ++A  +++    + ++    VV  
Sbjct: 294 HAVNLLTETNQAQAEKFAGEIEKYNSDRRGLDQEITKEALTQIIEN--EEEEGFTSVVYK 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL E + RP+   +   D K   S RS++GFD+   +        + 
Sbjct: 352 ETWHKGVIGIVASRLTETYYRPTLVFTKSGD-KLAASARSVKGFDVYNALEGC--ADYIE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+    +      F+K     +   +  P   +D  +    +   L+ +
Sbjct: 409 QFGGHKYAAGLTLLEEQYQNFKHQFEKVVSETIDPNLLIPEIAVDLRIEIKDITPKLMRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNL--AHLQMTFESQDSETLQAIAFRVYGTP 552
           +    P+G  N  PVF   N +     + V     HL+          +  I F +    
Sbjct: 469 INQFEPFGPENMTPVFMAENIQDSGYAKGVGEEGKHLKFAVTQNGYGPIGGIGFSLGD-- 526

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +  + +  K       +  N W+G+   QL++ D  
Sbjct: 527 --KLPLLTGRKPFSAVFSIDENEWQGNVSLQLKLRDIK 562


>gi|325860540|ref|ZP_08173644.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella denticola
           CRIS 18C-A]
 gi|327313685|ref|YP_004329122.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella denticola
           F0289]
 gi|325481925|gb|EGC84954.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella denticola
           CRIS 18C-A]
 gi|326945082|gb|AEA20967.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella denticola
           F0289]
          Length = 574

 Score =  423 bits (1087), Expect = e-116,   Method: Composition-based stats.
 Identities = 162/585 (27%), Positives = 284/585 (48%), Gaps = 22/585 (3%)

Query: 16  FRWV-SLLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W  +    E  + A  + +K  I  I+A +L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWNHTPPTAEQESAAGELGEKLGISPILAALLIRRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+ + E+++++GDYDVDG  +VAL+ +FL     N + YIPDR  +
Sbjct: 62  LMKDMDAAVDRLNDAMGHKERVLVYGDYDVDGCTAVALVYKFLRQFYSNIDYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G +LII +DCG  +   + YA  QGID I+ DHH       PA A
Sbjct: 122 GYGVSRKGIDFAKETGVRLIIILDCGIKAVKEIAYAKEQGIDFIICDHHVPDETMPPAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD      LC  GV F  +    +     N       L+ LLD  A++   D+
Sbjct: 182 ILNPKRPDDAYPFKDLCGCGVGFKFMQAFAK-----NNNIPFSRLIPLLDFCAVSIAADL 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP++  NR     GL    +  + GLKA+I+   ++   ++  ++ + IGP INA GR+ 
Sbjct: 237 VPVVDENRILAFHGLKQLNQNPSLGLKAIIDICGLNGRELSMSDIIFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  +       A  +D  N+ R+ ++  M E+A  +++ + +  +  S IV
Sbjct: 297 NGKKSVDLLVEREYGMAFRQAKHIDEYNEQRKDVDRQMTEEA-NQIVARLESQKHQSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  ++  ++    GS RS+ GFD+   V       
Sbjct: 356 LYDEHWKKGVIGIVASRLTEIYFRPTVVLT-RDENLATGSARSVAGFDVYAAVKSC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L+  GGH  AAG+T++  +    C  FQ +    +       +  ID V++   +   L
Sbjct: 413 LLLNFGGHTYAAGMTMKWTDVKEFCRRFQTYVEEHIEPEQREAILDIDAVIDFKDITKKL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
            + L+   P+G GNP P+F   +     + +VV     H+++     + +  +  IAF  
Sbjct: 473 HNDLKRFAPFGPGNPKPLFCTLDVYDFGTSKVVGREQEHIKLELVDSKSNNVMNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
             +           +   +   +  N ++     QL++ D  P +
Sbjct: 533 SAS----ARYIKSKRSFDIAYTIEDNVFK-RGAVQLQIEDIRPTD 572


>gi|86134620|ref|ZP_01053202.1| single-stranded-DNA-specific exonuclease  RecJ [Polaribacter sp.
           MED152]
 gi|85821483|gb|EAQ42630.1| single-stranded-DNA-specific exonuclease RecJ [Polaribacter sp.
           MED152]
          Length = 561

 Score =  423 bits (1087), Expect = e-116,   Method: Composition-based stats.
 Identities = 169/579 (29%), Positives = 282/579 (48%), Gaps = 24/579 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW          +  ++ ++  +   +AR+L  R++ + + AK F  PS+  +  DP ++
Sbjct: 2   RWTLKPT-PDSEKVKSLAKELQVSPTIARILCQRDINTFNEAKLFFRPSLEDVH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  RI +AI   E I+++GDYDVDG  +V+L+  +L   S N   YIPDR  +GY
Sbjct: 60  KDMDLAVARIDKAIAKQENILVYGDYDVDGTTAVSLVASYLRTLSPNIATYIPDRYAEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G + + ++   +    LII +DCG  + D + YAT +GID I+ DHH+   E   A A++
Sbjct: 120 GVSYAGIDFAEDNDFALIIALDCGIKAIDKVAYATQKGIDFIICDHHKPGDEIPKAVAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           N  R D       LC  GV F ++  +    +Q          +  LDLVA A   D+VP
Sbjct: 180 NAKREDCSYPFDELCGCGVGFKLIQALGVSRQQ-----TIEKFVPYLDLVATAIAADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     G+ V       G+KAL+ +      +T  ++ ++I P INA GR+   N
Sbjct: 235 MNGENRVLAYYGIQVINNNPRNGIKALVHQTKKKE-LTITDVVFIIAPRINAAGRMKHGN 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL   D       A  +++ N +R+ ++  + ++A  +++    + +     VV  
Sbjct: 294 YAVELLTEMDFDSAVQFAADIEIFNADRKDLDKKITDEALIQIIDN--NEEDKFTSVVYQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
           + WH G++G++A+RL EK+ RP+   +   D K   S RS++GFD+   +    E   + 
Sbjct: 352 EDWHKGVIGIVASRLIEKYYRPTLVFTKSGD-KLAASARSVKGFDVYNALLACSEF--IE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+   N+ +  + F++     +   + TP   +D  +  S +   L  +
Sbjct: 409 QFGGHKYAAGLTLLPENYNKFKNKFEEVVSKTIDKKLLTPEITVDAEIELSEITPKLFRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSI-RVVN--LAHLQM-TFESQDSETLQAIAFRVYGT 551
           LE   P+G  N  PVF   + +     + V    +HL++  F+  + +T  AI F     
Sbjct: 469 LEQMAPFGPQNMKPVFKTSSVRDNGYGKKVGADQSHLKLNVFQGDNKQTFGAIGFG---- 524

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            LG+ L +++     +   L  N W G K  QL + D  
Sbjct: 525 -LGDKLEEAQND-FDIVYTLDENIWNGHKSIQLVLKDLK 561


>gi|150390115|ref|YP_001320164.1| single-stranded-DNA-specific exonuclease RecJ [Alkaliphilus
           metalliredigens QYMF]
 gi|149949977|gb|ABR48505.1| single-stranded-DNA-specific exonuclease RecJ [Alkaliphilus
           metalliredigens QYMF]
          Length = 841

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 179/583 (30%), Positives = 297/583 (50%), Gaps = 22/583 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRN-VSIDYAKDFLNPSIRLLMPDPLI 74
             W              ++++  +    A++L NR  +    AK F++ S+  L  DP +
Sbjct: 4   KIWTYK--DYNEIEIKKMSEELGVLPFTAQILTNRKVIDTREAKRFIDSSLEQLH-DPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D  KA  RI +AI  +EKI I+GDYDVDG +S ++M+++      + + YIPDR+ +G
Sbjct: 61  LKDMKKAVDRIQEAIQKNEKIWIYGDYDVDGVSSTSIMLQYFKTIDFSVDYYIPDRVQEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   ++   + G  LIITVDCG TS++ +  A +  ID+I+ DHH+ +     AYA+
Sbjct: 121 YGINQEAIQLIKSRGGNLIITVDCGITSFEEIALANSLSIDMIITDHHECQGAVPEAYAI 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP + D       +C  G+   ++  +        K      +   +D+VA+ATV D+V
Sbjct: 181 INPKQHDCSYPFDSICGCGLALKLIQAL------TPKEEFKSTIYLYIDIVAIATVADIV 234

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           PL+  NR +V  GL       N G++AL+E        + A ++G+ +GP INA GRIG 
Sbjct: 235 PLVDENRIFVKNGLQYMPDTKNLGVQALLEVCKLKDRKLNAGHIGFSLGPRINAAGRIGS 294

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           ++ G +LL S D  E++ LA  L+  NQNR+ +E  +L++A   + +         V+V+
Sbjct: 295 ADSGVKLLTSSDPAEVQQLAHFLNEENQNRQEIEVKILDEAINMIESSGQ-FNIDKVLVL 353

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+R+ E++ +P   ++  E  K  GS RSI   ++ + ++    + +
Sbjct: 354 AKEGWHHGVIGIVASRIVERYHKPVIILA-IEGDKAKGSARSIPKLNLFEAMNQC--KDL 410

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
            +K GGH  AAGLT++  N            +  +           DG+L+   V  +LI
Sbjct: 411 FLKIGGHEQAAGLTLKSENIEAFRMKINDIVNQTLSPEDFIAQIHCDGLLSLDVVEDSLI 470

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           D L +  PYG GNP+P F   +  +  IR V     HL++   S+ S+ + AI F     
Sbjct: 471 DELGNLEPYGMGNPSPKFIGYDFTIVDIRAVGVDGKHLKLKLGSK-SKQVDAIGFNFGDY 529

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
                    +G ++H+      N +RG K  QL++ D   V+ 
Sbjct: 530 S----DHIEQGDKIHLVYTPEFNEFRGQKNIQLQIKDIKTVKP 568


>gi|297529256|ref|YP_003670531.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           C56-T3]
 gi|297252508|gb|ADI25954.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           C56-T3]
          Length = 788

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 181/589 (30%), Positives = 289/589 (49%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E       + ++  +  ++AR+LV R V +   A  FLNP +R    DP +L
Sbjct: 7   RWEVERLDE--QTVRRLAEEAGVTPLLARLLVRRGVRTASEAAAFLNP-LRQPFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              ++A +R+ +AI   E+++++GDYD DG  S ++M+  L     +   YIP+R  +GY
Sbjct: 64  DGMERAIQRLKRAIDAGERVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN +        G  +I+TVD G  +   +  A   G+DVIV DHH+       A+A++
Sbjct: 124 GPNMAAFRSAKERGVSVIVTVDNGIAAVKEIAAANEWGLDVIVTDHHEPGPVLPEAHAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P +         L   GV F V   +   +              LLDLVA+ T+ D+VP
Sbjct: 184 HPKQPGSTYPFRDLAGVGVAFKVAHALLGRVP-----------RHLLDLVAIGTIADLVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L+G NR +V  GL   R     GL+AL  +  I+ + I  + +G++I P +NA GR+G +
Sbjct: 233 LVGENRLFVAHGLEALRATERIGLRALFRQCRINAAAINEQTVGFVIAPRLNAAGRLGGA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +    LL++DD  E   LA ++D LN+ R+ + + + E+A   V  Q    +   V+VV 
Sbjct: 293 DPAVALLMTDDENEAVQLAAEMDELNRERQQLVAQIAEEAADMVRRQFPPEEHR-VLVVA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
           G+ W+ G+VG++A++L E+F RP+  +S  +E G   GS RSI GFD+    S +    +
Sbjct: 352 GEGWNAGVVGIVASKLVEQFYRPAVVLSIDQEKGIAKGSARSIHGFDL--FASLSQCRDL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L       A   +     TP   ID   + + + +   
Sbjct: 410 LPHFGGHPMAAGMTLALDDVEELRQRLNAIAAETLSEDDFTPPTFIDASCSIAELTLDAA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
             LE   P+G GNP P+       ++++R V     H++  F SQD   + AI F +   
Sbjct: 470 RGLERFAPFGVGNPRPLVLIEGASVETMRRVGANGAHMKAVF-SQDGAAIDAIGFGLG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   +   R+   G L VN W G  + QL + D +  +   F  +
Sbjct: 527 --PLCEEIAPDARISAVGELSVNEWNGFAKPQLSLCDLAVSDCQLFDVR 573


>gi|304384433|ref|ZP_07366838.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella marshii
           DSM 16973]
 gi|304334485|gb|EFM00773.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella marshii
           DSM 16973]
          Length = 582

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 166/588 (28%), Positives = 280/588 (47%), Gaps = 22/588 (3%)

Query: 15  GFRWVSLLGQ-EGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDP 72
            F+W       E    A  + +K  +  ++A +L++R ++ +  AK +  P +  L+ +P
Sbjct: 2   NFKWNYTPPSTEQQQAAKELGEKLGMSPVLASLLIDRGITTESAAKRYFRPQLADLI-NP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D D A  R+  A+   E+IM++GDYDVDG  SVAL+ +FL     N   YIPDR  
Sbjct: 61  FLMKDMDVAVDRLNDAMGRKERIMVYGDYDVDGCTSVALVYKFLRQFYSNIEYYIPDRYE 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++    +  +LII +DCG  + D + YA  QGID I+ DHH    +  PA 
Sbjct: 121 EGYGVSIKGIDYAKEKEVKLIIILDCGIKAIDEIAYAKEQGIDFIICDHHVPDEQLPPAA 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A++NP R DD     +L   GV F  +    +     N       L+ LLD  A++   D
Sbjct: 181 AILNPKRKDDTYPFKYLSGCGVGFKFMQAFVK-----NNGIPFSRLIPLLDFCAVSIAAD 235

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRI 311
           +VP++  NR     GL    +  + GLKA+IE  N++   ++  ++ + IGP INA GR+
Sbjct: 236 IVPVVDENRILAYHGLKQLNQNPSVGLKAIIEICNLNGRNLSMSDIVFKIGPRINASGRM 295

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
                   LL+  D  +    A  +D  N+ R+ ++  M E+A   ++ + ++ +  S I
Sbjct: 296 ENGKESVDLLVEKDYTQALQAARHIDEYNEQRKDIDKQMTEEA-NLIVEKLENQKHRSSI 354

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V+  + W  G++G++A+RL E + RP+  I+  ++     S RSI GFDI   +      
Sbjct: 355 VLYDENWKKGVIGIVASRLTEIYYRPTIVIT-RDENMATASARSIAGFDIYSAIKSC--R 411

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L   GGH  AAG+T++  +       FQ +    +          ID +L+   +   
Sbjct: 412 DLLQNFGGHTYAAGMTMKWSDVKEFARRFQTYVDEHIRPEQKEATLHIDALLDFKDITKR 471

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFR 547
           L   L+   P+G GNP P+F   N     + +VV     H+++     + +  +  IAF 
Sbjct: 472 LHHDLKRFAPFGPGNPKPLFCTNNVYDFGTSKVVGREQEHIKLELVDAKSNNVMNGIAFG 531

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
              +           +   +   +  N ++     QL++ D  P E  
Sbjct: 532 QSRS----ARYIKSKRSFDIAYTIEENAFK-RGGLQLQIEDIRPRENE 574


>gi|315499810|ref|YP_004088613.1| single-stranded-DNA-specific exonuclease recj [Asticcacaulis
           excentricus CB 48]
 gi|315417822|gb|ADU14462.1| single-stranded-DNA-specific exonuclease RecJ [Asticcacaulis
           excentricus CB 48]
          Length = 622

 Score =  422 bits (1085), Expect = e-116,   Method: Composition-based stats.
 Identities = 225/604 (37%), Positives = 333/604 (55%), Gaps = 19/604 (3%)

Query: 5   AFLGVECSISGFRWVSLLGQE--GINRALAITQKHAIP--------DIVARVLVNRNVSI 54
            FLGVE S++G  WV     +  G +    ITQ+ A+         + VAR +  R V+ 
Sbjct: 15  PFLGVETSVTGRLWVDRRDSQRVGAHELRQITQQIALKGPMEEAFVEPVARSIAARGVTA 74

Query: 55  DYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMR 114
               D+L P+++ L PDP    D  +A   I+ A+   +KI +F DYDVDGA S A ++R
Sbjct: 75  ATLDDYLRPTLKALFPDPDGFMDMPQAVAAILDALQARQKIYVFADYDVDGATSAAQLVR 134

Query: 115 FLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGI 174
           +  H     ++Y+PDR+++GYGP+    ++   EGA L+ITVDCG++++ AL YA   G+
Sbjct: 135 WFRHMGHELSVYVPDRMLEGYGPSEKAFDRLKAEGADLVITVDCGASAHRALDYAARIGL 194

Query: 175 DVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV-- 232
           +V+VIDHH ++ +     A+VNPNR    S QG+L AAGVVF+VL  + R          
Sbjct: 195 EVVVIDHHIMREDPPKCRAVVNPNRPGCTSAQGNLAAAGVVFVVLAALNREAETRGLFAE 254

Query: 233 PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP- 291
               DL   LDL AL  +CDV  L G NRA   +GL V  R  NPG++AL++        
Sbjct: 255 RPRPDLTQWLDLAALGAICDVTALSGFNRALASQGLKVMSRLNNPGIRALMQVAGGEPKD 314

Query: 292 ----ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLME 347
               +   + G+++GP INAGGRIG ++LG RLL +DD+ E   LA +LD LN+ RR +E
Sbjct: 315 AATALGVFHSGFVLGPRINAGGRIGRADLGVRLLSTDDADEAAALAQELDELNKTRRDVE 374

Query: 348 SAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE-D 406
           +A+ EQA A   T+     +  VI+V  + WHPG++G++A RL+E++ +P   I  +   
Sbjct: 375 AAVQEQALALAETKGLVTAEDHVIIVAHEDWHPGVIGIVAGRLRERWHKPVIVIGIDPVT 434

Query: 407 GKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHN 466
           G G GSGRS  G ++G+ V+ A E G+L+ GGGHAMAAGL++E      L  F      N
Sbjct: 435 GIGKGSGRSQAGINLGQAVTAAFESGLLLSGGGHAMAAGLSIEAARIPELRTFLNSHIAN 494

Query: 467 IVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL 526
                      +ID  L+A A    L++  E   P+G GNP P+F  P  ++     +  
Sbjct: 495 ATVEADRKDRLEIDAALSAGACTRVLLECFEIMAPFGPGNPEPMFVLPGMRVGYASALKG 554

Query: 527 AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRV 586
            H++     +  + L+AIA+R   T +G  L+   G  +HV G L  + + G K  Q  +
Sbjct: 555 GHVRCDLIDEGGKRLKAIAWRAQDTAVGAALLNPVGA-IHVAGRLKPDDYMGRKGVQFEI 613

Query: 587 LDAS 590
            D +
Sbjct: 614 EDIA 617


>gi|134298599|ref|YP_001112095.1| single-stranded-DNA-specific exonuclease RecJ [Desulfotomaculum
           reducens MI-1]
 gi|134051299|gb|ABO49270.1| exonuclease RecJ [Desulfotomaculum reducens MI-1]
          Length = 885

 Score =  422 bits (1084), Expect = e-116,   Method: Composition-based stats.
 Identities = 173/579 (29%), Positives = 283/579 (48%), Gaps = 21/579 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            +W        + + L+   +  I  I A++L+NR + ++D A+ FL   +   M  P +
Sbjct: 5   KKWRVKAPNPALQQILSF--ELGISKIFAQLLINRGIYTVDQARAFLGSELDK-MFSPWL 61

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D  KA  RI+ A    E+I+++GDYDVDG     +++  L      A+ +IP R+ +G
Sbjct: 62  MQDMKKAVERILGARDKGEQILVYGDYDVDGITGTTVLVLALRRLGCKADYFIPHRLEEG 121

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   +E+ +  G  L++TVDCG +  + ++ A   G++V++ DHH+   +   A A+
Sbjct: 122 YGLNKVALERAVERGVSLVVTVDCGISGAEEVEVAKALGLEVVITDHHEPPVQLPAAVAI 181

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R         L   GV   ++  ++       +          LDLV L TV D+V
Sbjct: 182 LDPKRSGCSYPFKELAGVGVALKLIQGLFEQAGLSQRN-----WEEYLDLVCLGTVADIV 236

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGE 313
           PL G NR  V  GL        PGL+ALI+   I    +    LG+ + P +NA GR+G+
Sbjct: 237 PLQGENRILVKHGLPQISNSKRPGLQALIKVSGIKAEVLGTRELGFGLAPRLNAAGRMGD 296

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           + LG  LL+++D    E +A +LD  N  R+ +ES +L +A A + T   +I Q  V+V+
Sbjct: 297 AGLGVELLLAEDLLVAEEMAEELDRGNHERQQVESKVLSEALALLETDS-EISQGKVLVL 355

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WHPG++G++A+RL ++F RP F IS  E+GKG GS RSI GF++ + +     +  
Sbjct: 356 ASENWHPGVIGIVASRLVDRFYRPVFMIS-LEEGKGKGSARSIPGFNLYQAMVSC--QDH 412

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L + GGHAMAAG ++               A   +     TP   +D ++N + +++  +
Sbjct: 413 LEQFGGHAMAAGFSIHVDKINEFRKTINAMAEEFLSEEHLTPNLDLDALINLNDLSMDTV 472

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
             L    P G  NP P+       + + R V     HL+M    +D   L  I F +   
Sbjct: 473 QELNQLSPLGHCNPGPILGCCQATVINCREVGKNGGHLKMRVR-EDHTVLDGIGFNLASY 531

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                 M +    + +     +N W G    QL V +  
Sbjct: 532 S----EMLAANDTVDMAFIPSINVWNGRTSVQLEVKELK 566


>gi|217979197|ref|YP_002363344.1| single-stranded-DNA-specific exonuclease RecJ [Methylocella
           silvestris BL2]
 gi|217504573|gb|ACK51982.1| single-stranded-DNA-specific exonuclease RecJ [Methylocella
           silvestris BL2]
          Length = 603

 Score =  422 bits (1084), Expect = e-116,   Method: Composition-based stats.
 Identities = 271/594 (45%), Positives = 365/594 (61%), Gaps = 5/594 (0%)

Query: 3   DQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLN 62
            ++FLGVE S  G  W   L   G  RA AITQ     DI+AR+L  R V  +   ++L+
Sbjct: 9   PRSFLGVEHSALGVSWRDRLDAGGQARAAAITQLRGHGDILARILAGRGVGPETCDEYLD 68

Query: 63  PSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN 122
           P++R L+PDP  + D + AA RI  A+  S K+ IFGDYDVDGAAS AL+  + + C V 
Sbjct: 69  PTLRRLLPDPFCIKDMEPAAERIAAAVEGSRKLAIFGDYDVDGAASSALLADYFTACGVE 128

Query: 123 ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHH 182
           A +YIPDRI +GYGPN   +      G  L+ITVDCG+ S+  L  AT  G++ IV+DHH
Sbjct: 129 AFVYIPDRIFEGYGPNIGAIRNLAAAGCHLLITVDCGTMSHGPLAEATALGLEPIVLDHH 188

Query: 183 QVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLS 240
           Q     +P   +VNPNR DDLSG G LCAAGVVFL L+ + R LR+          DLLS
Sbjct: 189 QAPEN-LPDALIVNPNRQDDLSGLGALCAAGVVFLTLIAVNRRLREKGFFNLRPEPDLLS 247

Query: 241 LLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYM 300
            LDLV+LATV DV PL GLNRA+V KGL V R++  PGL AL +   +  P T  +LG++
Sbjct: 248 GLDLVSLATVADVAPLGGLNRAFVTKGLAVMRQRLRPGLSALFDVAKLEGPPTPYHLGFL 307

Query: 301 IGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLT 360
           IGP INAGGRIG++ LG+RLL   D  E + +A +LD LN+ R+++ES  L++AEA+ + 
Sbjct: 308 IGPRINAGGRIGDAALGARLLSIADPIEAKRIAEELDRLNRERQVIESGTLDEAEAQAIA 367

Query: 361 QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFD 420
                  A+ IVV  D WHPG+VGL+A+RLKE+  +P+FAI+      G+GSGRS+ G D
Sbjct: 368 -GGLSPDAAAIVVASDGWHPGVVGLVASRLKERQRKPAFAIA-FSADLGVGSGRSVPGVD 425

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +G +V  AVE GILVKGGGHAMAAG+T+ +        F +    +            +D
Sbjct: 426 LGAVVRAAVEAGILVKGGGHAMAAGITIAKDRLEDFRGFLESKLADKRTEGGDAHALLVD 485

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET 540
             + A+     L+  LE AGPYGAGN  PVFA P H+L  +  V   HLQ+  ++ D  T
Sbjct: 486 AAVTAAGATATLVKSLERAGPYGAGNSEPVFALPAHRLMRVNEVGNGHLQLRAQAGDGST 545

Query: 541 LQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
           +  IAFR    PL + L  + G  +H+ G L ++ W G++R +LR++D +P  G
Sbjct: 546 IDGIAFRAAAQPLEKALRAAVGSSVHLAGALALDSWGGTERVRLRLIDLAPASG 599


>gi|117925055|ref|YP_865672.1| exonuclease RecJ [Magnetococcus sp. MC-1]
 gi|117608811|gb|ABK44266.1| exonuclease RecJ [Magnetococcus sp. MC-1]
          Length = 592

 Score =  421 bits (1083), Expect = e-115,   Method: Composition-based stats.
 Identities = 204/593 (34%), Positives = 315/593 (53%), Gaps = 17/593 (2%)

Query: 10  ECSISGFRWVSL-LGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRL 67
           + S++G  W       EG NR     Q   +   +A +L +R +      + FL P ++ 
Sbjct: 6   KSSLTGKLWTLRCQPDEGHNRV---VQALGLSHYLAPLLASRKLCGAGETRQFLAPRLKD 62

Query: 68  LMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYI 127
           L  DP  L D   A  R+ +A+   EKI +FGDYDVDGA S AL+MR+     V   +YI
Sbjct: 63  L-ADPYDLLDMRVAVERLAEALERGEKIAVFGDYDVDGATSSALLMRYFHELGVALRVYI 121

Query: 128 PDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSE 187
           P+R+ +GYGP+   M     EG  L+ITVDCG T+++ LQ A   G+ VI+ DHHQ + +
Sbjct: 122 PNRLTEGYGPSVGAMRTLAEEGVSLVITVDCGITAFEPLQEAKALGLAVIITDHHQAREQ 181

Query: 188 EIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV---PLNFDLLSLLDL 244
              A A++NPNR D+      L   GV F +++ + R+LR+            L  LLDL
Sbjct: 182 LPEALAVINPNRQDEPFPYKELAGVGVAFYLVMALNRLLRERGWFNKGRQEPVLKPLLDL 241

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS---SPITAENLGYMI 301
           VA+ TV DV  + GLNRA V  GL V   + NPGL AL++ V I      +T+ ++G+ +
Sbjct: 242 VAVGTVADVAGMRGLNRALVTTGLHVLSERSNPGLAALMQVVGIGEEVKELTSTHIGFQL 301

Query: 302 GPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQ 361
           GP +NAGGR+G+  LG +LL   D  +   +A  LD  N+ R+ +E  +L+QA  +V  +
Sbjct: 302 GPRLNAGGRLGQGALGYQLLSCHDQAQALPIAQTLDASNKERQEIERTLLKQAMDQVEAE 361

Query: 362 CDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFD 420
              I +  + VV G+ WH G++G++A+RL +K+ +P+  I+ + E G G GSGRSI G +
Sbjct: 362 NQPILRRGL-VVAGEGWHAGVIGIVASRLCDKYSKPALVIAIDAETGVGKGSGRSIPGIN 420

Query: 421 IGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           +   +        L   GGH +AAGLT++R       + F+        A    P   +D
Sbjct: 421 LLAAIEA--GAAHLEHFGGHKVAAGLTIQREKIPAFMEAFEDHLTRHYQASAFFPRLTVD 478

Query: 481 GVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFE-SQDSE 539
             L    ++ A+   ++S  P+G GNP P+F  P   L+ I+V+   HL M+    +  +
Sbjct: 479 AELPLDELDFAVARQIQSFSPFGPGNPEPIFILPRVSLRGIKVLKERHLAMSIVCPRTHQ 538

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            ++AI FR+   P+ + +         V G L +  WRG ++ +L++ D    
Sbjct: 539 QIEAIGFRMAPGPIVDAIQAGDVAVWDVAGKLTIETWRGREKMKLQLSDVRAA 591


>gi|51473709|ref|YP_067466.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia typhi
           str. Wilmington]
 gi|51460021|gb|AAU03984.1| single-stranded-DNA-specific exonuclease RecJ [Rickettsia typhi
           str. Wilmington]
          Length = 586

 Score =  421 bits (1083), Expect = e-115,   Method: Composition-based stats.
 Identities = 222/585 (37%), Positives = 333/585 (56%), Gaps = 14/585 (2%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           SI+G  W     +E I     + +   I D++AR++  R  ++   ++FL P I+ L+PD
Sbjct: 6   SINGKIWKQKQIKEDI--VTELCRSFKISDLLARIVSLRVNNLAEVENFLIPKIKNLLPD 63

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P  L D DKA  RIVQAI ++++I IF DYDVDGA S AL+   L   ++  ++Y+PDRI
Sbjct: 64  PFHLLDMDKAVDRIVQAIVHNQQICIFADYDVDGATSAALLKHLLRDLNIICDIYVPDRI 123

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYGP P  ++K  + G +L+ITVDCG+ ++DAL+YA +  +DVIVIDHH   +    A
Sbjct: 124 YEGYGPTPLAIQKIKDNGTELLITVDCGAMAHDALKYAKDVKLDVIVIDHHISTAILPDA 183

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSLLDLVALA 248
            A+VNPNR+D+ S   +L A GV FL    I   L++ N         +L+  LDLVAL 
Sbjct: 184 VAIVNPNRIDETSEYKYLAAVGVTFLFATAILSNLKKRNYFSQSIPTPNLMQYLDLVALG 243

Query: 249 TVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAG 308
           TVCD++ L GLNRA+V  GL V +++ N G+K L +   I+      +LG+++GP INAG
Sbjct: 244 TVCDMMKLTGLNRAFVATGLKVMQQRQNIGIKTLYDIAGINEIPQCYHLGFILGPRINAG 303

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+G+SNLG+ LL +    E   LA +L+  N  R+++E  M+++A    LTQ    + +
Sbjct: 304 GRVGKSNLGANLLATSCHNEASKLANELEKYNNERKVIELLMIDEAIDIALTQ----KDS 359

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
           S++ V  + WHPG++G++A RLKEKF +P   ++   +G G  S RSI G D    +  A
Sbjct: 360 SLLFVVKEGWHPGVIGIVAGRLKEKFDKPVAVVA-LNNGIGKASCRSILGIDFSAEIINA 418

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
             + +++ GGGHAMAAG TV       L DF        +  L      + D  L  ++V
Sbjct: 419 KSKDLIIAGGGHAMAAGFTVTAGKLEELQDFLNNAFSISINKLANYKHAEYDIDLTVNSV 478

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQ----DSETLQAI 544
           N  L++ L+   P+G+GN  P+F F +  +    +V   H++           ++ L AI
Sbjct: 479 NFYLMEELKILEPFGSGNHEPIFKFDDLFILKADIVGSKHIKCMLAPDKRGFGNKVLSAI 538

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           AF   GTP  + L+ SR K +   G L  N W+ +   QL + D 
Sbjct: 539 AFDAVGTPFEDILLSSRAKHISAIGTLKTNNWKDNYTIQLIIKDL 583


>gi|91215420|ref|ZP_01252391.1| single-stranded-DNA-specific exonuclease RecJ [Psychroflexus
           torquis ATCC 700755]
 gi|91186372|gb|EAS72744.1| single-stranded-DNA-specific exonuclease RecJ [Psychroflexus
           torquis ATCC 700755]
          Length = 564

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 158/578 (27%), Positives = 276/578 (47%), Gaps = 22/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW     +  I +A  + +   +   +A +L+ R V + + AK F  PS+  L  DP ++
Sbjct: 2   RWTV-TQEADIQKAEHLQKAIGVSLPIAELLIKRGVETFEKAKTFFRPSLDDLH-DPFLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              +KA   I++ + +++ +M+FGDYDVDG  SVALM  +L     +   YIPDR  +GY
Sbjct: 60  KGMEKATSHILETLESNKPVMVFGDYDVDGTTSVALMTTYLKKLGFDVVSYIPDRYDEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++    +G  LII +DCG  + D + YA + G++ I+ DHH+  +    A A++
Sbjct: 120 GISYQGIDYAKAQGIDLIIALDCGIKAIDKIDYAKSIGVNFIICDHHRPGASIPDAIAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P + D       LC  GV F ++  +   L +         + + LDLVA A   D+VP
Sbjct: 180 DPKQTDCHYPFDELCGCGVGFKLVQALQAKLDR-----PQQQIYTYLDLVATAIGSDIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL +   +  P  KA++E       +T  ++ +MIGP INA GR+    
Sbjct: 235 ITGENRVLAHFGLKLINSRRRPAFKAILENTK-KRELTITDVVFMIGPRINAAGRMKHGL 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
           L + LL   + +++++LA  +++ N +R+  + ++ ++A   +  Q    +  S  VV  
Sbjct: 294 LATELLCETNYEKVKVLAKDIELYNSSRKETDKSITKEALDMIKEQ--KEEGRSTTVVYQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
             WH G++G++A+RL E + RP+   +   + K   S RS++GFD+   +        + 
Sbjct: 352 PHWHKGVIGIVASRLTETYYRPTLVFTKSGE-KLAASARSVKGFDVYDALES--SSEFIE 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+E  +F      F+    + +   +  P    D  +    +   LI +
Sbjct: 409 QFGGHKYAAGLTLEEKHFENFKRKFEDVVKSTIDPELLIPEILYDSEITFKDITPKLIRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQS-IRVVNLA--HLQMTFESQDSETLQAIAFRVYGTP 552
           L+   P+G  N  P F   N      ++ +     HL+    +Q      AI F +    
Sbjct: 469 LKQFAPFGPRNMTPTFVSRNVSTTGFVKTLGEDGLHLKTNL-TQSETVFTAIGFGLGDKK 527

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                +  + ++  +   +  N W G+   QL + D  
Sbjct: 528 N----LMKKDEKFDIVYTIEENEWDGNITLQLNLKDIK 561


>gi|282877609|ref|ZP_06286424.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella buccalis
           ATCC 35310]
 gi|281300181|gb|EFA92535.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella buccalis
           ATCC 35310]
          Length = 578

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 172/585 (29%), Positives = 286/585 (48%), Gaps = 22/585 (3%)

Query: 16  FRWVS-LLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W       E    A  + +K  I  ++A++L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWNYVPPTSEETKAANELGEKLNISPLLAQLLIRRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+   E+IM++GDYDVDG  +VAL+ +FL     N + YIPDR  +
Sbjct: 62  LMKDMDLAVDRLNDAMGRKERIMVYGDYDVDGCTAVALVYKFLQQFYSNIDYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G +LII +DCG  + D + YA + GID I+ DHH       PA A
Sbjct: 122 GYGVSKKGIDHAQETGVKLIIILDCGIKAIDEIAYAKSLGIDFIICDHHVPDEVMPPAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD     HL   GV F  +    +     N       L+ LLD  A++   D+
Sbjct: 182 ILNPKRPDDSYPFKHLSGCGVGFKFMQAFAK-----NNSIPFSRLIPLLDFCAVSISADI 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP+   NR     GL    +  + GLKA+I+  N++   I+  ++ + IGP INA GR+ 
Sbjct: 237 VPVTDENRILAFHGLKQLNQNPSVGLKAIIDICNLNGRDISMSDIVFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  D       A  +D  N+ R+ ++  M E+A   ++ + +  +  S IV
Sbjct: 297 NGKESVDLLVEKDFASALRQAKHIDEYNEQRKDIDKQMTEEA-NLIVAKLESQKHHSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  ++ + +    GS RS+ GFD+   +       
Sbjct: 356 LYDENWKKGVIGIVASRLTEIYFRPTVVLTRDGE-FATGSARSVTGFDVYSAIKSC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +LV  GGH  AAGLT+   +  +  + FQK+    +    T P+  ID +++   +   L
Sbjct: 413 LLVNFGGHTYAAGLTLRWDDIKKFRERFQKYVDLHIEPEQTEPILDIDAIIDFKDITKRL 472

Query: 493 IDMLESAGPYGAGNPNPVFA-FPNHKLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
              L+   P+G GN  P+F         + +VV     H+++     + S  +  IAF  
Sbjct: 473 HADLKKFSPFGPGNSKPLFGTLGVFDYGTSKVVGREQEHIKLELVDSKSSNIVNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
             +    ++   RG    +   L  N ++     QL++ D  P+E
Sbjct: 533 SAS--ARYIKSKRG--FDIAYTLEDNVFK-RNAVQLQIEDIRPIE 572


>gi|167462059|ref|ZP_02327148.1| YrvE [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 813

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 185/595 (31%), Positives = 290/595 (48%), Gaps = 30/595 (5%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDP 72
           S  RW    G    +    + + H +  + AR+L  R ++  + A+ FL+ S +    DP
Sbjct: 4   SKARWQ--TGCAESSVVQKLAEAHHLDTLTARLLALRGITTPEAAESFLH-SRQDGFHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D  KA  RI  A+ + E I I+GDYD DG  S +L+M  L       + YIP R+ 
Sbjct: 61  FLMKDMKKAVDRIRLAVEHKEFIRIYGDYDADGVTSTSLVMFLLRKIKARFDYYIPHRVR 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG N   +EK   +G  LIITVD G ++ + + Y    G+DVIV DHH+         
Sbjct: 121 EGYGLNRQAVEKAAEDGVDLIITVDTGVSAVEQVTYIQELGMDVIVTDHHEPPDISPQPL 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           ALVNP + D      HL   GV F +   +   + +            LL+LVA+ TV D
Sbjct: 181 ALVNPKQADCPYPFKHLAGVGVAFKLAHALLDRVPE-----------ELLELVAIGTVAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRI 311
           ++P  G NR  V  GL   ++   PG++AL++   I    +T+ +LG+ +GP +NA GR+
Sbjct: 230 LMPFHGENRTIVKMGLKRMQQSAFPGIRALLKIAGIESQQVTSTHLGFAVGPRLNASGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
           G +N    LLI+ DS     LA  LD LNQ R+ +   + E+A A    Q         +
Sbjct: 290 GSANNSVELLITGDSGRANELAQLLDELNQERQRIVREINEEALAIAAEQVQKGNT--FL 347

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVE 430
           VV    W+ G++G++A+++ E + RP+   S   E G   GS RSIE FD+ + ++   E
Sbjct: 348 VVAKPDWNEGVIGIVASKIVETYYRPTIVFSMNDESGLAKGSARSIESFDMYENLTACRE 407

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             +L   GGH  AAG+T+++ +   L       A  ++      PV + D   +   V +
Sbjct: 408 --LLEHFGGHRSAAGMTIKQEHIDALHRQLDHQAKALLGPDDLVPVIRADAACHLKDVPL 465

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSET---LQAIA 545
             I+ L+   P+GA NP+P F   N +L  +R++     H+++       E+   ++A+ 
Sbjct: 466 GWIEQLQKLEPFGASNPSPQFIVENLRLTDLRLLGRDKKHMKLVLSESQGESTVQIEALG 525

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           F           + S   R+ V G L +N W G +R QL + D    E   F  +
Sbjct: 526 FGKAHLS----ELISPTARLDVLGELGINEWNGIRRPQLTLKDLRITEIQLFDWR 576


>gi|325570352|ref|ZP_08146167.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus ATCC 12755]
 gi|325156680|gb|EGC68856.1| single-stranded-DNA-specific exonuclease RecJ [Enterococcus
           casseliflavus ATCC 12755]
          Length = 766

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 183/591 (30%), Positives = 288/591 (48%), Gaps = 31/591 (5%)

Query: 15  GFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPL 73
            F WV     E       + Q   IP+ +  +L  RN+ + +    FL+  ++ L  DP 
Sbjct: 5   NFHWVLPQDSEATPVFKELIQARKIPERIGALLWQRNIRTAEALDAFLSTDLQYLH-DPF 63

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +  D DKA  RI +AI N E+I+I+GDYD DG  S  ++   L      A  Y+P+R  D
Sbjct: 64  LFHDMDKAVERIHEAILNGERILIYGDYDADGITSTTVLKETLELLGAEAEYYLPNRFSD 123

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYGPN ++ +  I  G QLIITVD G + ++A+ YA  QG+DVIV DHH++ +E   A+A
Sbjct: 124 GYGPNITVYKDKIAAGTQLIITVDNGVSGHEAIAYAQGQGVDVIVTDHHELPAELPEAFA 183

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +V+P   +     G L   GV F V   +   +            + LLDLVA+ T+ D+
Sbjct: 184 IVHPRHPEGNYPFGDLAGVGVAFKVACALLEEVP-----------VELLDLVAIGTIADM 232

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIG 312
           V L   NR  V  GL + ++    GL  L+         +   ++G+ +GP +NA GR+ 
Sbjct: 233 VSLTDENRLLVSNGLKMIQQTDRLGLNELLTVSGLKKRTVNETDIGFAVGPRLNAIGRLE 292

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           + N   RLL + D +E   LA  LD +NQ R+     ++++A+ K+           V +
Sbjct: 293 DPNPAVRLLTTFDEEEAVTLAKTLDTINQQRKTFVEEIMKEAQEKI------DPANHVHL 346

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           V GD WH G++G++A R+ +  G+P   ++ +E+G   GSGRS+   ++      A  + 
Sbjct: 347 VVGDNWHEGVLGIVAGRIMQSTGQPVIVLTKKENGLAKGSGRSVAALNL--FEMLATMKD 404

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +    GGH  A GL++   +   L     ++       L       ID  L  + V+I  
Sbjct: 405 MFTSFGGHHAAVGLSIPIDHLDMLQAQMNRYVEENGIDLSQGIPLAIDEELPLAEVSINF 464

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYG 550
           I+ L    P+G  NP P F F N   Q+ R +     HL++    + +  L  I F    
Sbjct: 465 IESLNVLAPFGTDNPLPKFLFSNLSTQNARQIGTENQHLKLVMTDESNLQLDVIGFG--- 521

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG-HHFAKK 600
              G+  ++    R+ + G L +N W G+K+ QL + D + VEG   F  +
Sbjct: 522 --FGKDSVEFENDRLSIVGQLSINEWNGNKKPQLMLDDFA-VEGLQLFDYR 569


>gi|261418404|ref|YP_003252086.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y412MC61]
 gi|319767637|ref|YP_004133138.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y412MC52]
 gi|261374861|gb|ACX77604.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y412MC61]
 gi|317112503|gb|ADU94995.1| single-stranded-DNA-specific exonuclease RecJ [Geobacillus sp.
           Y412MC52]
          Length = 788

 Score =  421 bits (1082), Expect = e-115,   Method: Composition-based stats.
 Identities = 180/589 (30%), Positives = 287/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E       + ++  +  ++AR+LV R V +   A  FLNP +     DP +L
Sbjct: 7   RWEVERLDE--QAVRRLAEEAGVTPLLARLLVRRGVRTASEAVAFLNP-LEQPFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              ++A +R+ +AI   E+++++GDYD DG  S ++M+  L     +   YIP+R  +GY
Sbjct: 64  DGMERAIQRLKRAIDAGERVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN +        G  +I+TVD G  +   +  A   G+DVIV DHH+       A+A++
Sbjct: 124 GPNMAAFRSAKERGVSVIVTVDNGIAAVKEIAAANEWGMDVIVTDHHEPGPVLPEAHAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P +         L   GV F V   +   +              LLDLVA+ T+ D+VP
Sbjct: 184 HPKQPGSTYPFRDLAGVGVAFKVAHALLGRVP-----------RHLLDLVAIGTIADLVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGES 314
           L+G NR +V  GL   R     GL+AL  +  I  + I  + +G++I P +NA GR+G +
Sbjct: 233 LVGENRLFVAHGLEALRATERIGLRALFRQCRIDAAAINEQTVGFVIAPRLNAAGRLGGA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +    LL++DD  E   LA ++D LN+ R+ + + + E+A   V  Q    +   V+VV 
Sbjct: 293 DPAVALLMTDDENEAVQLAAEMDELNRERQQLVAQIAEEAADMVRRQFPPEEHR-VLVVA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
           G+ W+ G+VG++A++L E+F RP+  +S   E G   GS RSI GFD+    S +    +
Sbjct: 352 GEGWNAGVVGIVASKLVEQFYRPAVVLSIDREKGIAKGSARSIHGFDL--FASLSQCRDL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L       A   +     TP   ID   + + + ++  
Sbjct: 410 LPHFGGHPMAAGMTLALDDVEELRQRLNAIAAETLSEDDFTPPTFIDASCSIAELTLSAA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
             LE   P+G GNP P+       ++++R V     H++  F SQD   + AI F +   
Sbjct: 470 RGLERFAPFGVGNPRPLVLIEGASVETMRRVGANGAHMKAVF-SQDGAAIDAIGFGLG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   +   R+   G L VN W G  + QL + D +  +   F  +
Sbjct: 527 --PLCEEIAPDARISAVGELSVNEWNGFAKPQLSLCDLAVSDCQLFDVR 573


>gi|260591573|ref|ZP_05857031.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella veroralis
           F0319]
 gi|260536482|gb|EEX19099.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella veroralis
           F0319]
          Length = 573

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 161/585 (27%), Positives = 278/585 (47%), Gaps = 22/585 (3%)

Query: 16  FRWVS-LLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W       E  N A  +  K  +   +A +L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWNYTPPTTEQSNAAKELGDKLGMSPTLASLLIRRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+ + E+I+++GDYDVDG  +VAL+ +FL     N + YIPDR  +
Sbjct: 62  LMKDMDAAVDRLNDAMGHKERILVYGDYDVDGCTAVALVYKFLRQFYSNIDYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G +LII +DCG  + + + YA   GID I+ DHH       PA A
Sbjct: 122 GYGVSKKGIDYAAETGVKLIIILDCGIKAIEEITYAKQLGIDFIICDHHVPDETMPPAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD      LC  GV F  +    +     N       L+ LLD  A++   D+
Sbjct: 182 ILNPKRPDDSYPFKSLCGCGVGFKFMQAFAK-----NNNIPFSRLVPLLDFCAVSIAADL 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP+I  NR     GL    +  + GLKA+I+   ++   ++  ++ + IGP INA GR+ 
Sbjct: 237 VPVIDENRILAFHGLKQLNQNPSLGLKAIIDICGLNGRELSMSDIIFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  +       A  +D  N+ R+ ++  M E+A  +++ + +  +  S IV
Sbjct: 297 NGKKSVDLLVEREYSLALNQAKHIDEYNEQRKDVDRQMTEEA-NQIVARLESQKHQSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  ++  ++    GS RS+ GFD+   +       
Sbjct: 356 LYDEHWKKGVIGIVASRLTEIYFRPTVVLT-RDENLATGSARSVAGFDVYAAIKSC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L+  GGH  AAGLT++  +       FQ +    +       +  ID V++   +   L
Sbjct: 413 LLLNFGGHTYAAGLTMKWSDVKEFRKRFQAYVEEHIEPEQREAILDIDAVIDFKDITKKL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
              L+   P+G  NP P+F   +     + +VV     H+++     + +  +  IAF  
Sbjct: 473 HSDLKRFAPFGPANPKPIFCTLDVYDFGTSKVVGREQEHIKLELVDSKSNNVMNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
             +           +   +   +  N ++     QL++ D  P E
Sbjct: 533 SAS----ARYIKSKRSFDIAYTIEDNVFK-RGAVQLQIEDIRPTE 572


>gi|261880324|ref|ZP_06006751.1| recombination protein J [Prevotella bergensis DSM 17361]
 gi|270333014|gb|EFA43800.1| recombination protein J [Prevotella bergensis DSM 17361]
          Length = 584

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 168/587 (28%), Positives = 280/587 (47%), Gaps = 22/587 (3%)

Query: 16  FRWVS-LLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W         I +A  + +K  I  I+A +L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWKYDPPTSNNIQQAKELGEKLNINPILAGLLIKRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+   E+IM++GDYDVDG  +VAL+ +FL     N   YIP R  +
Sbjct: 62  LMKDMDVAVDRLNDAMGRKERIMVYGDYDVDGCTAVALVYKFLQQFYSNIEYYIPSRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++       +LII +DCG  + + + YA + GID I+ DHH    E  PA A
Sbjct: 122 GYGVSKKGIDYAKENDVKLIIILDCGIKAIEEIGYAKSIGIDFIICDHHVPDEEIPPAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD      L   GV F  +    +     N       L+ LLD  A++   D+
Sbjct: 182 ILNPKRTDDTYPFKQLSGCGVGFKFMQAFAK-----NNGIPFSRLIPLLDFCAVSIAADL 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP++  NR     GL    +  + GLK++I+   +S   I+  ++ + IGP INA GR+ 
Sbjct: 237 VPVVDENRILAFHGLKQLNQNPSVGLKSIIDICGLSGREISMSDIIFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  D       A ++D  N+ R+ ++  M E+A  +++ + +  +  S IV
Sbjct: 297 NGKESVELLVEKDFSMALEEARRIDEYNEQRKDIDKQMTEEA-NQIVAKLESQEHHSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G+VG++A+RL E + RP+  ++  +     GS RS+ GFDI   +       
Sbjct: 356 LYDEHWKKGVVGIVASRLTEMYFRPTVVLT-RDGDFATGSARSVMGFDIYSAIKHC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           IL+  GGH  AAGLT++  +    C+ F  +    +    T     ID  ++   ++  L
Sbjct: 413 ILINFGGHTYAAGLTLKWEDIHEFCNRFHNYVEEHIEPEQTEAYLDIDAEIDFKDISKRL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFESQDSET-LQAIAFRV 548
            + L+   P+G GN  PVF         + +VV     H+++     +S T +  IAF  
Sbjct: 473 HNDLKRFSPFGPGNTKPVFCTKGVYDYGTSKVVGRFQEHIKLELVDSNSSTVVNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
             +           +   +   +  N ++   + QL++ D  P E  
Sbjct: 533 SAS----ARYIKSKRSFDIAYTIENNVFK-RNQVQLQIEDIRPAESE 574


>gi|218439815|ref|YP_002378144.1| single-stranded-DNA-specific exonuclease RecJ [Cyanothece sp. PCC
           7424]
 gi|218172543|gb|ACK71276.1| single-stranded-DNA-specific exonuclease RecJ [Cyanothece sp. PCC
           7424]
          Length = 654

 Score =  420 bits (1080), Expect = e-115,   Method: Composition-based stats.
 Identities = 166/583 (28%), Positives = 283/583 (48%), Gaps = 20/583 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPD 71
           +   RW+       I     + Q   +  ++A+VLVNR ++    A+ +L P    L+P 
Sbjct: 3   LPNQRWIISSPDPKI--VEQLVQTTGLLPLMAQVLVNREINTPELAQVYLEPE-SQLLPQ 59

Query: 72  P-LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
           P     D   +   +  AI + +KI+I GDYD DG  S AL++R L H   + +  IP R
Sbjct: 60  PLEEFPDLGVSVELLQDAIASQDKIVICGDYDADGMTSTALLLRALKHLGADVDYAIPSR 119

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           + +GYG N  ++E   + G  LI+TVD G ++Y+ +  A + G+ VI+ DHH +  +  P
Sbjct: 120 MKEGYGINTRIVEDCASSGVGLILTVDNGISAYEPIARAIDLGLSVIITDHHDLPEKLPP 179

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
           A A++NP  L + S    L   GV +++ V   + L     +        LL+L  L T+
Sbjct: 180 ADAILNPKLLPESSPYRGLAGVGVAYILAVTTAQNLGLLKGLT-----DQLLELFTLGTI 234

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN---ISSPITAENLGYMIGPSINA 307
            D+ PL+G+NR ++ +GL    +    G++ALI+          +  +++G+ +GP INA
Sbjct: 235 ADLAPLVGVNRRWLKRGLRKLPKSQLAGIQALIQMAGVSEEQKQLQPDDIGFKLGPRINA 294

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRIG+  L   LL +D+       AM+ + +NQ R+ +   + E+A   + T   + QQ
Sbjct: 295 IGRIGDPQLVIELLTTDEEGLALERAMQCEQINQKRQQLCKKIEEEAINLIETLPVNWQQ 354

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
             V+V+    WH G++G++A+RL E++G P F  ++EE+      G +    +     + 
Sbjct: 355 DRVLVIVQPHWHHGVIGIVASRLVERYGAPVFIGTYEEEEPEKIRGSARGIEEFHVFEAL 414

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
              + +L K GGH  A G ++   N     +   +FAH  +      P+ KID   +   
Sbjct: 415 EFCDDLLGKYGGHKAAGGFSLPIQNLEAFKERLSRFAHQCLKPEYLKPLIKIDAQTDFKQ 474

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
           +   L   +++  P+G GN  PVF   N KL   R+V   HL++    +D   ++AIA+R
Sbjct: 475 LTPYLYQQIDNLQPWGIGNDFPVFWTANVKLIEQRIVGQKHLKLVLAQEDGTEIKAIAWR 534

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                            + +   L  N+W G+   +L ++   
Sbjct: 535 WADYF-------PLPTCLDIAYKLKENHWNGNTTIELEIIGIR 570


>gi|189425065|ref|YP_001952242.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter lovleyi
           SZ]
 gi|189421324|gb|ACD95722.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter lovleyi
           SZ]
          Length = 586

 Score =  420 bits (1080), Expect = e-115,   Method: Composition-based stats.
 Identities = 174/601 (28%), Positives = 293/601 (48%), Gaps = 17/601 (2%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKD 59
           M   A  G+  S    +W+    Q       A++    +  + A +L +R ++  +    
Sbjct: 1   MKSPASRGISVSTMHKQWILK--QTDPATVAALSAATGLSAVTASILSSRGLTEPEQVAS 58

Query: 60  FLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHC 119
           FL+P++  ++ DP ++   ++A  R+V A    E + I+GDYDVDG ++ AL++  L   
Sbjct: 59  FLSPTLAAML-DPFLMAGMEQAVVRLVAARAAKETVCIYGDYDVDGISATALLVSGLRAM 117

Query: 120 SVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVI 179
            +N   +IP+R+ DGYG N   +      G +L I+VDCG T+ +      + G+D+I+ 
Sbjct: 118 GLNVTYHIPNRMEDGYGLNGDALRLIKERGIELAISVDCGVTAIEEAILCRSIGLDLIIT 177

Query: 180 DHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN-FDL 238
           DHHQ   +   A A++NP+R D       L   GV F +LV +   LR       N  DL
Sbjct: 178 DHHQPLDQLPDAIAVINPHRRDCSYPFKGLAGVGVAFNLLVALRSRLRDQGAFGDNGPDL 237

Query: 239 LSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLG 298
              LDLVAL T+ D+VPL+  NR     GL         GL AL +   I   +++  +G
Sbjct: 238 RQWLDLVALGTIADLVPLVEQNRLLTSAGLQRMGDGCRIGLAALKQVAGIKGEVSSGQVG 297

Query: 299 YMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKV 358
           + + P +NA GR+  +  G  LL+++D Q+   L+ +LD  N  RR +E  + ++A A++
Sbjct: 298 FQLAPRLNAVGRLESAVPGVELLLTEDPQQAAALSAELDGANLERRQVERRIFDEAIAQI 357

Query: 359 LTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEG 418
             Q   +Q  + IV+    WH G+VG++A+RL E++ RP+  ++  +D  G GSGRSI G
Sbjct: 358 EAQG-GLQDRNSIVLSSPDWHQGVVGIVASRLVERYYRPTLLVAERDDASGKGSGRSISG 416

Query: 419 FDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFK 478
           F + + +        L + GGH  AAG+TVE        D F++ A   +      P   
Sbjct: 417 FHLLEALHEC--ADFLQRYGGHRAAAGVTVEPGQMAAFADAFEQAALTRLGDQELIPELV 474

Query: 479 IDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS 538
           +D  +    +  AL+  L+  GP+G GN  PV      ++   R     HL +  + +D 
Sbjct: 475 LDVEVAPRDLTSALVAELQRLGPFGMGNTTPVLLLRQMQVLDCRCFGEGHLNLRLQ-RDG 533

Query: 539 ETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFA 598
              +A+ + +    +           + +   + +  W G ++ +L + D    E +H A
Sbjct: 534 LQFKALGWGMAERTVPAL--------VDLACTVKLETWNGREQLRLELKDFRTSEDYHAA 585

Query: 599 K 599
           +
Sbjct: 586 Q 586


>gi|189184334|ref|YP_001938119.1| single-stranded-DNA-specific exonuclease [Orientia tsutsugamushi
           str. Ikeda]
 gi|189181105|dbj|BAG40885.1| single-stranded-DNA-specific exonuclease [Orientia tsutsugamushi
           str. Ikeda]
          Length = 587

 Score =  420 bits (1080), Expect = e-115,   Method: Composition-based stats.
 Identities = 230/586 (39%), Positives = 335/586 (57%), Gaps = 14/586 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           E S+ G  W      E I     I QKH + D +A++L  +N+ ++    FL P+I+  +
Sbjct: 6   EQSVLGNYWNKTEFDEYI--IETIRQKHGVSDFLAKLLYAQNIDLEQISYFLTPTIKEAL 63

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D DKA  R++ AI   E I IFGDYDVDGA S AL+  +     +   +YIP+
Sbjct: 64  PDPFHLLDMDKAVNRVIHAINQQEHICIFGDYDVDGATSSALLKNYFCELGIEPIIYIPE 123

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R+ +GYGP+ S ++K  + G  LIITVDCG+++Y+AL  A  Q IDVIVIDHH    +  
Sbjct: 124 RLTEGYGPSVSAIKKLKSAGISLIITVDCGTSAYEALAEAKAQHIDVIVIDHHLSVEQLP 183

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLDLVAL 247
            A A++NPNRLD+ S   +L A GV FL LV +   LR+ N         L+  LDLVAL
Sbjct: 184 DAVAIINPNRLDETSKYNYLAAVGVSFLFLVALRSALRKLNYFADKSEPSLVKYLDLVAL 243

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCDV+ LIGLNRA+V KGL +  +  N G+KAL              LG+++GP INA
Sbjct: 244 GTVCDVMALIGLNRAFVTKGLEIMAQHQNVGIKALGYLSEAEFSSDCYYLGFVLGPRINA 303

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGRIG+S+LGS+LL +    E   +A +L+  N  R+L+E  MLE+A      Q      
Sbjct: 304 GGRIGKSDLGSKLLSTKCQIEAYNIASELENYNSERKLIEKVMLEEAVTIAREQA----D 359

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
            +VIVV   +WHPG++G++A+RLK+ F +P   IS ++   G  S RSI+G DIG  ++ 
Sbjct: 360 NNVIVVANHKWHPGVIGIIASRLKDLFHKPIVVISLDDT-LGRASCRSIKGIDIGSKIAE 418

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           A  +G+L+ GGGHAMAAG T++R   G L +F  +     +  L    +      L+ ++
Sbjct: 419 AKLKGLLITGGGHAMAAGFTIKRDLIGDLKNFLNQELALDMKNLTGHNIRNYAIDLSIAS 478

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS----ETLQA 543
           +NI  +  ++   P+G GNP P+F   N KL+    ++  H+       ++    +T +A
Sbjct: 479 LNINTVHEIQKLAPFGNGNPEPIFKLTNIKLKYASQLSNKHVHCVLSEWENINAVKTTKA 538

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           IAF    T L + L+ +  K + + G++ VN WRG +  Q  ++D 
Sbjct: 539 IAFN-PRTQLFDALLSTYTKPIDLIGNIKVNRWRGREEIQFVIMDL 583


>gi|296132723|ref|YP_003639970.1| single-stranded-DNA-specific exonuclease RecJ [Thermincola sp. JR]
 gi|296031301|gb|ADG82069.1| single-stranded-DNA-specific exonuclease RecJ [Thermincola potens
           JR]
          Length = 1233

 Score =  420 bits (1079), Expect = e-115,   Method: Composition-based stats.
 Identities = 174/579 (30%), Positives = 277/579 (47%), Gaps = 23/579 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
             W        I     + ++  I  I A++L NR + S++ A+ FL  S+  L  DPL 
Sbjct: 6   KIWSFHNNNTFIQEL--LARRLGISKITAQILANRGICSVEEARTFLFGSLEDLY-DPLQ 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           +   ++A +RI QAI  +++I+++GDYDVDG  S  L++  L       + YIP R+ +G
Sbjct: 63  MHGMEEAVQRIKQAIKENQRILVYGDYDVDGITSTVLLLDTLEFLGAACDFYIPHRLTEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N + ++    +G  L+ITVDCG +S D + +A + G+++I+ DHH+       AYA+
Sbjct: 123 YGLNINSLKTIKEQGFNLVITVDCGISSADEVSWARDNGLEIIITDHHEPPEHIPQAYAV 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP +         L   GV F +   + R   ++  VP       LLDLVAL TV D+V
Sbjct: 183 INPKQAWCTYPFKELAGVGVAFKLAQALLRAHEKEYLVP------KLLDLVALGTVADMV 236

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           PL+G NR    +GL +       GL ALIE        I +E + + + P +NA GRI  
Sbjct: 237 PLVGENRITTKQGLQLINAGHREGLAALIEVAGLADQSIDSEQIAFALAPRLNAVGRIDH 296

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           +  G RLL   + +    +A  LD  N+ R+ +E+ +  +A   +  + + +     +V+
Sbjct: 297 AAKGVRLLREKNREMAVSIAKALDRANKERQAIENLIFTEAVEII--ESNSLLDNKALVL 354

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WH GIVG++A++L  ++ RP   +S   +    GS RSI GF++   +     E  
Sbjct: 355 ARPDWHLGIVGIVASKLVNRYCRPVILLSVNGE-VAKGSARSIPGFNLFAALQSC--EAF 411

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L K GGH+ AAGLT+   +       F +     + A        IDG ++   V   L 
Sbjct: 412 LKKYGGHSQAAGLTLNVDDISAFTAAFNEIVDQQITAEHMAEALPIDGEISFKDVTFDLY 471

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + L +  P+G GNP P+FA     +   R V     HL+M   ++    ++AI F +   
Sbjct: 472 NQLVALEPFGFGNPTPLFACRQADIIDCRKVGSDGKHLKMKIMNE-KLLMEAIGFNLSAC 530

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                       ++ +   L  N W G    QL V    
Sbjct: 531 QNS----IDFADKIDIVFELKKNDWNGRSNLQLNVRAIK 565


>gi|289423185|ref|ZP_06425000.1| single-stranded-DNA-specific exonuclease RecJ [Peptostreptococcus
           anaerobius 653-L]
 gi|289156516|gb|EFD05166.1| single-stranded-DNA-specific exonuclease RecJ [Peptostreptococcus
           anaerobius 653-L]
          Length = 815

 Score =  420 bits (1079), Expect = e-115,   Method: Composition-based stats.
 Identities = 184/586 (31%), Positives = 306/586 (52%), Gaps = 23/586 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
             W+      G ++   +T+K  I D + ++L+NR + + +    +++P +  L  DP +
Sbjct: 2   KNWIVKSL--GRSKGNEVTKKFNINDNIGQILINRGIETEEQLDLYMHPDLTSLR-DPFL 58

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D D+A  RI +AI N+EKI IFGDYDVDG +S +++  +          YIP+R+ +G
Sbjct: 59  LKDMDRAVDRIKRAISNNEKICIFGDYDVDGVSSTSILCLYFESIGYQVEFYIPNRLEEG 118

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N   + +    G  LII+VDCG TS + ++ A   GIDVI+ DHH+ + +   AYA+
Sbjct: 119 YGLNDEAIRQIGQMGTDLIISVDCGITSVNEVETARKLGIDVIITDHHEPQEKLPQAYAV 178

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R D       +C  GV F ++  +              ++   L++VALAT+CDV+
Sbjct: 179 IDPKREDCRYPFKGICGCGVAFKLIHAL------SGDRDFYNNINRYLEIVALATICDVM 232

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI-SSPITAENLGYMIGPSINAGGRIGE 313
           P++  NR  V  GL +  R  N G++ L+   +I  + + + +LG+ IGP INA GR+G 
Sbjct: 233 PVLDENRIIVKNGLEIMGRGNNIGMRELLGVCSILDTKMKSSHLGFAIGPRINASGRLGF 292

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           S LG  L  S D Q+  +LA  +++ N+ R+++E+ +L +AEA +       Q+  VIV+
Sbjct: 293 SRLGVELFTSKDPQKARLLAESMNLKNEERQMVEAKILMEAEAMIDRDS-KYQEEKVIVL 351

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            G  WH GI+G++A++L EK+ +P+  +   EDG   GS RSI+GFD+ K +S    + +
Sbjct: 352 AGHGWHHGIIGIVASKLTEKYYKPTVLL-CIEDGVATGSARSIKGFDLFKAMSEC--KDL 408

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           ++K GGH  AAGLT+   N   L +     A   +          I+  L   A+++ L+
Sbjct: 409 MMKFGGHEQAAGLTMAEGNIQALRERINAIADYELKKEDLIENINIEFELEEDAISLDLV 468

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
             L    P+G  NP P F   ++K++   ++     HL+++ E +   T   I F +   
Sbjct: 469 KDLHILEPFGIKNPTPYFMVRDYKVKKAYLIGKDKNHLKLSIEKE--YTYDCIGFNMGHL 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHF 597
                   S   R+ +   L  N ++G    Q+ + D    +    
Sbjct: 527 ----MDKFSVDDRVDIVFQLDENTFKGRTTVQMLIKDIRLSKPDKI 568


>gi|167646973|ref|YP_001684636.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter sp. K31]
 gi|167349403|gb|ABZ72138.1| single-stranded-DNA-specific exonuclease RecJ [Caulobacter sp. K31]
          Length = 605

 Score =  420 bits (1079), Expect = e-115,   Method: Composition-based stats.
 Identities = 226/589 (38%), Positives = 338/589 (57%), Gaps = 8/589 (1%)

Query: 6   FLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSI 65
           FL V  S+SG  W    G   + R+    Q H + + +AR L +R V +D A+ +L P++
Sbjct: 14  FLDVSRSLSGRAWRERPGDAAVARSH--QQLHGLSEPLARALASRGVGVDDAEHYLRPTL 71

Query: 66  RLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANM 125
           + L PDP   TD D+AA  ++ A+ +    M+F DYDVDGA S A ++R+  +  V   +
Sbjct: 72  KALFPDPSSFTDMDRAAEILIDALESGRSTMVFADYDVDGATSAAQLVRWFRYMGVELPI 131

Query: 126 YIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVK 185
           YIPDR+ +GYGP+P+  +   + GA L++T+DCG+ +YDA+  A   G++V+VIDHH ++
Sbjct: 132 YIPDRLTEGYGPSPAAFKTIRDTGADLVVTLDCGAAAYDAIASAATIGLEVVVIDHHLMR 191

Query: 186 SEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP---LNFDLLSLL 242
            +   A A+VNPNR    SGQG L AAGV F++L  + R  R+           DL   L
Sbjct: 192 EDPPAAAAVVNPNRPGCQSGQGVLAAAGVTFVLLAALNREARRRGLFTDERPQPDLRQWL 251

Query: 243 DLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIG 302
           DLVA+  VCDV  L+G NRA    GL      GNPGLKAL E    S P +  + G+++G
Sbjct: 252 DLVAMGEVCDVTQLVGFNRALTTLGLRTMSSWGNPGLKALFEVGKGSGPASVFHAGFILG 311

Query: 303 PSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQC 362
           P INAGGRIG S+LG+RLL +DD +E  MLA +LD LN  R+ +E+ ++E+A A +    
Sbjct: 312 PRINAGGRIGRSDLGARLLSTDDPEEARMLAEELDGLNTERKAVEAGVVEEAAAVLERGS 371

Query: 363 DDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDI 421
           +    A VIVV G+ WHPG++G++A RL+E++ +P   I        G GSGRS  G ++
Sbjct: 372 NFNPDAPVIVVAGEGWHPGVIGIVAGRLRERYRKPVVVIGIDRAANVGKGSGRSQPGVNL 431

Query: 422 GKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDG 481
           G  +  A E G+L+ GGGHAMAAGL++   +      F ++     +   +      ID 
Sbjct: 432 GAAIQAAFEAGLLMAGGGHAMAAGLSIRPDSIPEFRAFLEERLAGEM-EAVGVEGVDIDA 490

Query: 482 VLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETL 541
           ++   A N AL    +   P+G GNP P+FA    + + +  +   H+++       + +
Sbjct: 491 LVQPRAANRALWTEFQQLAPFGPGNPEPMFALAGVRPERMMAMKGGHVRVDLVGPSGDRI 550

Query: 542 QAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           +AI++R   TPLG+ LM   G  +HV G L  + + G +  QL + DA+
Sbjct: 551 KAISWRSVETPLGQRLMAGGGA-LHVVGRLKPDDYMGREGVQLEIEDAA 598


>gi|226311467|ref|YP_002771361.1| hypothetical protein BBR47_18800 [Brevibacillus brevis NBRC 100599]
 gi|226094415|dbj|BAH42857.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 782

 Score =  420 bits (1079), Expect = e-115,   Method: Composition-based stats.
 Identities = 187/589 (31%), Positives = 285/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E    A +I     +  +V+++LV R +     A+DFL      L  DP +L
Sbjct: 7   RWKLATYDE--QLAASIAADCQLTPLVSKLLVIRGIDTSQKARDFLQAG-PELFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              +++  RI QAI   E I I+GDYD DG +S +LM+  L       + YIP+R  +GY
Sbjct: 64  DGMEQSVHRIQQAIQRQEPICIYGDYDADGVSSTSLMVHLLRQLGAVFDYYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   +      G +LIITVD G ++ + + YA   G+DVIV DHH+  +    A+A++
Sbjct: 124 GLHKDALAHLHQSGYKLIITVDTGISAVEQVAYANQLGLDVIVTDHHEPPAVIPEAFAVI 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP +         L   GV F V   + +              L L DL AL T+ D+VP
Sbjct: 184 NPKKPGCSYPFDMLAGVGVAFKVGHALLKE-----------PPLHLADLAALGTIADLVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGES 314
           L+  NR     GL       N GL+ALI       + ++A ++G+ +GP +NA GR+  +
Sbjct: 233 LVDENRILARAGLKRLNHTRNLGLQALIRVCGLADTELSAGHVGFALGPRLNASGRLETA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
               +LL + D  E E  A  LD LN+ R+ + +AM E+A   V       Q  +V+V+ 
Sbjct: 293 ESAVKLLTTSDMDEAEKCAQALDDLNRERQEIVAAMTEEAVQMVNELYPPDQN-NVLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+ G+VG++A+RL E F RP+  +    E G   GS RSI GFD+ + ++   E   
Sbjct: 352 KEGWNVGVVGIVASRLVELFYRPTIVLGIDPEKGTAKGSARSIAGFDMYEGLTACKEW-- 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   N   L     + A   + +   TP+ K+D  ++   +++   
Sbjct: 410 LPHYGGHTMAAGMTLPVENLDLLRQKLNELAGEWLSSEDFTPMTKVDVAMSMEEISLTAA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + LE   PYG GNP P+      + Q +R +     HL+ T  ++   +L AI F     
Sbjct: 470 EQLEQLAPYGMGNPTPLVLLEEVETQGMRTIGRDDNHLKCTL-NKAGTSLDAIGFNWAHV 528

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   +   R HV G L VN W G+++ QL + D S      F  +
Sbjct: 529 ----TKRVTPKARFHVLGELSVNEWNGNRKPQLTIRDLSVGHQQVFDWR 573


>gi|148284293|ref|YP_001248383.1| single-stranded-DNA-specific exonuclease [Orientia tsutsugamushi
           str. Boryong]
 gi|146739732|emb|CAM79563.1| single-stranded-DNA-specific exonuclease [Orientia tsutsugamushi
           str. Boryong]
          Length = 586

 Score =  419 bits (1078), Expect = e-115,   Method: Composition-based stats.
 Identities = 229/586 (39%), Positives = 334/586 (56%), Gaps = 14/586 (2%)

Query: 10  ECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLM 69
           E S+ G  W      E I     I QKH + D +A++L  +N+ ++    FL P+I+  +
Sbjct: 6   EKSVLGNYWNKTEFDEYI--IETIRQKHGVSDFLAKLLYAQNIDLEQISYFLTPTIKDAL 63

Query: 70  PDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPD 129
           PDP  L D DKA  R++ AI   E I IFGDYDVDGA S AL+  +     +   +YIP+
Sbjct: 64  PDPFHLLDMDKAVNRVIHAINQQEHICIFGDYDVDGATSSALLKNYFCELGIEPIIYIPE 123

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R+ +GYGP+ S ++K  + G  LIITVDCG+++Y+AL  A  Q IDVIVIDHH    +  
Sbjct: 124 RLTEGYGPSVSAIKKLKSAGISLIITVDCGTSAYEALAEAKAQHIDVIVIDHHLSVEQLP 183

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLDLVAL 247
            A A++NPNRLD+ S   +L A GV FL LV +   LR+ +         L+  LDLVAL
Sbjct: 184 DAVAIINPNRLDETSKYNYLAAVGVSFLFLVALRSALRKLHYFTDKSEPSLVKYLDLVAL 243

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCDV+ LIGLNRA+V KGL +  +  N G+KAL              LG+++GP INA
Sbjct: 244 GTVCDVMALIGLNRAFVAKGLEIMAQHQNVGIKALGYMSEAEFSSDCYYLGFVLGPRINA 303

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGRIG+S+LGS+LL +    E   +A +L+  N  R+L+E  MLE+A      Q      
Sbjct: 304 GGRIGKSDLGSKLLSTKCQIEAYNIASELENYNSERKLIEKVMLEEAVTIAREQA----D 359

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
            +VIVV   +WHPG++G++A+RLK+ F +P   IS ++   G  S RSI+G DIG  ++ 
Sbjct: 360 NNVIVVANHKWHPGVIGIIASRLKDLFHKPIVVISLDDT-LGRASCRSIKGIDIGSKIAE 418

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
           A  +G+L+ GGGHAMAAG T++R   G L +F  +     +  L    +      L+ ++
Sbjct: 419 AKLKGLLITGGGHAMAAGFTIKRDLIGDLKNFLNQELALDIKNLTGHNIRNYAIDLSIAS 478

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDS----ETLQA 543
           +NI  +  ++   P+G GNP P+F   N KL+    ++  H+        +    +T +A
Sbjct: 479 LNINTVHEIQKLAPFGNGNPEPIFKLTNIKLKYASQLSNKHVHCVLSEWGNINAVKTTKA 538

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
           IAF    T L + L+ +  K + + G++ VN WRG +  Q  ++D 
Sbjct: 539 IAFN-PRTQLFDALLSTYTKPIDIIGNIKVNRWRGREEIQFAIMDL 583


>gi|85859325|ref|YP_461527.1| single-stranded DNA-specific exonuclease [Syntrophus aciditrophicus
           SB]
 gi|85722416|gb|ABC77359.1| single-stranded DNA-specific exonuclease [Syntrophus aciditrophicus
           SB]
          Length = 586

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 176/577 (30%), Positives = 296/577 (51%), Gaps = 17/577 (2%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
            WV             + ++  I  I++ +L +R++ + D A+ +L PS+  L  +P ++
Sbjct: 18  NWVM--SDVNKEAQYLLVKELGIHWIMSSILASRDIQTPDDARKYLYPSLHDLH-NPFLM 74

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D      R++QA+Y  EKI+++GDYD DG  SVA++++FL     + + YIPDRI +GY
Sbjct: 75  KDMQLGVNRLIQAVYQGEKIVVYGDYDADGITSVAVLVKFLRDIQADVSYYIPDRIDEGY 134

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   +++   + A LIITVDCG +  D + YA + G+D I++DHH+V      A A +
Sbjct: 135 GLNRKAIDRIKEKSASLIITVDCGISDCDEILYARSLGLDTIILDHHEVSDSLPTAVASI 194

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKV--PLNFDLLSLLDLVALATVCDV 253
           NP R D      HL A G+VF  L+ +   LR++         +L   LDLVAL T+ D+
Sbjct: 195 NPKRPDCPFPLKHLAAVGIVFNFLIALRGNLRKEGFWHGKPYPNLKEYLDLVALGTIGDI 254

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIG 312
            P++  NR +V  GL +       G++AL E   + +  +  E   + + P INA GR+G
Sbjct: 255 CPMVDENRIFVRVGLELLTEGKRVGIRALKEICGVDTQAVDTEKASFSLIPRINAAGRVG 314

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
             +    LL++DD  +   LA+KLD  N+ RR +E  +LE+    +     D  + ++ V
Sbjct: 315 LPDDAVELLLADDMGKARDLAVKLDSYNRRRRALEKNILEEIIEDLEKTISDRNRTAL-V 373

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  ++WHPG++G++A+++ +++ RP+  IS ++ G G GSGRSI  F+I + +     E 
Sbjct: 374 MASEKWHPGVIGIVASKIADRYDRPAILISLKD-GIGKGSGRSIANFNIYQGLREC--ED 430

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
            L+  GGH  AAG+++   +  +  +   +     V          I+   + + +   L
Sbjct: 431 YLISYGGHRYAAGISIMEEDIEQFAETLDEIVRENVLQSDFISATFIEAQCHLNDITHEL 490

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
           +  +E   P+G+ NP PV    N    S  VV   HL+M   S+   +   I F      
Sbjct: 491 LAQMELLAPFGSKNPEPVLCVRNVNAFSPAVVGNNHLRMRV-SEAGVSRNTIWFSQ---- 545

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
            G F+ +     + +     +N W G+   QL++ D 
Sbjct: 546 -GHFIRELNDSCLDIAFTPQINTWNGASDIQLKMKDI 581


>gi|300728171|ref|ZP_07061542.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella bryantii
           B14]
 gi|299774597|gb|EFI71218.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella bryantii
           B14]
          Length = 573

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 170/585 (29%), Positives = 282/585 (48%), Gaps = 22/585 (3%)

Query: 16  FRWVSL-LGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W       E    A A+ +K  +  I+A++L+ R +S +  AK F  P +  L+ +P 
Sbjct: 3   FKWKYTTPTSEQDEAAKALGEKLNMSTILAQLLIRRGISTESAAKRFFRPQLGDLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+   E+I+++GDYDVDG  +VAL+ +FL     N   YIPDR  +
Sbjct: 62  LMKDMDVAVDRLNDAMGRKERILVYGDYDVDGCTAVALVYKFLQQFYSNIEYYIPDRYNE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G +LII +DCG  + + + YA + GID I+ DHH        A A
Sbjct: 122 GYGVSKQGIDYAYENGVKLIIILDCGIKAIEEIAYAKSLGIDFIICDHHVPDDVMPEAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD     HLC  GV F  +    +     N       L+ LLD  A+A   D+
Sbjct: 182 ILNPKRTDDSFPFKHLCGCGVGFKFMQGWAK-----NNGIPFSQLIPLLDFCAVAIAADI 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP++  NR     GL    +  + GLKA+I+   ++   IT  ++ + IGP INA GR+ 
Sbjct: 237 VPVVDENRILAFHGLKQLNQNPSVGLKAIIDICGLNGRNITMSDIIFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  D      +A  ++  N+ R+ ++  M E+A  +++ + +  +  S IV
Sbjct: 297 NGKESVDLLVEKDFSSAIQMAKHINEYNEQRKDIDKQMTEEA-NQIVGRLESQKHQSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  I+   +    GS RS+ GFDI   +       
Sbjct: 356 LYDENWKKGVIGIVASRLTEIYFRPTVVITKFGE-FATGSARSVTGFDIYSAIKSC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L+  GGH  AAGLT++  +       FQ++  + +          ID VL+   +   L
Sbjct: 413 LLINFGGHTYAAGLTMKWEDVKEFRKRFQEYVESHIEPEQIEATLDIDAVLDFKDITKKL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
              L+   P+G GNP P+F         + +VV     H+++     + S  +  IAF  
Sbjct: 473 HTDLKKFAPFGPGNPKPLFCTIGVYDYGTSKVVGRQQEHIKLELVDSKSSNVVNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
             +           +   +   +  N ++   + QL++ D  P E
Sbjct: 533 SAS----ARYIKSKRSFDIAYTIEDNVFK-KNQVQLQIEDIRPTE 572


>gi|149369293|ref|ZP_01889145.1| single-strand DNA specific exonuclease [unidentified eubacterium
           SCB49]
 gi|149356720|gb|EDM45275.1| single-strand DNA specific exonuclease [unidentified eubacterium
           SCB49]
          Length = 562

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 168/578 (29%), Positives = 278/578 (48%), Gaps = 22/578 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLIL 75
           RW  L  +    +   +++   + + +A +L  R ++  D AK F  PS++ L  DP ++
Sbjct: 2   RWNILP-KSNSEKTQELSKALGVDNTIANLLFQRGITTFDEAKYFFRPSLKDLH-DPYLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D   A  RI +AI N E I+++GDYDVDG  SVALM  +L     N   YIPDR  +GY
Sbjct: 60  EDMLVAVERIEKAIENKENILVYGDYDVDGTTSVALMSSYLRTYYPNIATYIPDRYEEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  + D + YA+ + ID I+ DHH+   E   A A++
Sbjct: 120 GVSYKGIDFAADNNFSLIIALDCGVKAIDKVAYASEKNIDFIICDHHRPGPELPKAIAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  +     Q     L +  L     VA A   D+VP
Sbjct: 180 DPKREDCAYPYKELCGCGVGFKLIQALGARRGQTIDDLLLYLDL-----VATAIGADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           + G NR     GL V       G KA+++++     +T  ++ ++IGP INA GR+   N
Sbjct: 235 ITGENRILAYYGLKVINSNPRTGYKAILKQIK-KEVLTITDVVFIIGPRINAAGRMKHGN 293

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
               LL+  D  +  + A +++  N +RR  +  + ++A A++  + +  ++    VV  
Sbjct: 294 HAVTLLVETDINKAAIWAAEIEQFNLDRREADKRITKEALAQI--KTNKEEERKTTVVYQ 351

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
             WH G++G++A+RL E + RP+   +   D K   S RS+ GFD+   +    E   + 
Sbjct: 352 KDWHKGVIGIVASRLTETYYRPTLVFTKSGD-KLAASARSVIGFDVYNALQECSEF--IT 408

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAGLT+E  NF    + F++     +   +  P   +   +  + +      +
Sbjct: 409 QFGGHKYAAGLTLEEKNFENFKNKFEEVVSRTIDPKLLQPELSVTMEIELADITPKFYRI 468

Query: 496 LESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGTP 552
           L+   P+G GNP+PVF   N  +    + V     HL++T +   S+ +  I F +    
Sbjct: 469 LKQFAPFGPGNPSPVFMTQNLSETGYGKCVGEDKTHLRITVKQGMSQYV-CIGFGLGDKK 527

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                +   G+       +  N W+G+   QLR+ D  
Sbjct: 528 A----IACSGRPFKAAYVIDENEWQGNVSLQLRLKDIK 561


>gi|149184834|ref|ZP_01863152.1| single-stranded DNA-specific exonuclease [Erythrobacter sp. SD-21]
 gi|148832154|gb|EDL50587.1| single-stranded DNA-specific exonuclease [Erythrobacter sp. SD-21]
          Length = 594

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 232/592 (39%), Positives = 347/592 (58%), Gaps = 18/592 (3%)

Query: 7   LGVECSISGFRWVSLLGQEGINRALAITQKH--AIPDIVARVLVNRNVSIDYAKDFLNPS 64
            GV  S++G  W    G         + Q H      IV ++L+ R V+ D  +  L+P+
Sbjct: 10  FGVSQSLTGRAWRWRGGNMD------LGQGHFGDADAIVRQILLARGVAQDDLQRHLSPT 63

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R  +PDP   +D + AA RI QA+ ++E+I I+GDYDVDGA S AL++R L    V A+
Sbjct: 64  LRDFLPDPSEFSDMETAADRIAQAVLSNERITIYGDYDVDGATSSALLIRLLRDLGVEAD 123

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
            YIPDR+++GYGP+   + K    G+ LI+TVDCG+ +++AL  A++ G+DVIV+DHH+ 
Sbjct: 124 YYIPDRLLEGYGPSGEALVKLAQAGSSLIVTVDCGAMAHEALAMASDAGVDVIVVDHHKC 183

Query: 185 KSEEIPAYALVNPNRLDDL---SGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLL 239
             E   A ALVNPNRLD+    +  GHL A GV FL+ + + R LR +     +   DL 
Sbjct: 184 SPELPRAAALVNPNRLDENDLAAAHGHLAAVGVAFLLAIALVRTLRGNGYFENHKEPDLF 243

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           +LLD+VAL TV DV  L GLNRA+V +GL +  R+ N G+ ALI+   +       +LG+
Sbjct: 244 ALLDVVALGTVADVAALHGLNRAFVAQGLKIMGRRDNIGMAALIDASRLKRAPACSDLGF 303

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
            +GP INAGGR+GES LG RLL + D++E + +A +L  LN+ RR +E+ + + AE ++ 
Sbjct: 304 ALGPRINAGGRVGESTLGVRLLTTQDAEEAQQIAAQLSALNEERRAIEAEVQQAAEEQLA 363

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            Q       +V VV    WHPG++G++A R+KEK G+PS  I+ +E+G+G GSGRSI G 
Sbjct: 364 AQ----HNRAVHVVAARGWHPGVIGIVAGRIKEKSGKPSLVIALDENGEGKGSGRSIPGV 419

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           D+G  +  A EEG+L+KGGGHAMAAGLTV         D+        V          +
Sbjct: 420 DLGAAIIRAREEGLLIKGGGHAMAAGLTVAEDKLEAFSDWLDAHLEGPVSRASENREMLL 479

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           D  +    +   L++ L+  GPYG G P P  A    +L    +V   H+++    +D  
Sbjct: 480 DLAVAPGGLTPDLVEALDRGGPYGVGWPGPRVAVGPVRLVKCDIVGTDHVRLIASGEDGR 539

Query: 540 TLQAIAFRVYGTPLGEFLMQ-SRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           + + IAFR   + +G+ L+  SRG+R+ + G + ++ W    + +L + DA+
Sbjct: 540 SFKGIAFRAAESDMGQALLHGSRGRRLWLAGRVKIDDWGSRPQAELHLEDAA 591


>gi|297584748|ref|YP_003700528.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           selenitireducens MLS10]
 gi|297143205|gb|ADH99962.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           selenitireducens MLS10]
          Length = 785

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 184/593 (31%), Positives = 291/593 (49%), Gaps = 30/593 (5%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNR-NVSIDYAKDFLNPSIRLLMPDP 72
           S  +W+     E   +   + +   + +I AR  V R   + +    FL+   R L+ DP
Sbjct: 4   SKSKWLVPDWSED--QVGELAEATGLSNIAARFFVQRRKTTKEEVMSFLHMDHRSLL-DP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D D+A  RI +AI   E+I+IFGDYD DG  S A+    L       + YIP+R  
Sbjct: 61  FLLYDMDRAVDRIRRAIEKQERILIFGDYDADGVTSTAITYLTLKRLGAEVSYYIPNRFT 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN     +   E   LIITVD G +     + A   G+D+I+ DHH+       A+
Sbjct: 121 EGYGPNEGAFRQAAEESVSLIITVDTGISGVHEAEVAKECGMDLIITDHHEPPPVLPDAF 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+VNP +        +L  AGV F +   +   + +D           L DLVA+ T+ D
Sbjct: 181 AVVNPKQEHCSYPNPNLAGAGVAFKLAHALTGEIPED-----------LFDLVAIGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRI 311
           +V L G NR     G+   R+    G+KAL++      S +  E +G+MIGP +NA GR+
Sbjct: 230 LVSLEGENRYLAKAGIEAIRQGPRAGVKALLDIAGAEVSELNEETIGFMIGPRLNAAGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             ++  + LLI+++  E + LA  +D LN+ R+ +   + E+A  +V  Q       SVI
Sbjct: 290 DSADPAAALLITENPHEAKDLAELIDGLNKERQSIVKEIAEEAIEQVEAQGV----PSVI 345

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           +V  + W+PG++G++A+RL E++ RP   +SF +E  +  GS RSIEGFD+    S +  
Sbjct: 346 IVGAEGWNPGVIGIVASRLVERYYRPVIVLSFDQEKEQAKGSARSIEGFDM--FQSLSTC 403

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAGLT+   +   L +   + A+  +         K+D  ++   V +
Sbjct: 404 RDILPHFGGHPMAAGLTMSLSDVEELRERLIRLANESMSDDDWIRKLKVDLPVSIEEVTL 463

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQD-SETLQAIAFR 547
             I+ L++  PYG GNP P     +  + S+R +     HL+++  ++     L AIAF 
Sbjct: 464 NAIEDLQAMAPYGIGNPAPKVMLEDVGIVSMRRIGATGDHLKLSVNNKGSGIELDAIAFG 523

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                       S+   + + G L +N W G ++ Q  V D    +   F  +
Sbjct: 524 KGDA----ADEISKLSPLSLVGKLGINEWNGKRKPQFLVEDMQISDWQLFDFR 572


>gi|126662540|ref|ZP_01733539.1| single-strand DNA specific exonuclease [Flavobacteria bacterium
           BAL38]
 gi|126625919|gb|EAZ96608.1| single-strand DNA specific exonuclease [Flavobacteria bacterium
           BAL38]
          Length = 576

 Score =  419 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 169/587 (28%), Positives = 281/587 (47%), Gaps = 29/587 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW     +    +  AI     + +I+A +LV R V + + AK F  P++  L  +P ++
Sbjct: 2   RWNLKS-KPNQEKVQAIQSALQVDEIIATLLVQRGVETFEQAKTFFRPTLADLH-NPYLM 59

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D DKA  RI +AI N+E I++FGDYDVDG  +V+L+  +L     N   YIPDR  +GY
Sbjct: 60  KDMDKAVVRIEKAISNNENILVFGDYDVDGTTAVSLVSSYLRSFYPNVATYIPDRYAEGY 119

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +    LII +DCG  S D + YA  + ID I+ DHH+       A A++
Sbjct: 120 GISYMGIDYAEDNDISLIIALDCGIKSIDHVNYAKAKNIDFIICDHHRPGPVLPDAIAVL 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D       LC  GV F ++  +      +N+     DL+  LDLVA A   D+VP
Sbjct: 180 DPKRDDCSYPYDELCGCGVGFKLVQALA-----ENRNQTIADLVLYLDLVATAIAADIVP 234

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNI---------SSPITAENLGYMIGPSIN 306
           + G NR     GL V      PG+KAL++ V              +T  ++ +++ P IN
Sbjct: 235 ITGENRVLAKFGLEVINSNPRPGIKALVQNVKTRANGERSEAKKVLTITDVVFIVAPRIN 294

Query: 307 AGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQ 366
           A GRI   N    LL   D ++ E  A +++  N +R+ ++  + ++A  ++  + ++ Q
Sbjct: 295 AAGRIKHGNEAVALLTEYDLEQAEQFASEIEQHNSDRKELDKQITKEALLQI--EENNEQ 352

Query: 367 QASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS 426
                VV  + WH G++G++A+RL E + RP+   +   D K   S RS++ FD+   + 
Sbjct: 353 NRFSTVVYQENWHKGVIGIVASRLVENYYRPTIVFTKSGD-KLAASARSVKDFDVYNALE 411

Query: 427 FAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNAS 486
              E   L + GGH  AAG+T++  N+    + F+K     +   +  P    D  ++ S
Sbjct: 412 ACAEH--LEQFGGHMYAAGMTLKEENYDNFKNAFEKVVQETIHPDLLMPEIAYDAEIDLS 469

Query: 487 AVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVN--LAHLQMTFESQDSETLQA 543
            ++  L+ +L+   P+G  N  P+F           + +     HL+   +  +SE   A
Sbjct: 470 EIHPKLMRVLKQFEPFGPENMTPLFLAKGLTDSGYAKTLGADNEHLKAFVKQGNSENFGA 529

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           I F +      +  + +   +      L  N W+     QL++ D  
Sbjct: 530 IGFGLGN----KLDIVTNKNKFDAIFSLEENEWKDIITLQLQLRDIR 572


>gi|258515504|ref|YP_003191726.1| single-stranded-DNA-specific exonuclease RecJ [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257779209|gb|ACV63103.1| single-stranded-DNA-specific exonuclease RecJ [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 907

 Score =  419 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 172/579 (29%), Positives = 298/579 (51%), Gaps = 21/579 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
             W              IT++  +  I+A+++VNR + +++  K+F+   +  L  +P I
Sbjct: 5   KIWHIKENDLATQSI--ITKELGVSPILAQLMVNRGLGTVEQIKNFMEYDLSSL-NNPYI 61

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D  KA  RI++A+  SEKI+I+GDYDVDG    AL++  L   + + N YIP RI +G
Sbjct: 62  LQDMQKAVNRIIEAVNRSEKILIYGDYDVDGITGTALLVGALRRLTDHVNYYIPHRIKEG 121

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQ-GIDVIVIDHHQVKSEEIPAYA 193
           YG +   +EK   +G  LIITVDCG +  +A+ ++      D+I+ DHH+       A A
Sbjct: 122 YGLHKEAVEKAAGQGYSLIITVDCGISGKEAVDWSVQNTKTDIIITDHHEPPPVLPAALA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R D       L   GV   ++  +Y           +      LD+V L T+ DV
Sbjct: 182 VINPKRKDCEYPFKELAGIGVALKLVQAVYAAANMS-----SETWKEYLDIVCLGTIADV 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGE 313
           VPL+G NR  V  GL    +    GL ALI+   +   IT+  +G+++ P +NA GR+G+
Sbjct: 237 VPLLGENRILVKYGLPYLTKTSKKGLIALIKASGLRGDITSGQVGFVLAPRLNAAGRLGD 296

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
             +   LL+++D  +   +A+ LD  N+ R+ +E A L++A   +  +    +Q+ V+V+
Sbjct: 297 PFMAVELLLTEDEAQANQIAVVLDEKNRKRKSVEDAALKEAIQMIEREI-SFKQSKVLVL 355

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WHPG++GL+A+RL E++ +P  AI+ + + +G GS RSI GF++ + +        
Sbjct: 356 ASEEWHPGVIGLVASRLVERYYKPVLAIALDGE-QGKGSARSIPGFNLYQALEHC--GKN 412

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG +++R +          +A  ++   +  PV  +DG+ + + +   +I
Sbjct: 413 LSGYGGHTMAAGFSLKRESLDNFIREINVYADEVISEDLLVPVMNLDGIFSLNDITEQVI 472

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRVYGT 551
             +E   P+G  NP P+   P  ++ + + V     HL++    ++   +  I F +   
Sbjct: 473 AEIEKLAPFGQANPGPLLCCPEIQVVNFKGVGKEGEHLKIKIRKENG-FIDGIGFNLASY 531

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                 M +  +R+++     +N W+G +   LR+ D  
Sbjct: 532 S----EMLATAERVNLAFVPEINEWQGKRHISLRIKDIQ 566


>gi|332883950|gb|EGK04230.1| single-stranded-DNA-specific exonuclease RecJ [Dysgonomonas mossii
           DSM 22836]
          Length = 575

 Score =  419 bits (1076), Expect = e-115,   Method: Composition-based stats.
 Identities = 174/581 (29%), Positives = 295/581 (50%), Gaps = 21/581 (3%)

Query: 16  FRWV-SLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPL 73
           ++W    L  +   +   + +K  I  ++ ++L+ R +S  + A+ F +PS+R L  DP 
Sbjct: 3   YKWNYEALTTQQKEQRDELAKKLGISPVLCQLLIQRGISSAEEARKFFHPSLRDLH-DPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           +L D DKA +RI +A+   ++I+I+GDYDVDG  +VAL+ +FL   + N + YIPDR  +
Sbjct: 62  LLPDMDKAIKRIEKALGQKQRILIYGDYDVDGTTAVALVYKFLRKFTTNLDYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G +LII +DCG  + + + YA ++GID I+ DHH        A A
Sbjct: 122 GYGISEQGIDYAEETGVKLIIALDCGIKANEKIDYAKSKGIDFIIGDHHMPDDVLPDAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++  RLD      HL   GV F ++  + +  + D       ++  LLDLVA++   D+
Sbjct: 182 VIDAKRLDSTYPYEHLSGCGVGFKLVQALAQSNKID-----FSEITDLLDLVAVSVASDI 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIG 312
           VP+ G NR     GL       + GLK +I+   ++   IT  ++ + IGP INA GR+ 
Sbjct: 237 VPITGENRVLTYFGLKQINSNPSLGLKGIIDICGLTYKNITVNDIIFKIGPRINASGRMM 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           +      LL+S   ++    +M +D  N +RR ++  + E+A   +  +  D+++   IV
Sbjct: 297 KGKEAVDLLLSSTIEDAREKSMNIDHYNDDRRELDKRITEEAIQFI-DENVDMKEKKSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WH G++G++A+RL EK+ RP+  ++ +  G   GS RS+ GFD+ K +     + 
Sbjct: 356 IYNETWHKGVIGIVASRLTEKYLRPAVVLT-KSQGLITGSARSVMGFDVYKAIEAC--KD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           IL   GGH  AAGL+++  N       F+  +  ++   +  P  ++D  L+   +N   
Sbjct: 413 ILENFGGHTYAAGLSLKEENLKEFKSRFEALSLEMIAPEMMRPQIRVDAELSFKEINQKF 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVNLA--HLQM-TFESQDSETLQAIAFRV 548
            + L +  P+G  N NP+F   N     + ++V     HL++   +   S  +  IAFR 
Sbjct: 473 TEDLAAFAPFGPENLNPIFVTCNVMDYGTSKLVGKDNVHLKLEMIDDTLSTPVNGIAFRQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
             +          GK   +   L  N   G    QL V D 
Sbjct: 533 QDSS----DKVKSGKPFDICYTLEENTHNGKTNIQLYVKDI 569


>gi|325280371|ref|YP_004252913.1| single-stranded-DNA-specific exonuclease RecJ [Odoribacter
           splanchnicus DSM 20712]
 gi|324312180|gb|ADY32733.1| single-stranded-DNA-specific exonuclease RecJ [Odoribacter
           splanchnicus DSM 20712]
          Length = 574

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 164/586 (27%), Positives = 267/586 (45%), Gaps = 23/586 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
            RWV         +   +++K     ++A +L+ R ++  + A+ F  PS+ +L  DP +
Sbjct: 3   KRWVI-NTPPEATKIEELSKKLNCHPVIANLLLQRGITSSEQAQSFFYPSLNMLH-DPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV--NANMYIPDRIV 132
           + D DKA  R+ +AI   EKI+I+GDYDVDG  +V+L+ ++L H     N   YIPDR  
Sbjct: 61  MKDMDKAVERLDRAIAQDEKILIYGDYDVDGTTAVSLLYKYLKHHCNSDNLEYYIPDRYT 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++     G  L++  DCG  + + ++YA ++ +D+I+ DHH        A 
Sbjct: 121 EGYGVSIKGIDYAAENGFSLMLITDCGIKAVEKVKYANSRQVDIIICDHHTPGDTLPEAI 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+++P R D       L   GV F ++                 +L  LLDL+ ++   D
Sbjct: 181 AVLDPQRPDCPYPYKWLSGCGVSFKLVQAHS-----LKHNLPMSELYKLLDLLCVSIASD 235

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           +VP+ G NR     GL       + GLK +I+   I   IT  ++ + IGP INA GR+ 
Sbjct: 236 IVPITGENRILAYFGLQQLNSNPSLGLKTIIKISGIDKEITINDIVFRIGPRINAAGRVE 295

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL +D+      +A  ++  N  R+ ++  + E+A   +  Q +        V
Sbjct: 296 SGRKSVELLTADEKCSAAGIASDINTFNDQRKKLDHDITEEAIRHI-NQSELEPSKKTTV 354

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +    WH G++G++A+RL E F RP+  ++ E +G   GS RS+EGFD+   +S   E  
Sbjct: 355 LFNANWHKGVIGIVASRLTESFYRPTIILT-ESNGLATGSARSVEGFDLYYAISQCSEF- 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
            L   GGH  AAGLT++  N       F++     +   + TP   ID  +  + +   L
Sbjct: 413 -LENYGGHKYAAGLTLKIENIEPFKQKFERIVRETIDDEMLTPQINIDAKIKLTDITPDL 471

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHK-LQSIRVVNLA--HLQMTFESQDSETLQ--AIAFR 547
             ML+   P+G  N  PVF           + V     HL++              I F 
Sbjct: 472 YHMLQKFAPFGPNNTIPVFMTEKVTNFIGTKRVGRNNEHLKLVIVDDTRACNDRSGIGFG 531

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           +       +   + G    +   L  N + G    Q+ V D    E
Sbjct: 532 MGHL----YDKVNSGGFFDICYTLQENEFMGKNDIQMIVKDIRLRE 573


>gi|313204813|ref|YP_004043470.1| exonuclease recj [Paludibacter propionicigenes WB4]
 gi|312444129|gb|ADQ80485.1| exonuclease RecJ [Paludibacter propionicigenes WB4]
          Length = 574

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 171/583 (29%), Positives = 286/583 (49%), Gaps = 21/583 (3%)

Query: 18  WVSLLGQEGINRAL-AITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           W+     E        + ++ +I  I++++LV R++ + + A+ F  P +  L  DP ++
Sbjct: 5   WIYRTLTEQQRETQNKLAEELSISPILSQLLVQRDILTFEEARSFFRPDLSNLH-DPFLM 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D   A  R+ +A+  +EKI+I+GDYDVDG  SVAL+ +FL     N   YIPDR  +GY
Sbjct: 64  ADMHNAVNRLTKAMQKNEKILIYGDYDVDGTTSVALVYKFLKQFYRNVAFYIPDRYNEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++   +   +LII +DCG  + + ++YA  +G+D I+ DHH   +   PA A++
Sbjct: 124 GISIQGIDFAADNDFKLIIALDCGIKAVEKVRYALEKGVDFIICDHHTPDAVLPPAVAVL 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P R D      HL   GV F ++         D        L  LLDL+AL+   D+VP
Sbjct: 184 DPKRADCTYPYKHLSGCGVGFKLMQAFAITNNID-----FSQLTPLLDLLALSIASDIVP 238

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGES 314
           + G NR     GL       + GL+ ++E        IT  ++ + IGP INA GR+  +
Sbjct: 239 ITGENRILAFYGLKQINSNPSIGLQGILEVCGLKDKEITISDIVFKIGPRINASGRMKLA 298

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +    LL+S D   ++  +  ++  N +R+ ++  + ++A A +      + + S+ VV 
Sbjct: 299 SEAVELLVSSDYLFVKEKSDTINEYNNDRKDLDKNITDEAIALIGADKRYLDRKSI-VVH 357

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
              WH G++G++A+RL E++ +PS  ++   +G   GS RS+ GFDI K +       +L
Sbjct: 358 KPDWHKGVIGIVASRLSEEYYKPSIVLT-NSNGFASGSARSVSGFDIYKAIDSC--RDLL 414

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
              GGH  AAGL+++  N     + F+KF    +    T P   ID VL    +      
Sbjct: 415 ENFGGHMYAAGLSMKEENIPAFTERFEKFVAENILKEQTYPQIDIDAVLEFKDITPKFFR 474

Query: 495 MLESAGPYGAGNPNPVFAFPNH-KLQSIRVVNL--AHLQMTFESQDS-ETLQAIAFRVYG 550
           +L+  GP+G GN  P+F   N     + R+V     HL++      S   +  IAFR++ 
Sbjct: 475 VLKQFGPFGPGNMKPIFVSKNVLDYGTSRLVGKEQEHLKLELVDSSSENVMNGIAFRMHE 534

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                  +      + +   +  N + G+   QL + D   VE
Sbjct: 535 YNDHLKALN----PLDICYTIEENSFNGNTSIQLMIRDIKVVE 573


>gi|77412804|ref|ZP_00789009.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae 515]
 gi|77161100|gb|EAO72206.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae 515]
          Length = 732

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 184/590 (31%), Positives = 288/590 (48%), Gaps = 32/590 (5%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           + WV    +       A ++K  I + VA ++ +R + +      FL  ++  L  DP +
Sbjct: 6   YSWVLNNQKPDAGFFEA-SKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DPYL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L+       +Y+P+R  DG
Sbjct: 64  LNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALNMMGAEVQVYLPNRFTDG 123

Query: 135 YGPNPSLMEKFINEGA-QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           YGPN S+ + FI +    LIITVD G   ++A+ YA NQG+DV+V DHH + ++   AYA
Sbjct: 124 YGPNESVYKYFIEQQDVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCAYA 183

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++P   D      +L   GV F V   +   +              +LDLVA+ T+ D+
Sbjct: 184 IIHPEHPDANYPFPYLAGCGVAFKVACALLETIP-----------TEMLDLVAIGTIADM 232

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR+ 
Sbjct: 233 VSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGRLD 292

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           + N    LL   D +E + +A  +D  N+ R+ +   + +QA   +       Q   V V
Sbjct: 293 DPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQAMQML------DQTKPVQV 346

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI    +F     
Sbjct: 347 LAKENWHPGVLGIVAGRILERTGQPVIVLN-IEDGIAKGSARSVEALDI--FQAFDQHRE 403

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           + +  GGH+ AAG+T+E    G L      +       +       ID  L    +++  
Sbjct: 404 LFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLTIDSELRFDELSLDT 463

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYG 550
           +   E   P+G  N  PVF   + K+   RV+     HL++  E QD + L  +AF + G
Sbjct: 464 VRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLVAFNM-G 521

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           + L EF    + + + +   L VN W G+   QL + DA       F  +
Sbjct: 522 SQLQEF---QQAQHLELAVTLSVNQWNGATTLQLMLEDARVDGIQLFDIR 568


>gi|315607973|ref|ZP_07882966.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella buccae
           ATCC 33574]
 gi|315250442|gb|EFU30438.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella buccae
           ATCC 33574]
          Length = 573

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 163/583 (27%), Positives = 282/583 (48%), Gaps = 22/583 (3%)

Query: 16  FRWVSLLGQEGINRAL-AITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W          +A   + +K  +   +A++L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWNYQTPTPDERQAADELGEKLNMSPTLAQLLIRRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+   E+I+++GDYDVDG  +VAL+ +FL     N   YIPDR  +
Sbjct: 62  LMKDMDVAVDRLNDAMGRKERILVYGDYDVDGCTAVALVYKFLQQFYSNIGYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++     G +LII +DCG  + + + YA + GID I+ DHH       PA A
Sbjct: 122 GYGVSKKGIDYAKETGVKLIIILDCGIKAVEEITYAKSLGIDFIICDHHVPDEVMPPAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD     HLC  GV F  +    +     N       L+ LLD   +A   D+
Sbjct: 182 ILNPKRPDDSYPFKHLCGCGVGFKFMQGFAK-----NNDIAFSRLIPLLDFCTVAIAADI 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP++  NR     GL    +  + GLK++I+   ++   I+  ++ + IGP INA GR+ 
Sbjct: 237 VPVMDENRILAFHGLKQLNQNPSIGLKSIIDICGLNGREISMSDIVFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  +      +A  ++  N+ R+ ++  M E+A  +++++ +  +  S IV
Sbjct: 297 NGRESVDLLVEREFPVALRMATHINEYNEQRKDIDKQMTEEA-NQIVSRLESQRHRSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  ++  +     GS RS+ GFD+   +       
Sbjct: 356 LYDENWKKGVIGIVASRLTEIYFRPTVVLT-RDGDMATGSARSVTGFDVYSAIKSC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           IL+  GGH  AAGLT++  +     D FQKF    +    T     ID +++   +N  L
Sbjct: 413 ILINFGGHTYAAGLTMKWEHVKEFRDRFQKFVEEHIEPEQTEATLNIDAMIDFKDINKRL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
              L+   P+G GN  P+F         + +VV     H+++     + S  +  IAF  
Sbjct: 473 HTDLKRFAPFGPGNSKPLFCTCGVYDYGTSKVVGREQEHIKLELVDSKSSNVVNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
             +           +   +   +  N ++ ++  QL++ D  P
Sbjct: 533 SAS----ARYIKSKRSFDIVYTIEDNVFKHNQ-VQLQIEDIRP 570


>gi|213963155|ref|ZP_03391413.1| single-stranded-DNA-specific exonuclease RecJ [Capnocytophaga
           sputigena Capno]
 gi|213954239|gb|EEB65563.1| single-stranded-DNA-specific exonuclease RecJ [Capnocytophaga
           sputigena Capno]
          Length = 564

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 168/581 (28%), Positives = 280/581 (48%), Gaps = 23/581 (3%)

Query: 15  GFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPL 73
            + W            + + Q+  I + +A +L  R ++    AKDF  P++  L  +P 
Sbjct: 2   NYTWNFKPLPPQ-ATVIQLQQELNISEPLAILLAQRGITTFQQAKDFFRPTLSQLH-NPF 59

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++     A  R+  A+ N+E I+I+GDYDVDG ++V+LM R+LS  +     Y+PDR  +
Sbjct: 60  LMKGMQAAVTRLDHALKNNETILIYGDYDVDGTSAVSLMERYLSTFTSKLFTYVPDRYSE 119

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++    +G  LII +DCG  + D +QYA  +GID I+ DHH+   +   A A
Sbjct: 120 GYGISFQGIDYAEAQGCTLIIALDCGIKAIDKVQYAKEKGIDCIIADHHRPSDQVPDAVA 179

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++P + D       LC  G+ F +    +  L          +L+ LLDLVA+AT  D+
Sbjct: 180 VLDPQQADCPYPYKELCGCGLGFKLAQAYHEYL-----QRPFSELMPLLDLVAVATAADI 234

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGE 313
           VP+ G NR  +  GL V  +Q + G+KAL         IT  ++ +   P INA GRI  
Sbjct: 235 VPMNGENRTLMYFGLEVINQQPSAGVKALF--GEHQGAITVSDVVFKAAPRINAAGRIEH 292

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL   D+++  + A ++D LN +R+ ++S + EQA  ++  + +  Q     VV
Sbjct: 293 GKYAVALLTEPDAEKALLKAQEIDELNTHRKELDSYIAEQALGQI--ESNGEQNRYTSVV 350

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+   +   D K   S RS++GFDI + +    +   
Sbjct: 351 LNEEWHKGVIGIVASRLIEHYYRPTIVFTKSGD-KYAASARSVQGFDIYEALEQCSQY-- 407

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L + GGH  AAGLT+    +    + F+      +   + TP   ID  L  S +     
Sbjct: 408 LEQFGGHKYAAGLTLLPEQYPLFKEAFETVVKQTINPELRTPKLSIDTALPLSKLTQKFY 467

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQS-IRVVNL--AHLQMTFE-SQDSETLQAIAFRVY 549
           ++L+   P+G  N  P+F   N       + +     HL++      ++    A+ F + 
Sbjct: 468 NILKQFEPFGPQNLPPLFYAENVVDTGFAKHIGKTNEHLKLCLREVGNTAYFDAVGFGLA 527

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                +  + + G    +   +  N W G    QL+V D  
Sbjct: 528 H----KLPLITSGTPFSIVYSVEENVWNGKVSLQLQVRDIR 564


>gi|77411730|ref|ZP_00788068.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae CJB111]
 gi|77162238|gb|EAO73211.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae CJB111]
          Length = 732

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 184/590 (31%), Positives = 287/590 (48%), Gaps = 32/590 (5%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           + WV    +       A ++K  I + VA ++ +R + +      FL  ++  L  DP +
Sbjct: 6   YSWVLNNQKPDAGFFEA-SKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DPYL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  DG
Sbjct: 64  LNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFTDG 123

Query: 135 YGPNPSLMEKFINEGA-QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           YGPN S+ + FI +    LIITVD G   ++A+ YA NQG+DV+V DHH + ++   AYA
Sbjct: 124 YGPNESVYKYFIEQQDVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCAYA 183

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++P   D      +L   GV F V   +   +              +LDLVA+ T+ D+
Sbjct: 184 IIHPEHPDANYPFPYLAGCGVAFKVACALLETIP-----------TEMLDLVAIGTIADM 232

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR+ 
Sbjct: 233 VSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGRLD 292

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           + N    LL   D +E + +A  +D  N+ R+ +   + +QA   +       Q   V V
Sbjct: 293 DPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQAMQML------DQTKPVQV 346

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI    +F     
Sbjct: 347 LAKENWHPGVLGIVAGRILERTGQPVIVLN-IEDGIAKGSARSVEALDI--FQAFDQHRE 403

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           + +  GGH+ AAG+T+E    G L      +       +       ID  L    +++  
Sbjct: 404 LFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLTIDSELRFDELSLDT 463

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYG 550
           +   E   P+G  N  PVF   + K+   RV+     HL++  E QD + L  +AF + G
Sbjct: 464 VRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNSAHLKLKLE-QDGQALDLVAFNM-G 521

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           + L EF    + + + +   L VN W G+   QL + DA       F  +
Sbjct: 522 SQLQEF---QQAQHLELAVTLSVNQWNGATTLQLMLEDARVDGIQLFDIR 568


>gi|319745216|gb|EFV97535.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae ATCC 13813]
          Length = 732

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 184/590 (31%), Positives = 287/590 (48%), Gaps = 32/590 (5%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           + WV    +       A ++K  I + VA ++ +R + +      FL  ++  L  DP +
Sbjct: 6   YSWVLNNQKPDAGFFEA-SKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DPYL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  DG
Sbjct: 64  LNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFTDG 123

Query: 135 YGPNPSLMEKFINEGA-QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           YGPN S+ + FI +    LIITVD G   ++A+ YA NQG+DV+V DHH + ++   AYA
Sbjct: 124 YGPNESVYKYFIEQQDVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCAYA 183

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++P   D      +L   GV F V   +   +              +LDLVA+ T+ D+
Sbjct: 184 IIHPEHPDANYPFPYLAGCGVAFKVACALLETIP-----------TEMLDLVAIGTIADM 232

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR+ 
Sbjct: 233 VSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGRLD 292

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           + N    LL   D +E + +A  +D  N+ R+ +   + +QA   +       Q   V V
Sbjct: 293 DPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQAMQML------DQTKPVQV 346

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI    +F     
Sbjct: 347 LAKENWHPGVLGIVAGRILERTGQPVIVLN-IEDGIAKGSARSVEALDI--FQAFDQHRE 403

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           + +  GGH+ AAG+T+E    G L      +       +       ID  L    +++  
Sbjct: 404 LFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLTIDSELRFDELSLDT 463

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYG 550
           +   E   P+G  N  PVF   + K+   RV+     HL++  E QD + L  +AF + G
Sbjct: 464 VRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLVAFNM-G 521

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           + L EF    + + + +   L VN W G+   QL + DA       F  +
Sbjct: 522 SQLQEF---QQAQHLELAVTLSVNQWNGATTLQLMLEDARVDGIQLFDIR 568


>gi|22537366|ref|NP_688217.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae 2603V/R]
 gi|25011329|ref|NP_735724.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae NEM316]
 gi|22534239|gb|AAN00090.1|AE014247_5 single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae 2603V/R]
 gi|24412867|emb|CAD46939.1| Unknown [Streptococcus agalactiae NEM316]
          Length = 732

 Score =  418 bits (1073), Expect = e-114,   Method: Composition-based stats.
 Identities = 184/590 (31%), Positives = 287/590 (48%), Gaps = 32/590 (5%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           + WV    +       A ++K  I + VA ++ +R + +      FL  ++  L  DP +
Sbjct: 6   YSWVLNNQKPDAGFFEA-SKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DPYL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  DG
Sbjct: 64  LNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFTDG 123

Query: 135 YGPNPSLMEKFINEGA-QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           YGPN S+ + FI +    LIITVD G   ++A+ YA NQG+DV+V DHH + ++   AYA
Sbjct: 124 YGPNQSVYKYFIEQQDVSLIITVDNGVAGHEAITYAQNQGVDVVVTDHHSMPADLPCAYA 183

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++P   D      +L   GV F V   +   +              +LDLVA+ T+ D+
Sbjct: 184 IIHPEHPDANYPFPYLAGCGVAFKVACALLETIP-----------TEMLDLVAIGTIADM 232

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR+ 
Sbjct: 233 VSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGRLD 292

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           + N    LL   D +E + +A  +D  N+ R+ +   + +QA   +       Q   V V
Sbjct: 293 DPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQAMQML------DQTKPVQV 346

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI    +F     
Sbjct: 347 LAKENWHPGVLGIVAGRILERTGQPVIVLN-IEDGIAKGSARSVEALDI--FQAFDQHRE 403

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           + +  GGH+ AAG+T+E    G L      +       +       ID  L    +++  
Sbjct: 404 LFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLTIDSELRFDELSLDT 463

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYG 550
           +   E   P+G  N  PVF   + K+   RV+     HL++  E QD + L  +AF + G
Sbjct: 464 VRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLVAFNM-G 521

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           + L EF    + + + +   L VN W G+   QL + DA       F  +
Sbjct: 522 SQLQEF---QQAQHLELAVTLSVNQWNGATTLQLMLEDARVDGIQLFDIR 568


>gi|325269072|ref|ZP_08135693.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella
           multiformis DSM 16608]
 gi|324988693|gb|EGC20655.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella
           multiformis DSM 16608]
          Length = 574

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 162/586 (27%), Positives = 282/586 (48%), Gaps = 22/586 (3%)

Query: 15  GFRWVS-LLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDP 72
            F+W       E  + A  + +K  I  I+A +L+ R ++ +  AK F  P +  L+ +P
Sbjct: 2   NFKWNYTPPTAEQEHTAAELGEKLGINPILAGLLIRRGITTESAAKRFFRPQLADLI-NP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D D A  R+  A+ + E+I+++GDYDVDG  +VAL+ +FL     N + YIPDR  
Sbjct: 61  FLMKDMDAAVDRLNDAMGHKERILVYGDYDVDGCTAVALVYKFLRQFYSNIDYYIPDRYD 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++     G +LII +DCG  + + + YA  QGID I+ DHH       PA 
Sbjct: 121 EGYGVSRKGIDFAKETGVRLIIILDCGIKAIEEIAYAKEQGIDFIICDHHVPDESMPPAV 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A++NP R DD      LC  GV F  +    +     N       L+ LLD  A++   D
Sbjct: 181 AILNPKRPDDSYPFKDLCGCGVGFKFMQAFAK-----NNNIPFSRLIPLLDFCAVSIAAD 235

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRI 311
           +VP++  NR     GL    +  + GLKA+I+   ++   ++  ++ + IGP INA GR+
Sbjct: 236 LVPVVDENRILAFHGLKQLNQNPSLGLKAIIDICGLNGRELSMSDIIFKIGPRINASGRM 295

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
                   LL+  +       A  +D  N+ R+ ++  M E+A  +++ + +  +  S I
Sbjct: 296 ENGKKSVDLLVEREYGMAFRQAKHIDEYNEQRKDVDRQMTEEA-NQIVARLESQKHQSSI 354

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V+  + W  G++G++A+RL E + RP+  ++  ++    GS RS+ GFD+   +      
Sbjct: 355 VLYDEHWKKGVIGIVASRLTEIYFRPTVVLT-RDENLATGSARSVAGFDVYAAIKSC--R 411

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L+  GGH  AAGLT++  +       FQ +    +       +  ID V++   +   
Sbjct: 412 DLLLNFGGHTYAAGLTMKWSDVKEFRRRFQDYVETHIEPEQREAILDIDAVIDFKDITKK 471

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFR 547
           L + L+   P+G GN  PVF   +     + +VV     H+++     + +  +  IAF 
Sbjct: 472 LHNDLKRFAPFGPGNTKPVFCTLDVYDFGTSKVVGREQEHIKLELVDSKSNNVMNGIAFG 531

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
              +           +   +   +  N ++     QL++ D  P +
Sbjct: 532 QSAS----ARYIKSKRSFDIAYTIEDNVFK-RGAVQLQIEDIRPTD 572


>gi|189463814|ref|ZP_03012599.1| hypothetical protein BACINT_00147 [Bacteroides intestinalis DSM
           17393]
 gi|189438764|gb|EDV07749.1| hypothetical protein BACINT_00147 [Bacteroides intestinalis DSM
           17393]
          Length = 571

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 167/582 (28%), Positives = 277/582 (47%), Gaps = 22/582 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W       E +  +  + Q+  I  I++ +LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYQPITPEQVETSQKLAQELGISPILSGLLVQRGITKAQDAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+ +A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDVAVERLNKAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNIDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGVSTKGVDYAAETGVGLIIVLDCGIKAVEEITYAKEKGIDFIICDHHVPDDVLPPAAAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +         +        L+ LLDLVA++   D+V
Sbjct: 183 LNAKRLDNTYPYEHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDLVAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAFHGLKQLNSNPSVGLKAIIDVCGLTEKDITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL   D       A +++  N+ R+ ++  M E+A  +++   + +     IV+
Sbjct: 298 GKEAVDLLTEKDFSMALEKANQINQYNETRKDLDKTMTEEA-NQIVADLEGLADRRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K + +     +
Sbjct: 357 YNEDWHKGVIGIVASRLTEIYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEYC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N     + F++F    +    T+ V  ID  ++   ++    
Sbjct: 414 LENFGGHTYAAGLSMKVENVPAFTERFEEFVSQNILPEQTSAVINIDAEIDFRDISPKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   PYG  NP P+F   N     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NDLKKFNPYGPDNPKPIFCTHNVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
                        +   +   +  N  +     QL++ D  P
Sbjct: 534 ----SHVRFIKTKRSFDICYTIEENTHK-RGEVQLQIEDIQP 570


>gi|85059969|ref|YP_455671.1| ssDNA exonuclease RecJ [Sodalis glossinidius str. 'morsitans']
 gi|84780489|dbj|BAE75266.1| single-stranded-DNA-specific exonuclease [Sodalis glossinidius str.
           'morsitans']
          Length = 578

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 186/568 (32%), Positives = 288/568 (50%), Gaps = 20/568 (3%)

Query: 36  KHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKI 95
           +  IP ++ R+ V R V    A   L   +R L+     LT  ++A   +++A+ +  +I
Sbjct: 20  EADIPPLLKRLYVQRGVC---AVGELERGVRGLLAY-HTLTGIEQAVDLLIRALADQRRI 75

Query: 96  MIFGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLII 154
           M+ GD+D DGA S AL +  L        +  +P+R  DGYG +P ++E+    GAQLI+
Sbjct: 76  MVVGDFDADGATSTALTVLALRQMGAQTIDFLVPNRFEDGYGLSPEVVEQAAARGAQLIL 135

Query: 155 TVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGV 214
           TVD G +S+  +  A  +GI V++ DHH        A A+VNPN  D       L   GV
Sbjct: 136 TVDNGISSHAGVTLAHEKGIPVLITDHHLPGDTLPAAEAIVNPNLRDCTFASKSLAGVGV 195

Query: 215 VFLVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
            F +++ +   L               L  LLDLVAL TV DVVPL   NR  V +GL  
Sbjct: 196 AFYLMLALRARLNDSGWFTQRGIAAPKLAELLDLVALGTVADVVPLDANNRILVHQGLSR 255

Query: 271 ARR-QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQE 328
            R  +  PG++AL E  N   + + A +LG+ +GP +NA GR+ + ++G  LL+S+D  +
Sbjct: 256 IRAGRCRPGIRALAEVANRDITRLCASDLGFALGPRLNAAGRLDDMSVGVALLLSEDLPQ 315

Query: 329 LEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI-VVEGDRWHPGIVGLLA 387
             MLA +LD LNQ RR +E  M  +A A   +   D Q       +  ++WH G+VG+LA
Sbjct: 316 ARMLAAELDALNQTRREIEHGMEAEALALCQSMARDEQAMPFGLAIYHEQWHQGVVGILA 375

Query: 388 ARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV--EEGILVKGGGHAMAAG 445
           +R+KE+F RP  A +   +G   GSGRS+ G  +  ++        G+++K GGHAMAAG
Sbjct: 376 SRIKERFHRPVIAFAPAGEGVLKGSGRSVAGLHMRDLLERLDTLHPGMILKFGGHAMAAG 435

Query: 446 LTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAG 505
           LT+E   F R    F +     +   +   V   DG L    +++   ++L   GP+G G
Sbjct: 436 LTLEHAQFERFRQRFAELVDEWLDPAMLEGVIWSDGELAGQELSLTTAELLRDGGPWGQG 495

Query: 506 NPNPVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKR 564
            P+P+F     ++ + R+V   HL++  E       L  IAF +      +    +    
Sbjct: 496 FPDPLFDGR-FRVLNQRLVGEKHLKLLLEPVAGGPMLDGIAFNIDSRLWPD----NSVHT 550

Query: 565 MHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           + +   L VN +RG++  QL +    P+
Sbjct: 551 VELAYRLEVNEFRGNRSLQLLIQHIWPL 578


>gi|325298689|ref|YP_004258606.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides
           salanitronis DSM 18170]
 gi|324318242|gb|ADY36133.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides
           salanitronis DSM 18170]
          Length = 574

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 169/585 (28%), Positives = 278/585 (47%), Gaps = 22/585 (3%)

Query: 15  GFRWVSLLG-QEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDP 72
            ++W      QE    A A+ ++  I  ++ R+L+ R ++    AK F  P +  L  DP
Sbjct: 2   NYKWNYQPPTQEEREAAKALAKEIGISPVLCRLLLERGITSAAEAKRFFRPQLNELH-DP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++ D  +A  R+ +A+   E+IM++GDYDVDG  +VAL+ +FL     N + YIPDR  
Sbjct: 61  FLMKDMSRAVERLNKAMGRKERIMVYGDYDVDGTTAVALVYKFLQQFYSNIDYYIPDRYN 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++     G +L+I +DCG  + + + YA  +GID I+ DHH       PA 
Sbjct: 121 EGYGVSKKGVDYAYETGVKLVIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDEVLPPAV 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A++NP R D      HL   GV F  +          N       L  LLDLVA++   D
Sbjct: 181 AILNPKRHDASYPYSHLSGCGVGFKFMQAFA-----LNNGIEFQQLTPLLDLVAVSIASD 235

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRI 311
           +VP++G NR     GL       + GLKA+I+        +T  ++ + IGP INA GRI
Sbjct: 236 IVPVMGENRVLAYHGLKQLNTNPSIGLKAIIDVCGLSDRELTMSDIIFKIGPRINASGRI 295

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
                   LLI  D       A +++  N+ R+ ++  M E+A  K++ Q  ++ Q   I
Sbjct: 296 QNGKEAVDLLIEKDFPLALQKARQINQYNETRKDLDKNMTEEA-NKIVDQLANLSQRRSI 354

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V+  + WH G++G++A+RL E + RP+  ++   +    GS RS+ GFD+ K + +    
Sbjct: 355 VIYNEAWHKGVIGIVASRLTEIYYRPAVVLTRTNE-LATGSARSVSGFDVYKAIEYC--R 411

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L   GGH  AAGL+++  N       F+++    +    T+    ID  L+   +   
Sbjct: 412 DLLENFGGHTYAAGLSMKVENVPEFARRFEEYVTRHILPEQTSATIDIDAQLDFRDITSK 471

Query: 492 LIDMLESAGPYGAGNPNPVFAFPN-HKLQSIRVVN--LAHLQMTFES-QDSETLQAIAFR 547
               L+   P+G  NP PVF   N     + +VV     H+++     + +  +  IAF 
Sbjct: 472 FFFDLKKFNPFGPENPKPVFCTMNVFDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFG 531

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
                  +       +  ++   +  N  +     QL++ D  P 
Sbjct: 532 QS----SQARFIKTKQSFNICYTIEENTHK-RGDVQLQIEDIKPS 571


>gi|126653977|ref|ZP_01725814.1| YrvE [Bacillus sp. B14905]
 gi|126589534|gb|EAZ83676.1| YrvE [Bacillus sp. B14905]
          Length = 773

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 181/593 (30%), Positives = 297/593 (50%), Gaps = 27/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           +S  RW     +  +N   A+     +  I A++L  R   +   A+  LN +   +  D
Sbjct: 3   LSKKRWQV--ERPDVNLVQALQNDLQLSAIAAKILAARGCETTADAESLLNMTEANVH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P ++    +A  RI QA+ N EKI+++GDYD DG  S  +M+  L +   + +  IP+R 
Sbjct: 60  PFLMHGMTEAVARIEQALDNGEKILVYGDYDADGVTSTTVMLNVLLNLGADVSFKIPNRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           + GYGP+ +L  +   EG QLIITVD G +  + ++ A   G+DVIV DHH+   E  PA
Sbjct: 120 IHGYGPHEALFREAYEEGVQLIITVDNGISGIEPIRVAKELGLDVIVTDHHEPGEELPPA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
             +++P   +     G L   GV F +   +Y  L              LL+ VA+ TV 
Sbjct: 180 DIILHPRIPEGHYPFGELAGVGVAFKLAHALYGELP-----------THLLEYVAIGTVA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL+  NR  V +G+   RR  +P ++A+ +  +     I  E +G+  GP  NA GR
Sbjct: 229 DLVPLVDENRYLVKRGIEEMRRSLSPWVQAMCDIASTEQAKINEETIGFYFGPRFNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G+++ G  LL+++DS +   LA +L+  N  R+ +  ++ ++A A +  +   I  + V
Sbjct: 289 LGDASPGVELLMAEDSAKATALAKQLNACNTERKDIVKSITDEAIALIEAE-KKISDSLV 347

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAV 429
           +VV G+ W+ G+VG++A+RL E++ RP+  +S   + G   GS RSIEGF +      A 
Sbjct: 348 LVVAGEGWNAGVVGIVASRLVEQYYRPTIVLSLDPDKGTAKGSARSIEGFHLY--NELAK 405

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L       A   +     TPV  ID  L+   ++
Sbjct: 406 NRDILPHFGGHPMAAGMTLSIEHVDELRSRLDTQARACLTEEQLTPVVHIDIPLSLDEIS 465

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
              I+ + + GPYG   P PV+   + ++ S+R +     H++M   +   + L ++ F 
Sbjct: 466 ADAIEEISTLGPYGTDFPKPVYVLEDVEISSMRKIGAAENHIKMEL-TNGYDKLDSVGF- 523

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
             G    E    + G ++   G L +N W+G K+ Q  + D    E   F  +
Sbjct: 524 HKGHLHDEL---TYGIKVSFIGDLQINEWQGRKKAQFMIEDVQTTEWQLFDIR 573


>gi|330828612|ref|YP_004391564.1| Single-stranded-DNA-specific exonuclease RecJ [Aeromonas veronii
           B565]
 gi|328803748|gb|AEB48947.1| Single-stranded-DNA-specific exonuclease RecJ [Aeromonas veronii
           B565]
          Length = 576

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 181/564 (32%), Positives = 281/564 (49%), Gaps = 19/564 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           +  ++ ++  +R V        L  S   L+P P  L   ++A   + +A+   ++I+I 
Sbjct: 20  LHPLLRQIFASRGVEDPAL---LERSASQLLP-PQRLYGMEQAVPLLAEALTAQKRILIV 75

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L      + +  +P+R   GYG  P ++E  +  GA+ +ITVD
Sbjct: 76  GDFDCDGATSSALCVLALRAMGGRHIDFLVPNRFEFGYGLTPEIVELAVARGAEFLITVD 135

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S   +  A   G+ V+V DHH    E   A A+VNPN+         L   GV F 
Sbjct: 136 NGISSIAGVAAAKAAGMQVLVTDHHLPGQELPDADAIVNPNQHGCDFPSKSLAGVGVAFY 195

Query: 218 VLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR 273
           ++  +   LRQ            ++   LDLVAL TV DVV L G NR  V +GL   R 
Sbjct: 196 LMAALNTHLRQLGWFERQGLRAPNVADYLDLVALGTVADVVALDGNNRILVHQGLQRIRA 255

Query: 274 -QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
            +  PG++AL++        +TA +LG+ +GP +NA GR+ + +LG   L+ DD      
Sbjct: 256 GRCRPGIQALVDVSGRDGRRLTAADLGFALGPRLNAVGRLDDMSLGVACLLCDDLNLARQ 315

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLT-QCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
           LA ++D LNQ R+ +E  M ++A A +   +  D +  S IV+  + WH G+VGL+A+++
Sbjct: 316 LAAEMDSLNQERKEIEQGMQQEALATLEQVRFRDGEVPSGIVLHRNEWHQGVVGLVASKV 375

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGLTV 448
           KEK+ RP  A +   + +  GSGRSI G  +   +        G++ K GGHAMAAGLT+
Sbjct: 376 KEKYYRPVIAFAESSETELKGSGRSIPGVHLRDALELLDTRHPGLMGKFGGHAMAAGLTL 435

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
            + N       F+     +V   + T V   DG L    +N+ L +++ ++GP+G   P 
Sbjct: 436 PKANIEAFGRAFEAVISELVTPELLTGVLLTDGELLPDELNLELAELIRASGPWGQAFPE 495

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           P+F      L   R+V   HL+M   +     + AIAF V      +  +    KR+ + 
Sbjct: 496 PLFDGEFV-LVQQRLVGEKHLKMMLTTDSGHAVDAIAFGVDLKRWPDATV----KRVRLV 550

Query: 569 GHLCVNYWRGSKRCQLRVLDASPV 592
             L VN WRG++  QL V      
Sbjct: 551 YRLDVNEWRGNRSVQLLVEHLEAA 574


>gi|218960658|ref|YP_001740433.1| putative ssDNA exonuclease, 5'--> 3'-specific [Candidatus
           Cloacamonas acidaminovorans]
 gi|167729315|emb|CAO80226.1| putative ssDNA exonuclease, 5'--> 3'-specific [Candidatus
           Cloacamonas acidaminovorans]
          Length = 574

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 180/582 (30%), Positives = 295/582 (50%), Gaps = 20/582 (3%)

Query: 15  GFRWVSL--LGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
             +W+     G+E       ++ +  +P +VA +L  + + +++ A++F  PS+  L  D
Sbjct: 3   NKKWLIPSPPGKEINPEIEKLSAEFKLPRLVAELLYRKGIKTVNSAQEFFKPSMDNLY-D 61

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +  D +KA +RI++AI + EKI I+GDYDVDG  + AL+   L     N + YIP R+
Sbjct: 62  PYLFPDMEKAVQRILRAIDSKEKITIYGDYDVDGTTATALLYLGLKRIGANIDFYIPHRM 121

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           +DGYG +   ++     G+ LII+VDCG  + + +    + G+++I+ DHH  K E  PA
Sbjct: 122 IDGYGLSLGSLDALRENGSSLIISVDCGVNAIEEINAINSMGMEIIITDHHNPKDELPPA 181

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           +A++NP          HL   GV + +L+ IY  L  D       + L  +DLVA+ T+ 
Sbjct: 182 FAIINPKLPGTKYPYEHLAGVGVAYKLLMAIYNNLGID----SAENKLKYMDLVAVGTIA 237

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL   NR +   GL     + N GL AL++   ++   +   ++ + I P INA GR
Sbjct: 238 DIVPLTSENRIFASIGLQHLIEKKNLGLNALVQISGLNQKNLDTTDIVFGIAPRINAAGR 297

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +G +++   LLIS D  +   LA  ++  N  R+  +    ++A   +  +  D+QQ S 
Sbjct: 298 MGSASVSVELLISTDEAKSMELAEIIEHQNSLRQQEDQKTFQEACDIIEKKYKDLQQTSC 357

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           +VV  D WHPG++G++A++L EK+ RP   ISF++ G G GSGRS+  FD+    +    
Sbjct: 358 MVVSSDDWHPGVIGIVASKLVEKYYRPVIMISFKD-GFGSGSGRSVADFDL--FEALKQT 414

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           E  L   GGH  A GLT+ +    R  +   +F    +      P  +ID  +    +N 
Sbjct: 415 EHNLHSFGGHKYAVGLTIYQEYLDRFENELTRFVSENLRLEQIQPPLQIDAEIELYNINN 474

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQS-IRVVNLAHLQMTFESQDSETLQAIAFRVY 549
            L+D LE   P+G  N  PVF   N  + S    V   HL++            I F + 
Sbjct: 475 TLLDALEHFAPFGPDNTRPVFMTRNVTIASYPYNVGRNHLKLKVVK------DGIYFNLI 528

Query: 550 GTPLGEFL-MQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
           G  LG++L +  +  ++ +   L  N +  +   Q ++ D  
Sbjct: 529 GYNLGDYLPLLKKNGKLDIAYTLEYNRFGNNLTIQGKLKDLQ 570


>gi|77407833|ref|ZP_00784586.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae COH1]
 gi|77173580|gb|EAO76696.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae COH1]
          Length = 732

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 184/590 (31%), Positives = 287/590 (48%), Gaps = 32/590 (5%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           + WV    +       A ++K  I + VA ++ +R + +      FL  ++  L  DP +
Sbjct: 6   YSWVLNNQKPDAGFFEA-SKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DPYL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  DG
Sbjct: 64  LNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFTDG 123

Query: 135 YGPNPSLMEKFINEGA-QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           YGPN S+ + FI +    LIITVD G   ++A+ YA NQG+DV+V DHH + ++   AYA
Sbjct: 124 YGPNQSVYKYFIEQQDVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCAYA 183

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++P   D      +L   GV F V   +   +              +LDLVA+ T+ D+
Sbjct: 184 IIHPEHPDANYPFPYLAGCGVAFKVACALLETIP-----------TEMLDLVAIGTIADM 232

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR+ 
Sbjct: 233 VSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGRLD 292

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           + N    LL   D +E + +A  +D  N+ R+ +   + +QA   +       Q   V V
Sbjct: 293 DPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQAMQML------DQTKPVQV 346

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI    +F     
Sbjct: 347 LAKENWHPGVLGIVAGRILERTGQPVIVLN-IEDGIAKGSARSVEALDI--FQAFDQHRE 403

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           + +  GGH+ AAG+T+E    G L      +       +       ID  L    +++  
Sbjct: 404 LFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMSQKKTLTIDSELRFDELSLDT 463

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYG 550
           +   E   P+G  N  PVF   + K+   RV+     HL++  E QD + L  +AF + G
Sbjct: 464 VRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLVAFNM-G 521

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           + L EF    + + + +   L VN W G+   QL + DA       F  +
Sbjct: 522 SQLQEF---QQAQHLELAVTLSVNQWNGATTLQLMLEDARVDGIQLFDIR 568


>gi|188995866|ref|YP_001930118.1| single-stranded-DNA-specific exonuclease [Porphyromonas gingivalis
           ATCC 33277]
 gi|188595546|dbj|BAG34521.1| single-stranded-DNA-specific exonuclease [Porphyromonas gingivalis
           ATCC 33277]
          Length = 584

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 172/590 (29%), Positives = 271/590 (45%), Gaps = 27/590 (4%)

Query: 15  GFRWVSLLGQEGINRALAI-TQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDP 72
            + W              I  ++  +  +V  +L  R + S++ AK F  P +  L  DP
Sbjct: 2   NYNWNLEPFTAEERSLGTIFCRELRLAPVVGCLLARRGIASVEEAKRFFRPRLEDLH-DP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV---NANMYIPD 129
            ++ D DKA  R+ +A+   EKIMI+GDYDVDG  +VAL+ ++L          + YIPD
Sbjct: 61  FLMKDMDKAVARLNRAVGRKEKIMIYGDYDVDGTTAVALVYKYLRATGCSETQLDYYIPD 120

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R  +GYG +   ++   + G +LII +DCG  + + + YA +  ID I+ DHH       
Sbjct: 121 RYDEGYGISYRGIDLAHSLGTKLIIVLDCGIKAVEKVAYAKSLDIDFIICDHHNPDETLP 180

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALAT 249
            A A+++  R D+     HL   GV F  +    R             LL LLDLVA++ 
Sbjct: 181 DAVAVLDAKRADNTYPYEHLSGCGVGFKFMQAYARS-----NNLPESKLLPLLDLVAVSI 235

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAG 308
             D+VP++G NR     GL    ++   GL+A+I+        I   ++ + IGP INA 
Sbjct: 236 ASDIVPIMGENRILAYYGLRQLNKRPCLGLQAIIDVCGLKKRRIDMNDIVFKIGPRINAS 295

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+        LL+S D+ E +     +D  N  RR ++  + EQA   +          
Sbjct: 296 GRMMNGGKAVELLLSQDAVEAQSRTANIDEYNDQRRELDKDVTEQAIDILGELS--DVDK 353

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
            ++V+    WH G++G++A+R+ E++ RP+  ++   D    GS RS+ GFD+ K +   
Sbjct: 354 KILVIYRPEWHKGVIGIVASRMTERYSRPTIVMTKSGD-FISGSARSVGGFDVYKAIEHC 412

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
             + +LV  GGH  A+GLT++  N          +A   V   +  P   +D  ++   V
Sbjct: 413 --KDLLVNFGGHPFASGLTIKEENLETFRKMITDYAEEAVSPELLVPQIDVDAEISIEEV 470

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVNL--AHLQMTFESQDSET--LQA 543
           N  L+D L+  GP+G  N  PVF           R V     HL++       E   +  
Sbjct: 471 NYKLLDNLKRMGPFGPENSKPVFISRQLYDAGGSRAVGKASEHLKIDVRVGSGERHPVSG 530

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           IAF   G        + +     +   +  N + G+K  QL V D  P E
Sbjct: 531 IAFNQAGHC-----NEIKNGSFRLCYTIEENEFNGNKSLQLLVRDIKPEE 575


>gi|34539926|ref|NP_904405.1| single-stranded-DNA-specific exonuclease RecJ [Porphyromonas
           gingivalis W83]
 gi|34396237|gb|AAQ65304.1| single-stranded-DNA-specific exonuclease RecJ [Porphyromonas
           gingivalis W83]
          Length = 584

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 172/590 (29%), Positives = 271/590 (45%), Gaps = 27/590 (4%)

Query: 15  GFRWVSLLGQEGINRALAI-TQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDP 72
            + W              I  ++  +  +V  +L  R + S++ AK F  P +  L  DP
Sbjct: 2   NYNWNLEPFTAEERSLGTIFCRELRLAPVVGCLLARRGIASVEEAKRFFRPRLEDLH-DP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSV---NANMYIPD 129
            ++ D DKA  R+ +A+   EKIMI+GDYDVDG  +VAL+ ++L          + YIPD
Sbjct: 61  FLMKDMDKAVARLNRAVGRKEKIMIYGDYDVDGTTAVALVYKYLRATGCSETQLDYYIPD 120

Query: 130 RIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEI 189
           R  +GYG +   ++   + G +LII +DCG  + + + YA +  ID I+ DHH       
Sbjct: 121 RYDEGYGISYRGIDLAHSLGTKLIIVLDCGIKAVEKVAYAKSLDIDFIICDHHNPDETLP 180

Query: 190 PAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALAT 249
            A A+++  R D+     HL   GV F  +    R             LL LLDLVA++ 
Sbjct: 181 DAVAVLDAKRADNTYPYEHLSGCGVGFKFMQAYARS-----NNLPESKLLPLLDLVAVSI 235

Query: 250 VCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAG 308
             D+VP++G NR     GL    ++   GL+A+I+        I   ++ + IGP INA 
Sbjct: 236 ASDIVPIMGENRILAYYGLRQLNKRPCLGLQAIIDVCGLKKRRIDMNDIVFKIGPRINAS 295

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GR+        LL+S D+ E +     +D  N  RR ++  + EQA   +          
Sbjct: 296 GRMMNGGKAVELLLSQDAVEAQSRTANIDEYNDQRRELDKDVTEQAIDILGELS--DVDK 353

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
            ++V+    WH G++G++A+R+ E++ RP+  ++   D    GS RS+ GFD+ K +   
Sbjct: 354 KILVIYRPEWHKGVIGIVASRMTERYSRPTIVMTKSGD-FISGSARSVGGFDVYKAIEHC 412

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
             + +LV  GGH  A+GLT++  N          +A   V   +  P   +D  ++   V
Sbjct: 413 --KDLLVNFGGHPFASGLTIKEENLETFRKMITDYAEEAVSPELLVPQIDVDAEISIEEV 470

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVNL--AHLQMTFESQDSET--LQA 543
           N  L+D L+  GP+G  N  PVF           R V     HL++       E   +  
Sbjct: 471 NYKLLDNLKRMGPFGPENSKPVFISRQLYDAGGSRAVGKASEHLKIDVRVGSGERHPVSG 530

Query: 544 IAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
           IAF   G        + +     +   +  N + G+K  QL V D  P E
Sbjct: 531 IAFNQAGHC-----DEIKNGSFRLCYTIEENEFNGNKSLQLLVRDIKPEE 575


>gi|147677378|ref|YP_001211593.1| hypothetical protein PTH_1043 [Pelotomaculum thermopropionicum SI]
 gi|146273475|dbj|BAF59224.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 946

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 175/578 (30%), Positives = 289/578 (50%), Gaps = 21/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
             W        + +     +K  I  + A++L+NR + +++  + F+   +  L   P +
Sbjct: 53  KIWRVKTPAPVLCQI--FARKLDISPVTAQLLINRGIYTVEQGRAFIGSELSRLHR-PEL 109

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D D A  RI+QA+   EKI+I+GDYD DG  + AL+++       +A+ YIP R+ +G
Sbjct: 110 LRDMDTAVARILQAVEAGEKILIYGDYDADGITATALLIKVFRRLGADADYYIPGRLEEG 169

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++K + +G  L++TVDCG ++    ++A   G+D+I+ DHH+   E   A A+
Sbjct: 170 YGVHLEPLQKALQKGTGLVVTVDCGISALAEAEWARANGLDLIITDHHEPPPEIPNACAV 229

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP R D       L   G+   +   +                L  LDL  L TV D+V
Sbjct: 230 INPKRPDCSYPFKELAGVGLALKLAQALLERTGAGE-----KAWLDYLDLACLGTVADIV 284

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGE 313
           P+ G NR  V  GL      G+PGL+AL+    I    ++   +GY + P +NA GRIG 
Sbjct: 285 PVQGENRILVKHGLPRLAGTGSPGLQALMAVSGIKGDNLSPREVGYALAPRLNAAGRIGT 344

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
             +G RLL++DD +E   LA +L+  NQ R+ +ES + E+A + +      + +A V V+
Sbjct: 345 PQMGVRLLMTDDLEEARHLAGELNRYNQVRQKIESKVFEEALSLLEAD-PGLAEAPVPVL 403

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WH G++G++A+RL EK  RP   IS E +  G GS RSI GF++ K +S   E   
Sbjct: 404 ASPGWHAGVIGIVASRLAEKLYRPVLLISLEGE-LGRGSARSIPGFNVYKALSHCHEY-- 460

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L++ GGHA+AAG  VE      L      +A   V A    P  ++DG++    V+  L+
Sbjct: 461 LLEYGGHALAAGFKVEGGMVEDLRKKINGYARTAVEAEKLIPYLELDGIVEVGQVSEELV 520

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G  NP+P+       +   RV+     HL++    ++   +  I F +   
Sbjct: 521 NEIKLLSPFGPSNPDPLLCCLEAFVLESRVIGKGSSHLKLRLRGKN-TVMDGIGFNLG-- 577

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
                 + +  +++ +     +N + G +  QL V D 
Sbjct: 578 --AYAEVLATAEKVDLAFVPGINEYNGRRSLQLEVKDL 613


>gi|330447416|ref|ZP_08311065.1| single-stranded-DNA-specific exonuclease RecJ [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491607|dbj|GAA05562.1| single-stranded-DNA-specific exonuclease RecJ [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 574

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 181/562 (32%), Positives = 281/562 (50%), Gaps = 20/562 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           IP I+ R+  +R ++ D     L    + L+ +   L   + A + +  A+ N+ +I+I 
Sbjct: 19  IPPILQRIYASRGINND---AELERGAKGLL-NYNQLYGMESAVQLLSDALANNTRIIIV 74

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L      N +  +P+R  DGYG +P ++E+    GA+LI+TVD
Sbjct: 75  GDFDADGATSSALSVLALRMLGCQNVDYLVPNRFDDGYGLSPEVVEQAQARGAELIMTVD 134

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S   +  A  +GI V+V DHH        A A+VNPN  +       LC  GV F 
Sbjct: 135 NGVSSISGVAAAKEKGIKVLVTDHHLPGDTLPIADAIVNPNLNECGFPSKALCGVGVAFY 194

Query: 218 VLVLIYRILRQDNKVPL----NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR 273
           +++ +   LR +           +L  LLDLVAL TV DVV L G NR  V +GL   R 
Sbjct: 195 LMLALRAELRNNGWFEQQGIAMPNLAELLDLVALGTVADVVALDGNNRILVHQGLQRIRA 254

Query: 274 -QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
            +  PG++ALIE  N     +   +LG+ +GP INA GR+ + + G  LL+ D+ Q    
Sbjct: 255 GKCRPGIQALIEVANRDPSRLVTSDLGFALGPRINAAGRLDDMSFGVELLLCDNIQAARR 314

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV-EGDRWHPGIVGLLAARL 390
           +A +LD LNQ R+ +E  M ++A A       + Q     +V     WH G++G+LA+R+
Sbjct: 315 MASELDGLNQTRKEIEQGMKDEALAICERLKFNQQNMPYGLVLFQRDWHQGVIGILASRI 374

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGLTV 448
           K+K+ RP  A +   +G+  GS RSI G  +   +        G+++K GGHAMAAGLT+
Sbjct: 375 KDKYHRPVIAFADAGNGEIKGSCRSIAGLHMRDALDLVDTQNPGMILKFGGHAMAAGLTI 434

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
                      F     +++       V   DG L +  +N+ + ++L + GP+G   P 
Sbjct: 435 PEDKLDAFSKAFDAVVRSVLDEDALKGVLLTDGELGSHELNLEVAEILRAGGPWGQQFPE 494

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P F     +L   ++V   HL+M  E       + AIAF V      +    +  +++ +
Sbjct: 495 PSFDGT-FRLLHQKLVGGKHLKMMVEPLNGGSVIDAIAFNVDVKRWPD----ASVQQIEL 549

Query: 568 TGHLCVNYWRGSKRCQLRVLDA 589
              L VN +RG++  QL V   
Sbjct: 550 VYRLDVNEYRGNRSVQLMVEHL 571


>gi|76786929|ref|YP_329907.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae A909]
 gi|77405405|ref|ZP_00782499.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae H36B]
 gi|76561986|gb|ABA44570.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae A909]
 gi|77175987|gb|EAO78762.1| single-stranded-DNA-specific exonuclease RecJ [Streptococcus
           agalactiae H36B]
          Length = 732

 Score =  417 bits (1071), Expect = e-114,   Method: Composition-based stats.
 Identities = 184/590 (31%), Positives = 287/590 (48%), Gaps = 32/590 (5%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
           + WV    +       A ++K  I + VA ++ +R + +      FL  ++  L  DP +
Sbjct: 6   YSWVLNNQKPDAGFFEA-SKKEKISEAVASLIYSRGIKTSAELHHFLQTNLENLH-DPYL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L D DKA  RI +AI N+E I+++GDYD DG  S ++M   L        +Y+P+R  DG
Sbjct: 64  LNDMDKAVNRIRRAIENNETILVYGDYDADGMTSASIMKEALDMMGAEVQVYLPNRFTDG 123

Query: 135 YGPNPSLMEKFINEG-AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           YGPN S+ + FI +    LIITVD G   ++A+ YA NQG+DV+V DHH + ++   AYA
Sbjct: 124 YGPNESVYKYFIEQQGVSLIITVDNGVAGHEAIAYAQNQGVDVVVTDHHSMPADLPCAYA 183

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           +++P   D      +L   GV F V   +   +              +LDLVA+ T+ D+
Sbjct: 184 IIHPEHPDANYPFPYLAGCGVAFKVACALLETIP-----------TEMLDLVAIGTIADM 232

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           V L   NR  V  GL V +     GL+ LI   NI    +  E +G+ I P +NA GR+ 
Sbjct: 233 VSLTDENRIMVKAGLEVMKDSERIGLQELISLSNIDLKTLNEETIGFKIAPQLNALGRLD 292

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           + N    LL   D +E + +A  +D  N+ R+ +   + +QA   +       Q   V V
Sbjct: 293 DPNPAIELLTGFDDEESQAIAQMIDQKNEERKEIVQTIFDQAMQML------DQTKPVQV 346

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + WHPG++G++A R+ E+ G+P   ++  EDG   GS RS+E  DI    +F     
Sbjct: 347 LAKENWHPGVLGIVAGRILERTGQPVIVLN-IEDGIAKGSARSVEALDI--FQAFDQHRE 403

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           + +  GGH+ AAG+T+E    G L      +       +       ID  L    +++  
Sbjct: 404 LFIAFGGHSGAAGMTLEESKVGDLSQVLCDYISKKQLDMGQKKTLTIDSELRFDELSLDT 463

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYG 550
           +   E   P+G  N  PVF   + K+   RV+     HL++  E QD + L  +AF + G
Sbjct: 464 VRDFEKLAPFGMDNKKPVFLLKDFKVSQARVMGQNGAHLKLKLE-QDGQALDLVAFNM-G 521

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           + L EF    + + + +   L VN W G+   QL + DA       F  +
Sbjct: 522 SQLQEF---QQAQHLELAVTLSVNQWNGATTLQLMLEDARVDGIQLFDIR 568


>gi|169829358|ref|YP_001699516.1| single-stranded-DNA-specific exonuclease recJ [Lysinibacillus
           sphaericus C3-41]
 gi|168993846|gb|ACA41386.1| Single-stranded-DNA-specific exonuclease recJ [Lysinibacillus
           sphaericus C3-41]
          Length = 773

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 181/593 (30%), Positives = 297/593 (50%), Gaps = 27/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           +S  RW     +  +    A+     +  I A++L  R   +   A+  LN +   +  D
Sbjct: 3   LSKKRWQV--ERPDVELVQALQNDLQLSAIAAKILAARGCETTADAESLLNMTEANVH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P ++    +A  RI QA+ N EKI+++GDYD DG  S  +M+  L     N +  IP+R 
Sbjct: 60  PFLMHGMAEAVARIEQALDNGEKILVYGDYDADGVTSTTVMLNVLLDLGANVSFKIPNRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           + GYGP+ +L  +   EG QLIITVD G +  + ++ A   G+DVIV DHH+   E  PA
Sbjct: 120 IHGYGPHEALFREAYEEGVQLIITVDNGISGIEPIRVAKELGLDVIVTDHHEPGEELPPA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
             +++P   +     G L   GV F +   +Y  L              L++ VA+ TV 
Sbjct: 180 DIILHPRLPEGHYPFGELAGVGVAFKLAHALYGELP-----------THLIEYVAIGTVA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL+  NR  V +G+   RR  +P ++A+ +  +     I+ E +G+  GP +NA GR
Sbjct: 229 DLVPLVDENRYLVKRGIEEMRRSLSPWVQAMCDIASTEQAKISEETIGFYFGPRLNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +GE++ G  LL+++DS +   LA +L+  N  R+ +   + E+A A + ++   I  + V
Sbjct: 289 LGEASPGVELLMAEDSVKATALAKQLNASNTERKDIVKNITEEAIALIESE-KKISDSLV 347

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAV 429
           +VV G+ W+ G+VG++A+RL E++ RP+  +S   + G   GS RSI+GF +      A 
Sbjct: 348 LVVAGEGWNAGVVGIVASRLVEQYYRPTIVLSLDPDKGTAKGSARSIDGFHLY--NELAK 405

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L       A   +     TPV  ID  L+   ++
Sbjct: 406 NRDILPHFGGHPMAAGMTLSIEHVDELRSRLDTQARACLTEEHLTPVVHIDIPLSLDEIS 465

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFR 547
              I+ + S GP+G   P PV+   + ++ S+R +     H++M   +   + L ++ F 
Sbjct: 466 ADAIEEIASLGPFGTDFPKPVYVLEDVEISSMRKIGAAENHIKMEL-TNGCDKLDSVGF- 523

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
             G    E    + G ++   G L +N W+G K+ Q  + D    E   F  +
Sbjct: 524 HKGHLHDEL---TYGIKVSFIGDLQINEWQGRKKAQFMIEDVQTTEWQLFDIR 573


>gi|255011348|ref|ZP_05283474.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides fragilis
           3_1_12]
 gi|313149162|ref|ZP_07811355.1| single-stranded-DNA-specific exonuclease recJ [Bacteroides fragilis
           3_1_12]
 gi|313137929|gb|EFR55289.1| single-stranded-DNA-specific exonuclease recJ [Bacteroides fragilis
           3_1_12]
          Length = 572

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 168/584 (28%), Positives = 277/584 (47%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W      QE    + A+ Q+  I  ++ ++LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYRPITQEQAETSRALAQELGISPVLGQLLVQRGITKAQDAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+  A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDIAVERLNMAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNLDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGISKKGVDYAAETGVGLIIVLDCGIKAVEEITYAKEKGIDFIICDHHVPDDVLPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +         +        L+ LLDL A++   D+V
Sbjct: 183 LNAKRLDNTYPYTHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDLTAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAYHGLKQLNSNPSVGLKAIIDVCGLSEKEITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++ +M E+A  K++ + + +     IV+
Sbjct: 298 GKEAVDLLIEKDFSTALEKAGQINQYNETRKDLDKSMTEEA-NKIVAELEGLVDRRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K +       +
Sbjct: 357 YNEDWHKGVIGIVASRLTEIYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEHC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N     + F+ F    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVQAFTERFESFVSEHILPEQTSAVIDIDAEIDFKDITPKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  PVF   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NELKRFNPFGPDNQKPVFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 534 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 572


>gi|303229401|ref|ZP_07316191.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515937|gb|EFL57889.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 664

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 191/580 (32%), Positives = 300/580 (51%), Gaps = 24/580 (4%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLIL 75
            RW  +           + ++  +  IVAR++VNRN+  D    FL  +++ L+ DP  L
Sbjct: 4   KRWHIMPRNVEKEN--TLIRELGVNPIVARLMVNRNIDSDEGHRFLEGTLKDLL-DPFTL 60

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D + A   I++ I   + I+++GDYDVDG  + +L+ RFL       + YIP+R  +GY
Sbjct: 61  KDMETAVALILETIEAEKSIVVYGDYDVDGITATSLLYRFLVKMGARVSYYIPERQSEGY 120

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   ++  I++GA L+ITVDCG +SYD ++   ++ ID+I+ DHH    +  PA A++
Sbjct: 121 GLNLEALDHIISDGASLVITVDCGISSYDIVEAVCDR-IDIIITDHHTAPPQIPPARAVI 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           N  + D      +L   GV F +   ++  LRQ          L  LD+VAL TV DVVP
Sbjct: 180 NHKQPDCPYRDKNLSGVGVAFKLCQALW--LRQCG-----EWYLDDLDIVALGTVADVVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGES 314
           L+G NR  V  GL       N G+  LI+        ITA ++G+ + P +NA GR+  +
Sbjct: 233 LVGENRIIVQAGLKKMNELPNLGIDKLIDVAGLHDKTITAGHIGFTLAPRLNAAGRVTHA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL++DD    E +A +L   N  R+ +E ++ E+A A V  Q        V VV 
Sbjct: 293 TRAVELLVTDDVDLAETIAQELQETNMERQEIERSIHEEARANVAAQGHLA--GYVTVVA 350

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
           G+ WHPG++G++A+RL E+F +P+  IS  ++G G GS RSIEGF+I   + F   E IL
Sbjct: 351 GENWHPGVIGIVASRLVEEFYKPTLVIS-IDNGVGKGSCRSIEGFNIYNALKFC--EDIL 407

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           ++ GGHA AAG +++      L     ++    V      PV  ID  L    +++ ++D
Sbjct: 408 IQFGGHAAAAGFSIDASRIDELRQRLTEYCKAHVSPDEYIPVVSIDATLPVDDIDVDIVD 467

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGTP 552
            + +  PYG GN  P+F   + K+Q I ++     H ++   + +  ++ AIA+      
Sbjct: 468 RVSALEPYGMGNSTPIFGVMDAKVQDIMLMGQLKNHCKVILATANG-SVDAIAWNRPDL- 525

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
              F    +G  + V   L  N W+G    QL + D  P+
Sbjct: 526 ---FRHIFQGMNVKVAFTLQKNEWQGFVSPQLMIQDIEPI 562


>gi|320540118|ref|ZP_08039773.1| ssDNA exonuclease, 5' --> 3'-specific [Serratia symbiotica str.
           Tucson]
 gi|320029784|gb|EFW11808.1| ssDNA exonuclease, 5' --> 3'-specific [Serratia symbiotica str.
           Tucson]
          Length = 576

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 180/565 (31%), Positives = 277/565 (49%), Gaps = 19/565 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V  +     L  S++ ++P    L+  D A   + QA+ +   IM+
Sbjct: 21  NLPPLLRRLYALRGVQGEQE---LERSVKGMLP-WQQLSGIDTAVGILEQALVDCRSIMV 76

Query: 98  FGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
            GD+D DGA S AL +  L     + +  +P+R  DGYG +P ++E+    GA+LI+TVD
Sbjct: 77  LGDFDADGATSTALTVLALRSMGGSVDYLVPNRFEDGYGLSPEVVEQAAARGAELIVTVD 136

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S+  +  A   G+ V+V DHHQ       A A+VNPN          L   GV F 
Sbjct: 137 NGVSSHAGVDVAHANGMQVLVTDHHQPGETLPAAEAIVNPNLRGCEFPSKSLAGVGVAFY 196

Query: 218 VLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR 273
           +++ +   LR             +L  LLDLVAL TV DVVPL   NR  V +GL   R 
Sbjct: 197 LMLALRARLRDSGWFAQRALATPNLAELLDLVALGTVADVVPLDTNNRILVYQGLHRIRA 256

Query: 274 -QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
            +  PG++AL+E        + A +LG+ +GP +NA GR+ + ++G  LL+SDD  +  M
Sbjct: 257 GKCRPGIRALLEVAKRDARQLVASDLGFALGPRLNAAGRLDDMSVGVALLLSDDIAQARM 316

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLT-QCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
           LA  LD LNQ RR +E  M  +A       +    +    + +    WH G+VG+LA+R+
Sbjct: 317 LANDLDTLNQTRREIEQGMQIEALHLCDQLERTSTELPYGLAMYHPEWHQGVVGILASRI 376

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE--EGILVKGGGHAMAAGLTV 448
           KE+F RP  A +   DG   GSGRS+ G  +   +        G+++  GGHAMAAGL++
Sbjct: 377 KERFHRPVIAFAPVGDGILKGSGRSVAGLHMRDALERLDMLSPGLMMTFGGHAMAAGLSL 436

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
           E   F      F +     +   +   V   DG L+   +++   ++L   GP+G   P 
Sbjct: 437 EEAKFDEFRQRFGELVGEWLDPAMLEGVIWSDGELSMQELSLTTAELLRDGGPWGQAFPE 496

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P F     ++   R+V   HL++  E       L  IAF V  T   +    S  + + +
Sbjct: 497 PTFDGR-FRILQQRLVGEKHLKLMVEPLGGGPLLDGIAFNVDTTLWPD----SSVREVEL 551

Query: 568 TGHLCVNYWRGSKRCQLRVLDASPV 592
              L +N +RG++  QL +    P 
Sbjct: 552 AYKLDINEFRGNRNVQLLIQHLWPH 576


>gi|152976827|ref|YP_001376344.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152025579|gb|ABS23349.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus cytotoxicus
           NVH 391-98]
          Length = 779

 Score =  416 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 180/589 (30%), Positives = 284/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + + R +  +    DF N +      DP +L
Sbjct: 7   RWKEKTYNE--ELVRELASKLQLSPLVVSLFLGRGLDTEDKIMDFFN-TAEQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ QAI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDRTVERVKQAIQNGEQILIFGDYDADGVSSTTVLFLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN          G  LIITVD G  +    Q A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHQAGFSLIITVDTGIAAVHEAQVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+++ P INA GR+ ++
Sbjct: 233 LHGENRLIVQRGLKHMRMTKNIGLKALFKVANVSQSEITEESIGFLLAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A  +V  +    +   V+V+ 
Sbjct: 293 APAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIIEVECKYPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S + E     GS RSIEGFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLSIDSEKQIAKGSARSIEGFDL--FANLSDCRDL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A+ ++      P+  ID V     V ++ I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQANAVLVEEDFIPITTIDAVCKVEDVTLSAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  +  L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPCIAVKDADLESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G + +N W   K+ QL V D +      F  +
Sbjct: 527 --AYAKEISPVAKVSVVGEVSINEWNNFKKPQLMVQDIAVEAWQLFDWR 573


>gi|299535667|ref|ZP_07048988.1| single-stranded-DNA-specific exonuclease recJ [Lysinibacillus
           fusiformis ZC1]
 gi|298728867|gb|EFI69421.1| single-stranded-DNA-specific exonuclease recJ [Lysinibacillus
           fusiformis ZC1]
          Length = 776

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 180/593 (30%), Positives = 291/593 (49%), Gaps = 27/593 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           +S  RW     +       A+     +  I A++L  R   +   A+  LN +   +  D
Sbjct: 3   LSKKRWQV--ERPDATLVQALQNDLQLSAIAAKILAARGCETTADAESLLNMTEANIH-D 59

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P ++    +A  RI QA+ N EKI+++GDYD DG  S  +M+  L     + +  IP+R 
Sbjct: 60  PFLMHGMAEAVARIEQALENGEKILVYGDYDADGVTSTTVMLHVLLDLGADVSFKIPNRF 119

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
           + GYGP+ +L  +   EG QLIITVD G +  + ++ A   G+DVIV DHH+   E  PA
Sbjct: 120 IHGYGPHEALFREAYEEGVQLIITVDNGISGIEPIRVAKELGMDVIVTDHHEPGEELPPA 179

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
             +++P   +     G L   GV F +   +Y  L              L++ VA+ TV 
Sbjct: 180 DIILHPRIPEGQYPFGELAGVGVAFKLAHALYGELP-----------SHLIEFVAIGTVA 228

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGR 310
           D+VPL+  NR  V +G+   RR  +P ++AL +  +     IT E +G+  GP  NA GR
Sbjct: 229 DLVPLVDENRYLVKRGIQEMRRSLSPWVQALCDIASTEQTKITEETIGFYFGPRFNAVGR 288

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +GE+  G  LL+++D+ +   LA KL+  N  R+ +  ++ ++A A +    + I  + V
Sbjct: 289 LGEAAPGVELLMAEDNAKATALAKKLNACNTERKDIVKSITDEAIALIEAD-EKIGHSLV 347

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAV 429
           +VV G+ W+ G+VG++A+RL E + RP+  +S   E G   GS RSIEGF +      A 
Sbjct: 348 LVVAGEGWNAGVVGIVASRLVELYYRPTIVLSLDPEKGMAKGSARSIEGFHLY--NELAK 405

Query: 430 EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVN 489
              IL   GGH MAAG+T+   +   L       A   +     TPV  ID  L+   ++
Sbjct: 406 NRDILPHFGGHPMAAGMTLSLEHVDELRTRLDAQARACLTEEQLTPVVHIDIPLSIDEIS 465

Query: 490 IALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV--NLAHLQMTFESQDSETLQAIAFR 547
              I+ + + GP+G   P PV+   + ++ S+R +     H++M   +   + L ++ F 
Sbjct: 466 ADAIEEISTLGPFGTDFPKPVYVLEDVEIASMRKIGAGENHIKMEI-TNGYDKLDSVGFN 524

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                       + G ++   G L +N W+G K+ Q  + D    E   F  +
Sbjct: 525 KGHLH----DELTYGIKVSFIGDLQINEWQGRKKAQFMIEDVQTTEWQLFDIR 573


>gi|253566348|ref|ZP_04843802.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           3_2_5]
 gi|251945452|gb|EES85890.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           3_2_5]
 gi|301164670|emb|CBW24229.1| putative single-stranded-DNA-specific exonuclease [Bacteroides
           fragilis 638R]
          Length = 572

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 169/584 (28%), Positives = 277/584 (47%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W      QE    + A+ Q+  I  ++ R+LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYRPITQEQAEISRALAQELGISPVLGRLLVQRGITKAQDAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+  A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDIAVERLNMAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNLDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGISKKGVDYAAETGVGLIIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDDVLPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +         +        L+ LLDL A++   D+V
Sbjct: 183 LNAKRLDNTYPYTHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDLTAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAYHGLKQLNGNPSVGLKAIIDVCGLSEKEITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++ +M E+A  K++ + + +     IV+
Sbjct: 298 GKEAVDLLIEKDFSAALEKAGQINQYNETRKDLDKSMTEEA-NKIVAELEGLADRRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K +       +
Sbjct: 357 YNEDWHKGVIGIVASRLTEIYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEHC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N     + F+ F    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVQAFTERFESFVSEHILPEQTSAVIDIDAEIDFKDITPKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  PVF   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NELKRFNPFGPDNQKPVFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 534 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 572


>gi|262384491|ref|ZP_06077625.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           2_1_33B]
 gi|301309112|ref|ZP_07215056.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           20_3]
 gi|262293784|gb|EEY81718.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           2_1_33B]
 gi|300832794|gb|EFK63420.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           20_3]
          Length = 574

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 172/582 (29%), Positives = 286/582 (49%), Gaps = 21/582 (3%)

Query: 17  RWVSL-LGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
           +W      +E +++   +  +     ++  +LV R ++  + AK F  PS+  L  DP +
Sbjct: 4   KWNFQTPSEEELHKRDQLVAELGFSPVICLLLVQRGITSIEEAKKFFKPSLNDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D DKA RR+ +A+ N EKI+I+GDYDVDG  +V+L+ ++L   S   + YIPDR  +G
Sbjct: 63  MPDMDKAVRRLNKALGNKEKILIYGDYDVDGTTAVSLVFKYLRPYSSTLDFYIPDRYDEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  L+I++DCG  + + ++YA  +GID I+ DHH   +    A A+
Sbjct: 123 YGISYKGIDYAAENGVSLVISLDCGIKAIEKIEYAKEKGIDFIICDHHMPDATLPDAVAV 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++  R D +    HL   GV F  +    +     N  P +  L  LL+L A++   D+V
Sbjct: 183 LDAKRSDSIYPYEHLSGCGVGFKFMQAFAK----SNNFPFSD-LEKLLELTAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P+ G NR     GL       + GLK +I+        IT  ++ + IGP INA GR+  
Sbjct: 238 PITGENRILAYYGLKQLNSNPSLGLKGIIDICGLTGKEITISDIVFKIGPRINASGRMMN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL+S DS      +  ++  N+ RR ++  + ++A A V+ + +++     IVV
Sbjct: 298 GKEAVELLLSKDSASAREKSESINQYNEERRELDKKITDEANA-VIDEVENMDDRKAIVV 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WH G++G++A+RL EK+ RP+  ++   +    GS RS+ GFDI K +       +
Sbjct: 357 YNPGWHKGVIGIVASRLTEKYYRPAVVLTKSSE-LITGSARSVTGFDIYKAIESC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL++   N     + F K A   +      P   ID +L+   +N   +
Sbjct: 414 LENFGGHTYAAGLSLREENLEAFTERFLKIASEEIIPEQMIPQIDIDAILDLKEINQKFV 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNHK-LQSIRVVNL--AHLQMTFESQDSET-LQAIAFRVY 549
           + L+   P+G  N  PVF     K   + ++V     HL++     +S T + AIAF ++
Sbjct: 474 NDLKKMSPFGPDNQKPVFCSLGVKDYGTSKLVGKELEHLKLELIDGNSSTPMHAIAFGMH 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
                        K  ++   +  N + G+   QL + D  P
Sbjct: 534 RHN----DHIKGMKPFNICYTVEENTYNGNTSIQLMIKDIKP 571


>gi|323344224|ref|ZP_08084450.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella oralis
           ATCC 33269]
 gi|323094953|gb|EFZ37528.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella oralis
           ATCC 33269]
          Length = 577

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 159/587 (27%), Positives = 276/587 (47%), Gaps = 22/587 (3%)

Query: 16  FRWVSLLGQEGINRALA-ITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W          +A   + +K  I  I+A +L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWNYEPPTPQEEQAAKELGEKLNINQILALLLIRRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+   E+I+++GDYDVDG  +VAL+ +FL     N + YIPDR  +
Sbjct: 62  LMKDMDIAVDRLNDAMGRKERILVYGDYDVDGCTAVALVYKFLQQFYSNVDYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   ++   + G +LI+ +DCG  + + + YA + GID I+ DHH        A A
Sbjct: 122 GYGVSKKGIDYAKDTGVKLIVILDCGIKAIEEIAYAKSLGIDFIICDHHVPDEVMPCAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD     HLC  GV F ++    +     N       L+ LLD  A++   D+
Sbjct: 182 ILNPKRPDDSYPFKHLCGCGVGFKLMQAFAK-----NNGIPFSRLIPLLDFCAVSIAADI 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP+   NR     GL    +  + GLKA+I+   ++   I+  ++ + IGP INA GR+ 
Sbjct: 237 VPVTDENRILAFHGLKQLNQNPSIGLKAIIDICGLNGRDISMSDIVFKIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  D       A  ++  N+ R+ ++  M E+A  +++ + +  +  S IV
Sbjct: 297 NGKESVDLLVEKDFSSALTQAKHINEYNEQRKDIDKQMTEEA-NQIVAKLESQKHHSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  ++  +     GS RS+ GFD+   +       
Sbjct: 356 LYDENWKKGVIGIVASRLTEIYFRPTVVLT-RDGDFATGSARSVTGFDLYAAIKSC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           IL+  GGH  A GLT+   +       FQ++    +          ID  ++   +   L
Sbjct: 413 ILINFGGHTYATGLTLRWNDVPEFRKRFQRYVEEHIQPEQIEANLNIDAQIDFKDITKRL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
            + L+   P+G  N  P+F   +     + +VV     H+++     + S  +  IAF  
Sbjct: 473 HNELKKFSPFGPCNTKPIFCTTDVYDYGTSKVVGRIQEHIKLELVDSKSSNVVNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
             +           +   +   +  N ++     QL++ D  P E  
Sbjct: 533 SAS----ARYIKSKRSFDIAYTIENNIFK-RNAVQLQIEDIRPTEDE 574


>gi|150008372|ref|YP_001303115.1| single-stranded-DNA-specific exonuclease RecJ [Parabacteroides
           distasonis ATCC 8503]
 gi|255015620|ref|ZP_05287746.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           2_1_7]
 gi|256839338|ref|ZP_05544847.1| single-stranded-DNA-specific exonuclease RecJ [Parabacteroides sp.
           D13]
 gi|298375012|ref|ZP_06984969.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           3_1_19]
 gi|149936796|gb|ABR43493.1| single-stranded-DNA-specific exonuclease RecJ [Parabacteroides
           distasonis ATCC 8503]
 gi|256738268|gb|EEU51593.1| single-stranded-DNA-specific exonuclease RecJ [Parabacteroides sp.
           D13]
 gi|298267512|gb|EFI09168.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           3_1_19]
          Length = 574

 Score =  416 bits (1068), Expect = e-114,   Method: Composition-based stats.
 Identities = 172/582 (29%), Positives = 286/582 (49%), Gaps = 21/582 (3%)

Query: 17  RWVSL-LGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
           +W      +E +++   +  +     ++  +LV R ++  + AK F  PS+  L  DP +
Sbjct: 4   KWNFQTPSEEELHKRDQLVAELGFSPVICLLLVQRGITSIEEAKKFFKPSLNDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D DKA RR+ +A+ N EKI+I+GDYDVDG  +V+L+ ++L   S   + YIPDR  +G
Sbjct: 63  MPDMDKAVRRLNKALGNKEKILIYGDYDVDGTTAVSLVFKYLRPYSSTLDFYIPDRYDEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  L+I++DCG  + + ++YA  +GID I+ DHH   +    A A+
Sbjct: 123 YGISYKGIDYAAENGVSLVISLDCGIKAIEKIEYAKEKGIDFIICDHHMPDATLPDAVAV 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++  R D +    HL   GV F  +    +     N  P +  L  LL+L A++   D+V
Sbjct: 183 LDAKRSDSIYPYEHLSGCGVGFKFMQAFAK----SNNFPFSD-LEKLLELTAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P+ G NR     GL       + GLK +I+        IT  ++ + IGP INA GR+  
Sbjct: 238 PITGENRILAYYGLKQLNSNPSLGLKGIIDICGLTGKEITISDIVFKIGPRINASGRMMN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL+S DS      +  ++  N+ RR ++  + ++A A V+ + +++     IVV
Sbjct: 298 GKEAVELLLSKDSASAREKSESINQYNEERRELDKKITDEANA-VIDEVENMDDRKAIVV 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
               WH G++G++A+RL EK+ RP+  ++   +    GS RS+ GFDI K +       +
Sbjct: 357 YNPGWHKGVIGIVASRLTEKYYRPAVVLTKSSE-LITGSARSVTGFDIYKAIESC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL++   N     + F K A   +      P   ID +L+   +N   +
Sbjct: 414 LENFGGHTYAAGLSLREENLEAFTERFLKIASEEIIPEQMIPQIDIDAILDLKEINQKFV 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNHK-LQSIRVVNL--AHLQMTFESQDSET-LQAIAFRVY 549
           + L+   P+G  N  PVF     K   + ++V     HL++     +S T + AIAF ++
Sbjct: 474 NDLKKMSPFGPDNQKPVFCSLGVKDYGTSKLVGKELEHLKLELIDGNSSTPMHAIAFGMH 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
                        K  ++   +  N + G+   QL + D  P
Sbjct: 534 RYN----DHIKGMKPFNICYTVEENTYNGNTSIQLMIKDIKP 571


>gi|313500298|gb|ADR61664.1| Single-stranded-DNA-specific exonuclease RecJ [Pseudomonas putida
           BIRD-1]
          Length = 569

 Score =  416 bits (1068), Expect = e-114,   Method: Composition-based stats.
 Identities = 178/562 (31%), Positives = 280/562 (49%), Gaps = 18/562 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V  +     L+ S+  L+P    L   +     +V+AI   ++I+I
Sbjct: 17  NLPPLLTRLYAARGVQSE---AELDKSLARLLPY-QQLKGIEAGVDLLVEAIDQRQRILI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQRQPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S D +  A   G+ V+V DHH    +   A A++NPN+         L   GV+F
Sbjct: 133 DNGISSVDGVAAAKAAGLKVLVTDHHLPGEQLPDADAIINPNQPGCAFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKV--PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
            VL+ +   LR   +       ++  LLDLVAL +V DVVPL   NR  V +GL   R  
Sbjct: 193 YVLMALRARLRSLGRYETQPQPNIGELLDLVALGSVADVVPLDANNRILVHQGLERIRAG 252

Query: 274 QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PGLKA++E        IT+ +LG+++GP +NA GR+ + +LG   L+ +D+   + +
Sbjct: 253 RARPGLKAILEVARRDHRRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCEDAALAQDM 312

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           A +LD LNQ+R+ +E  M  +A A++     +      + +    WH G++G+LA+RLKE
Sbjct: 313 AQQLDDLNQDRKSIEQGMQREALAQLKDLPVE-SMPYGLCLFDADWHQGVIGILASRLKE 371

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTVER 450
           ++ RP+ A +   DG   GS RS+ GF I   +    A    ++ K GGHAMAAGL++  
Sbjct: 372 RYHRPTIAFADAGDGMLKGSARSVPGFHIRDALDAVAARHPHLISKFGGHAMAAGLSLPE 431

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            NF    + F +     +     T     DG L     ++ L   L  AGP+G   P P+
Sbjct: 432 GNFPAFAEAFDEEVRRQLREEDLTGRLLSDGSLAVEEFHLDLAKALRHAGPWGQHFPEPL 491

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F     +L   RVV   HL++  +S+  S  L  IAF V      E       + + +  
Sbjct: 492 FHG-VFQLVEQRVVGERHLKVVLKSECGSVRLDGIAFGVDR----EVWPNPTVRWVELAY 546

Query: 570 HLCVNYWRGSKRCQLRVLDASP 591
            L VN +RG++  QL +    P
Sbjct: 547 KLDVNEFRGNESVQLMIAHMEP 568


>gi|60683150|ref|YP_213294.1| putative single-stranded-DNA-specific exonuclease [Bacteroides
           fragilis NCTC 9343]
 gi|265767046|ref|ZP_06094875.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           2_1_16]
 gi|60494584|emb|CAH09385.1| putative single-stranded-DNA-specific exonuclease [Bacteroides
           fragilis NCTC 9343]
 gi|263253423|gb|EEZ24899.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           2_1_16]
          Length = 572

 Score =  416 bits (1068), Expect = e-114,   Method: Composition-based stats.
 Identities = 169/584 (28%), Positives = 277/584 (47%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W      QE    + A+ Q+  I  ++ R+LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYRPITQEQAEISRALAQELGISPVLGRLLVQRGITKAQDAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+  A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDIAVERLNMAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNLDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGISKKGVDYAAETGVGLIIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDDILPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +         +        L+ LLDL A++   D+V
Sbjct: 183 LNAKRLDNTYPYTHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDLTAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAYHGLKQLNGNPSVGLKAIIDVCGLSEKEITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++ +M E+A  K++ + + +     IV+
Sbjct: 298 GKEAVDLLIEKDFSAALEKAGQINQYNETRKDLDKSMTEEA-NKIVAELEGLADRRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K +       +
Sbjct: 357 YNEDWHKGVIGIVASRLTEIYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEHC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N     + F+ F    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVQAFTERFESFVSEHILPEQTSAVIDIDAEIDFKDITPKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  PVF   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NELKRFNPFGPDNQKPVFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 534 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 572


>gi|212693913|ref|ZP_03302041.1| hypothetical protein BACDOR_03435 [Bacteroides dorei DSM 17855]
 gi|265751302|ref|ZP_06087365.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           3_1_33FAA]
 gi|212663445|gb|EEB24019.1| hypothetical protein BACDOR_03435 [Bacteroides dorei DSM 17855]
 gi|263238198|gb|EEZ23648.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           3_1_33FAA]
          Length = 590

 Score =  415 bits (1067), Expect = e-114,   Method: Composition-based stats.
 Identities = 167/584 (28%), Positives = 273/584 (46%), Gaps = 22/584 (3%)

Query: 17  RWVSLLG-QEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLI 74
           +W      QE    A A+ ++  I  I+ ++L+ R ++    AK F  P +  L  DP +
Sbjct: 21  KWNYQPPSQEQTEAAKALAKETGISPILCKLLLERGITSAAEAKRFFRPQLNELH-DPFL 79

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D   A  R+ QA+   E+IM++GDYDVDG  +VAL+ +FL     N + YIPDR  +G
Sbjct: 80  MKDMSIAVERLNQAMGRKERIMVYGDYDVDGTTAVALVYKFLQQFYSNIDYYIPDRYNEG 139

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G +LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 140 YGVSVKGVDYACETGVKLIIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDDILPPAVAI 199

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  R D+     HL   GV F  +          N       L  LLDLVA++   D+V
Sbjct: 200 LNAKRADNTYPYDHLSGCGVGFKFMQAFA-----LNNGIEFHQLTPLLDLVAVSVASDIV 254

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 255 PIMGENRVLTHHGLKQLNSNPSVGLKAIIDVCGLSEKEITVGDIVFKIGPRINASGRIQN 314

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++  M E+A  +++   + +     IV+
Sbjct: 315 GKEAVELLIEKDFSAALEKANQINQYNETRKDLDKTMTEEA-NQIVDHLEGLADRRSIVI 373

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +     GS RS+ GFD+ K + +     +
Sbjct: 374 YNEAWHKGVIGIVASRLTEIYYRPAVVLTRTD-NLATGSARSVSGFDVYKAIEYC--RDL 430

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+ +    +    T+ V  ID  ++   +     
Sbjct: 431 LENFGGHTYAAGLSMKVENVEEFTRRFETYVTEHILPEQTSAVIDIDAEIDFRDITPKFH 490

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
             L+   P+G  N  P+F   N     + +VV     H+++     + +  +  IAF   
Sbjct: 491 ADLKKFNPFGPDNHKPIFCTHNVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 550

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                +       +   +   +  N  +     QL++ D  P E
Sbjct: 551 ----SQARYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPSE 589


>gi|189346100|ref|YP_001942629.1| single-stranded-DNA-specific exonuclease RecJ [Chlorobium limicola
           DSM 245]
 gi|189340247|gb|ACD89650.1| single-stranded-DNA-specific exonuclease RecJ [Chlorobium limicola
           DSM 245]
          Length = 571

 Score =  415 bits (1067), Expect = e-114,   Method: Composition-based stats.
 Identities = 167/577 (28%), Positives = 266/577 (46%), Gaps = 19/577 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
           + WV L  QE   +   +     +   +AR L NR ++  + AK F  PSI  L   P +
Sbjct: 4   YSWVRLEPQE--KQVSLLAGAINVSHPLARALCNRGITTFEEAKTFFRPSISQL-SSPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L + ++AA R++ A+ N EKI+++GDYDVDG    AL+  FL         YI DR  +G
Sbjct: 61  LQNMERAAERVIAALNNHEKILLYGDYDVDGTTGTALLCLFLRDQGAEVFYYINDRFTEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   +      G  LIIT+DCG  + +A++     GIDVIV DHH+   E  PA+A+
Sbjct: 121 YGLSSEGIAYAEKSGVSLIITIDCGIRAGEAIERCAQAGIDVIVCDHHE-PDELPPAFAI 179

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP   +       LC   V F ++  +   L               LDLVA+AT  D+V
Sbjct: 180 LNPKVPECTYPFRELCGCAVAFRLVQAVAERLGAGE-----ESWKQYLDLVAIATAADMV 234

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGE 313
            L   NR  V +GL   R      L  ++  + I +  +T  ++ + + P INA GR+  
Sbjct: 235 SLEKENRILVNEGLKRIRISPRKSLSGMLSVMGIDAGTMTMYHIAFGLAPRINAAGRMHS 294

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
           ++L    L++         A  LD +N  RR +++A+  +A+  +  +       S IV+
Sbjct: 295 AHLAVEWLLAATETGALETAQALDRMNLERREIDTAIFSRADRMI--EGHFASYCSSIVL 352

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+R+ EK+  P+  +     G   GS RS+EG +I +++        
Sbjct: 353 YDEEWHLGVLGIVASRMLEKYYLPTVIMGSMN-GMIKGSVRSVEGINIYEVLQEC--SDH 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           LV+ GGH  AAG+T+   +       F      ++PA        ID  L    +    +
Sbjct: 410 LVQFGGHNQAAGITLRPEDLAGFRKKFDNICAALLPADKRQKELVIDSSLQLEEITANFM 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
           ++L+   PYG GN  PVF      L    R++   H++ +    +      I F      
Sbjct: 470 NVLDQFAPYGFGNREPVFETSAVVLVGRPRLLKEKHVKFSVRDGNGRLFDVIGFDRKDVF 529

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
             + L    G R  +   L    W   ++ QLR+ D 
Sbjct: 530 --QILDADPGIRFSMAYSLEKRSWNNREQWQLRLKDL 564


>gi|304396713|ref|ZP_07378593.1| single-stranded-DNA-specific exonuclease RecJ [Pantoea sp. aB]
 gi|304355509|gb|EFM19876.1| single-stranded-DNA-specific exonuclease RecJ [Pantoea sp. aB]
          Length = 578

 Score =  415 bits (1067), Expect = e-114,   Method: Composition-based stats.
 Identities = 182/564 (32%), Positives = 277/564 (49%), Gaps = 19/564 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           +P ++ R+ + R V        L    + L+P    L+  + A   + QA+ +  +IM+ 
Sbjct: 23  LPPLLKRLYLQRGVRDA---AELERGAKNLLPY-QSLSGIESAVELLHQALLDGRRIMVV 78

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L      N    +P+R  DGYG +P ++E+    GA +I+TVD
Sbjct: 79  GDFDADGATSTALTVMALRSMGGGNVQYLVPNRFEDGYGLSPEVVEQARARGAAMILTVD 138

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S+  + +A   GI V++ DHH        A A+VNPN  D       L   GV F 
Sbjct: 139 NGISSHAGVDFAHQHGIPVLITDHHLPGETLPAAEAIVNPNLPDCNFPSRALAGVGVAFY 198

Query: 218 VLVLIYRILRQDNKV---PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
           +++ +   LR            +L  +LDLVAL TV DVVPL   NR  V +GL   R  
Sbjct: 199 LMLALRAHLRTQGWFGTTRTEPNLAEMLDLVALGTVADVVPLDVNNRILVWQGLSRIRAG 258

Query: 274 QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PG++AL+E  N     + A +LG+ +GP +NA GR+ + ++G  LL++DD  +  ML
Sbjct: 259 KCRPGIRALLEIANRDARQLAASDLGFALGPRLNAAGRLDDMSVGVALLMTDDLSQARML 318

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI-VVEGDRWHPGIVGLLAARLK 391
           A +LD LNQ R+ +E  M  +A A       + +   +        WH G+VG+LA+RLK
Sbjct: 319 ASELDALNQTRKEIEQGMQSEALALCQALEREQRDLPLGLAFYHPEWHQGVVGILASRLK 378

Query: 392 EKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV--EEGILVKGGGHAMAAGLTVE 449
           E+F RP  A +   DG   GSGRSI G  +   +        G+++K GGHAMAAGL++E
Sbjct: 379 ERFHRPVIAFAPAGDGTLKGSGRSIAGLHLRDALERLDTLNPGMMLKFGGHAMAAGLSLE 438

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
              +      F       +       +   DG L     ++   +ML  AGP+G   P P
Sbjct: 439 TARYEEFRQRFADLVGEWLDGESLQGIIWSDGALQPQEFSLQTAEMLREAGPWGQAFPEP 498

Query: 510 VFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
            F     KL   R+V   HL++  E       +  IAF V  T   +    S  +++ + 
Sbjct: 499 AFDGK-FKLLQQRLVGERHLKVMVEPLDGGPLIDGIAFNVDTTLWPD----SSIRQVELA 553

Query: 569 GHLCVNYWRGSKRCQLRVLDASPV 592
             L +N +RG++  QL +    P+
Sbjct: 554 YKLDINEYRGNRSVQLIIDHIWPL 577


>gi|294776722|ref|ZP_06742186.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides vulgatus
           PC510]
 gi|294449377|gb|EFG17913.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides vulgatus
           PC510]
          Length = 590

 Score =  415 bits (1067), Expect = e-114,   Method: Composition-based stats.
 Identities = 167/584 (28%), Positives = 272/584 (46%), Gaps = 22/584 (3%)

Query: 17  RWVSLLG-QEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLI 74
           +W      QE    A A+ ++  I  I+ ++L+ R ++    AK F  P +  L  DP +
Sbjct: 21  KWNYQPPSQEQTEAAKALAKETGISPILCKLLLERGITSAAEAKRFFRPQLNELH-DPFL 79

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D   A  R+ QA+   E+IM++GDYDVDG  +VAL+ +FL     N + YIPDR  +G
Sbjct: 80  MKDMSIAVERLNQAMGRKERIMVYGDYDVDGTTAVALVYKFLQQFYSNIDYYIPDRYNEG 139

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G +LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 140 YGVSVKGVDYACETGVKLIIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDDILPPAVAI 199

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  R D+     HL   GV F  +          N       L  LLDLVA++   D+V
Sbjct: 200 LNAKRADNTYPYDHLSGCGVGFKFMQAFA-----LNNGIEFHQLTPLLDLVAVSVASDIV 254

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 255 PIMGENRVLTHHGLKQLNSNPSVGLKAIIDVCGLSEKEITVGDIVFKIGPRINASGRIQN 314

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++  M E+A  +++   + +     IV+
Sbjct: 315 GKEAVELLIEKDFSAALEKANQINQYNETRKDLDKTMTEEA-NQIVDHLEGLADRRSIVI 373

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +     GS RS+ GFD+ K +       +
Sbjct: 374 YNEAWHKGVIGIVASRLTEIYYRPAVVLTRTD-NLATGSARSVSGFDVYKAIEHC--RDL 430

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+ +    +    T+ V  ID  ++   +     
Sbjct: 431 LENFGGHTYAAGLSMKVENVEEFTRRFETYVTEHILPEQTSAVIDIDAEIDFRDITPKFH 490

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
             L+   P+G  N  P+F   N     + +VV     H+++     + +  +  IAF   
Sbjct: 491 ADLKKFNPFGPDNHKPIFCTHNVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 550

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                +       +   +   +  N  +     QL++ D  P E
Sbjct: 551 ----SQARYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPSE 589


>gi|150004614|ref|YP_001299358.1| putative single-stranded-DNA-specific exonuclease [Bacteroides
           vulgatus ATCC 8482]
 gi|149933038|gb|ABR39736.1| putative single-stranded-DNA-specific exonuclease [Bacteroides
           vulgatus ATCC 8482]
          Length = 573

 Score =  415 bits (1067), Expect = e-114,   Method: Composition-based stats.
 Identities = 167/584 (28%), Positives = 272/584 (46%), Gaps = 22/584 (3%)

Query: 17  RWVSLLG-QEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLI 74
           +W      QE    A A+ ++  I  I+ ++L+ R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYQPPSQEQTEAAKALAKETGISPILCKLLLERGITSAAEAKRFFRPQLNELH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D   A  R+ QA+   E+IM++GDYDVDG  +VAL+ +FL     N + YIPDR  +G
Sbjct: 63  MKDMSIAVERLNQAMGRKERIMVYGDYDVDGTTAVALVYKFLQQFYSNIDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G +LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGVSVKGVDYACETGVKLIIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDDILPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  R D+     HL   GV F  +          N       L  LLDLVA++   D+V
Sbjct: 183 LNAKRADNTYPYDHLSGCGVGFKFMQAFA-----LNNGIEFHQLTPLLDLVAVSVASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRVLTHHGLKQLNSNPSVGLKAIIDVCGLSEKEITVGDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++  M E+A  +++   + +     IV+
Sbjct: 298 GKEAVELLIEKDFSAALEKANQINQYNETRKDLDKTMTEEA-NQIVDHLEGLADRRSIVI 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +     GS RS+ GFD+ K +       +
Sbjct: 357 YNEAWHKGVIGIVASRLTEIYYRPAVVLTRTD-NLATGSARSVSGFDVYKAIEHC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+ +    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVEEFTRRFETYVTEHILPEQTSAVIDIDAEIDFRDITPKFH 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
             L+   P+G  N  P+F   N     + +VV     H+++     + +  +  IAF   
Sbjct: 474 ADLKKFNPFGPDNHKPIFCTHNVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                +       +   +   +  N  +     QL++ D  P E
Sbjct: 534 ----SQARYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPSE 572


>gi|237708535|ref|ZP_04539016.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237724007|ref|ZP_04554488.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|229437671|gb|EEO47748.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229457464|gb|EEO63185.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 573

 Score =  415 bits (1067), Expect = e-113,   Method: Composition-based stats.
 Identities = 167/584 (28%), Positives = 273/584 (46%), Gaps = 22/584 (3%)

Query: 17  RWVSLLG-QEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLI 74
           +W      QE    A A+ ++  I  I+ ++L+ R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYQPPSQEQTEAAKALAKETGISPILCKLLLERGITSAAEAKRFFRPQLNELH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D   A  R+ QA+   E+IM++GDYDVDG  +VAL+ +FL     N + YIPDR  +G
Sbjct: 63  MKDMSIAVERLNQAMGRKERIMVYGDYDVDGTTAVALVYKFLQQFYSNIDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G +LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGVSVKGVDYACETGVKLIIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDDILPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  R D+     HL   GV F  +          N       L  LLDLVA++   D+V
Sbjct: 183 LNAKRADNTYPYDHLSGCGVGFKFMQAFA-----LNNGIEFHQLTPLLDLVAVSVASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRVLTHHGLKQLNSNPSVGLKAIIDVCGLSEKEITVGDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++  M E+A  +++   + +     IV+
Sbjct: 298 GKEAVELLIEKDFSAALEKANQINQYNETRKDLDKTMTEEA-NQIVDHLEGLADRRSIVI 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +     GS RS+ GFD+ K + +     +
Sbjct: 357 YNEAWHKGVIGIVASRLTEIYYRPAVVLTRTD-NLATGSARSVSGFDVYKAIEYC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+ +    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVEEFTRRFETYVTEHILPEQTSAVIDIDAEIDFRDITPKFH 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
             L+   P+G  N  P+F   N     + +VV     H+++     + +  +  IAF   
Sbjct: 474 ADLKKFNPFGPDNHKPIFCTHNVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                +       +   +   +  N  +     QL++ D  P E
Sbjct: 534 ----SQARYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPSE 572


>gi|53715216|ref|YP_101208.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides fragilis
           YCH46]
 gi|52218081|dbj|BAD50674.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides fragilis
           YCH46]
          Length = 572

 Score =  415 bits (1067), Expect = e-113,   Method: Composition-based stats.
 Identities = 169/584 (28%), Positives = 277/584 (47%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W      QE    + A+ Q+  I  ++ R+LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYRPITQEQAEISRALAQELGISPVLGRLLVQRGITKAQDAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+  A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDIAVERLNMAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNLDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGISKKGVDYAAETGVGLIIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDDVLPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +         +        L+ LLDL A++   D+V
Sbjct: 183 LNAKRLDNTYPYTHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDLTAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAYHGLKQLNGNPSVGLKAIIDVCGLSEKEITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++ +M E+A  K++ + + +     IV+
Sbjct: 298 GKEAVDLLIEKDFSAALEKAGQINQYNETRKDLDKSMTEEA-NKIVAELEGLVDRRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K +       +
Sbjct: 357 YNEDWHKGVIGIVASRLTEIYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEHC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N     + F+ F    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVQAFTERFESFVSEHILPEQTSAVIDIDAEIDFKDITPKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  PVF   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NELKRFNPFGPDNQKPVFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 534 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 572


>gi|148549450|ref|YP_001269552.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas putida
           F1]
 gi|148513508|gb|ABQ80368.1| exonuclease RecJ [Pseudomonas putida F1]
          Length = 569

 Score =  415 bits (1067), Expect = e-113,   Method: Composition-based stats.
 Identities = 178/562 (31%), Positives = 279/562 (49%), Gaps = 18/562 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V  +     L+ S+  L+P    L   +     +V+AI   ++I+I
Sbjct: 17  NLPPLLTRLYAARGVQSE---AELDKSLARLLPY-QQLKGIEAGVDLLVEAIDQRQRILI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQRQPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S D +  A   G+ V+V DHH    +   A A++NPN+         L   GV+F
Sbjct: 133 DNGISSVDGVAAAKAAGLKVLVTDHHLPGEQLPDADAIINPNQPGCSFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKV--PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
            VL+ +   LR   +       ++  LLDLVAL +V DVVPL   NR  V +GL   R  
Sbjct: 193 YVLMALRARLRSLGRYEAQPQPNIGELLDLVALGSVADVVPLDANNRILVHQGLERIRAG 252

Query: 274 QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PGLKA++E        IT+ +LG+++GP +NA GR+ + +LG   L+ +D+   + +
Sbjct: 253 RARPGLKAILEVARRDHRRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCEDAALAQDM 312

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           A +LD LNQ+R+ +E  M  +A A++     +      + +    WH G++G+LA+RLKE
Sbjct: 313 AQQLDDLNQDRKSIEQGMQREALAQLKDLPVE-SMPYGLCLFDADWHQGVIGILASRLKE 371

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTVER 450
           ++ RP+ A +   DG   GS RS+ GF I   +    A    ++ K GGHAMAAGL++  
Sbjct: 372 RYHRPTIAFADAGDGMLKGSARSVPGFHIRDALDAVAARHPHLISKFGGHAMAAGLSLPE 431

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            NF      F +     +     T     DG L     ++ L   L  AGP+G   P P+
Sbjct: 432 GNFPAFAKAFDEEVRRQLREEDLTGRLLSDGSLAVEEFHLDLAKALRHAGPWGQHFPEPL 491

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F     +L   RVV   HL++  +S+  S  L  IAF V      E       + + +  
Sbjct: 492 FHG-VFQLVEQRVVGERHLKVVLKSECGSVRLDGIAFGVDR----EVWPNPTVRWVELAY 546

Query: 570 HLCVNYWRGSKRCQLRVLDASP 591
            L VN +RG++  QL +    P
Sbjct: 547 KLDVNEFRGNESVQLMIAHMEP 568


>gi|282858559|ref|ZP_06267730.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella bivia
           JCVIHMP010]
 gi|282588684|gb|EFB93818.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella bivia
           JCVIHMP010]
          Length = 574

 Score =  415 bits (1067), Expect = e-113,   Method: Composition-based stats.
 Identities = 166/585 (28%), Positives = 280/585 (47%), Gaps = 22/585 (3%)

Query: 18  WV-SLLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLIL 75
           W      Q+  + A  + +K +I  I+A +L+ R ++ +  AK F  P +  L+ +P ++
Sbjct: 5   WKHISPTQQEESAAKELGEKLSISPILALILIRRGITTESAAKRFFRPQLADLI-NPFLM 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D D A  R+  A+   E+I+++GDYDVDG  SVAL+ +FL     N + YIPDR  +GY
Sbjct: 64  KDMDAAVDRLNDAMGRKERILVYGDYDVDGCTSVALVYKFLRQYYSNIDYYIPDRYEEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G +   ++       +LII +DCG  + + + YA  QGID I+ DHH       PA A++
Sbjct: 124 GVSKKGIDFAKETSVKLIIILDCGIKAIEEITYAKEQGIDFIICDHHVPDEIMPPAVAIL 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           NP R DD     HLC  GV F  +    +     N       L+ LLD  A++   D+VP
Sbjct: 184 NPKRKDDSYPFKHLCGCGVGFKFMQAFAK-----NNNIPFSRLVPLLDFCAVSIAADLVP 238

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGES 314
           ++  NR     GL    +  + GLKA+I+        +   ++ + IGP INA GR+   
Sbjct: 239 VVDENRILAYHGLKQLNQNPSLGLKAIIDICGLSERELEMSDIIFKIGPRINASGRMETG 298

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+  D  E    A  +D  N+ R+ ++  M E+A   ++ + ++ +  S IV+ 
Sbjct: 299 KESVDLLVERDFAEAVKAAKHIDEYNEQRKGVDRQMTEEANN-IVERLENQKHQSSIVLY 357

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + W  G+VG++A+RL E + RP+  ++ + +    GS RS+ GFDI + +       +L
Sbjct: 358 DEHWKKGVVGIVASRLTEIYFRPTIVLTKDGE-YATGSARSVAGFDIYEAIKSC--RDLL 414

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           +  GGH  AAGLT++  +     +  Q F  N +      P+  ID  ++   +   L +
Sbjct: 415 INFGGHTYAAGLTLKWADVKTFRERLQAFIDNHIQPHQQEPILNIDANIDFKDITKKLHN 474

Query: 495 MLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVYG 550
            L+   P+G  NP P+F+        + +VV     H+++     + +  +  IAF    
Sbjct: 475 DLKRFAPFGPSNPKPIFSTEGVYDFGTSKVVGREQEHIKLELVDSKSNNVMNGIAFGQSA 534

Query: 551 TPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
           +           +   +   +  N ++     QL++ D    E  
Sbjct: 535 S----ARYIKSKRSFDIAFTIEENVFK-RNLVQLQIEDIRRTESE 574


>gi|224535855|ref|ZP_03676394.1| hypothetical protein BACCELL_00719 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522578|gb|EEF91683.1| hypothetical protein BACCELL_00719 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 571

 Score =  415 bits (1067), Expect = e-113,   Method: Composition-based stats.
 Identities = 167/582 (28%), Positives = 275/582 (47%), Gaps = 22/582 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W       E    +  + Q+  I  I+  +LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYQPITPEQAETSQKLAQELGISPILGGLLVQRGITKAQDAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+ +A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDVAVERLNKAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNIDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGVSTKGVDYAAETGVGLIIVLDCGIKAVEEITYAKEKGIDFIICDHHVPDDVLPPAAAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +         +        L+ LLDLVA++   D+V
Sbjct: 183 LNAKRLDNTYPYEHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDLVAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAFHGLKQLNSNPSVGLKAIIDVCGLTEKDITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL   D       A +++  N+ R+ ++  M E+A  +++   + + +   IV+
Sbjct: 298 GKEAVDLLTEKDFSMALEKANQINQYNETRKDLDKTMTEEA-NQIVADLEGLAERRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K + +     +
Sbjct: 357 YNEDWHKGVIGIVASRLTEIYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEYC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F++F    +    T+ V  ID  ++   ++    
Sbjct: 414 LENFGGHTYAAGLSMKVENVPAFTKRFEEFVSQNILPEQTSAVINIDAEIDFRDISPKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   PYG  NP P+F   N     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NDLKKFNPYGPDNPKPIFCTHNVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
                        +   +   +  N  +     QL++ D  P
Sbjct: 534 ----SHVRFIKTKRSFDICYTIEENTHK-RGEVQLQIEDIQP 570


>gi|254883095|ref|ZP_05255805.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|319643615|ref|ZP_07998235.1| single-stranded-DNA-specific exonuclease [Bacteroides sp. 3_1_40A]
 gi|254835888|gb|EET16197.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|317384784|gb|EFV65743.1| single-stranded-DNA-specific exonuclease [Bacteroides sp. 3_1_40A]
          Length = 590

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 167/584 (28%), Positives = 272/584 (46%), Gaps = 22/584 (3%)

Query: 17  RWVSLLG-QEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLI 74
           +W      QE    A A+ ++  I  I+ ++L+ R ++    AK F  P +  L  DP +
Sbjct: 21  KWNYQPPSQEQTEAAKALAKETGISPILCKLLLERGITSAAEAKRFFRPQLNELH-DPFL 79

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D   A  R+ QA+   E+IM++GDYDVDG  +VAL+ +FL     N + YIPDR  +G
Sbjct: 80  MKDMSIAVERLNQAMGRKERIMVYGDYDVDGTTAVALVYKFLQQFYSNIDYYIPDRYNEG 139

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G +LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 140 YGVSVKGVDYACETGVKLIIVLDCGIKAVEEIAYAKEKGIDFIICDHHVPDDILPPAVAI 199

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  R D+     HL   GV F  +          N       L  LLDLVA++   D+V
Sbjct: 200 LNAKRADNTYPYDHLSGCGVGFKFMQAFA-----LNNGIEFHQLTPLLDLVAVSVASDIV 254

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + GLKA+I+        IT  ++ + IGP INA GRI  
Sbjct: 255 PIMGENRVLTHHGLKQLNSNPSVGLKAIIDVCGLSEKEITVGDIVFKIGPRINASGRIQN 314

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LLI  D       A +++  N+ R+ ++  M E+A  +++   + +     IV+
Sbjct: 315 GKEAVELLIEKDFSAALEKANQINQYNETRKDLDKTMTEEA-NQIVDHLEGLADRRSIVI 373

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +     GS RS+ GFD+ K +       +
Sbjct: 374 YNEAWHKGVIGIVASRLTEIYYRPAVVLTRTD-NLATGSARSVSGFDVYKAIEHC--RDL 430

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+ +    +    T+ V  ID  ++   +     
Sbjct: 431 LENFGGHTYAAGLSMKVENVEEFTRRFETYVTEHILPEQTSAVIDIDAEIDFRDITPKFH 490

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
             L+   P+G  N  P+F   N     + +VV     H+++     + +  +  IAF   
Sbjct: 491 ADLKKFNPFGPDNHKPIFCTHNVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 550

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                +       +   +   +  N  +     QL++ D  P E
Sbjct: 551 ----SQARYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPSE 589


>gi|26988210|ref|NP_743635.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas putida
           KT2440]
 gi|24982948|gb|AAN67099.1|AE016338_9 single-stranded-DNA-specific exonuclease RecJ [Pseudomonas putida
           KT2440]
          Length = 569

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 177/562 (31%), Positives = 280/562 (49%), Gaps = 18/562 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V  +     L+ S+  L+P    L   +     +V+AI   ++I+I
Sbjct: 17  NLPPLLTRLYAARGVQSE---AELDKSLARLLPY-QQLKGIEAGVDLLVEAIDQRQRILI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQRQPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S D +  A   G+ V+V DHH    +   A A++NPN+         L   GV+F
Sbjct: 133 DNGISSVDGVAAAKAAGLKVLVTDHHLPGEQLPDADAIINPNQPGCSFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKV--PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
            VL+ +   LR   +       ++  LLDLVAL +V DVVPL   NR  V +GL   R  
Sbjct: 193 YVLMALRARLRSLGRYEAQPQPNIGELLDLVALGSVADVVPLDANNRILVHQGLERIRAG 252

Query: 274 QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PGLKA++E        IT+ +LG+++GP +NA GR+ + +LG   L+ +D+   + +
Sbjct: 253 RARPGLKAILEVARRDHRRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCEDAALAQDM 312

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           A +LD LNQ+R+ +E  M  +A A++     +      + +    WH G++G+LA+RLKE
Sbjct: 313 AQQLDDLNQDRKSIEQGMQREALAQLKDLPVE-SMPYGLCLFDADWHQGVIGILASRLKE 371

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTVER 450
           ++ RP+ A +   DG   GS RS+ GF I   +    A    ++ K GGHAMAAGL++  
Sbjct: 372 RYHRPTIAFADAGDGMLKGSARSVPGFHIRDALDAVAARHPQLISKFGGHAMAAGLSLPE 431

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            NF    + F +     +     T     DG L     ++ L   L  AGP+G   P P+
Sbjct: 432 ANFSAFAEAFDEEVRRQLREEDLTGRLLSDGSLAVEEFHLDLAKALRHAGPWGQHFPEPL 491

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F     +L   RVV   HL++  +S+  S  L  IAF +      E       + + +  
Sbjct: 492 FHG-VFQLVEQRVVGERHLKVVLKSECGSVRLDGIAFGIDR----EVWPNPTVRWVELAY 546

Query: 570 HLCVNYWRGSKRCQLRVLDASP 591
            L VN +RG++  QL +    P
Sbjct: 547 KLDVNEFRGNESVQLMIAHMEP 568


>gi|304407546|ref|ZP_07389198.1| single-stranded-DNA-specific exonuclease RecJ [Paenibacillus
           curdlanolyticus YK9]
 gi|304343497|gb|EFM09339.1| single-stranded-DNA-specific exonuclease RecJ [Paenibacillus
           curdlanolyticus YK9]
          Length = 801

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 181/598 (30%), Positives = 285/598 (47%), Gaps = 30/598 (5%)

Query: 14  SGFRWVSLLGQEGINRAL-AITQKHAIPDIVARVLVNRNVSIDYAK-DFLNPSIRLLMPD 71
           S  RW      E   +A   + Q  A+P +VAR+LV R +  + A   FL+  +  L  D
Sbjct: 4   SKTRWSQPDWDERREQAAGHLMQALALPPLVARLLVGRGIESEEAATSFLHGGM-ELTHD 62

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P +L   + A +RI  AI   + I I+GDYD DG +S +LM+  L       + YIP R 
Sbjct: 63  PYLLAGMEAAVQRIRHAIEQEQWIRIYGDYDADGVSSTSLMIHLLERLGAKFDYYIPHRT 122

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            +GYG N + ++     G +LIITVD G ++ D + YA  +GI+V+V DHH+       A
Sbjct: 123 REGYGMNCAAIDLAAEAGVKLIITVDTGISAVDEIAYAKAKGIEVVVTDHHEPPEVLPDA 182

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
           Y+++NP           L   GV F +   +                L L D+VAL T+ 
Sbjct: 183 YSIINPKLPYCQYPYKSLAGVGVAFKLATALLGEAP-----------LDLTDIVALGTIA 231

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGR 310
           DV+PL G NR  V +GL     +  PG  AL E   +    +T+ N+ + + P INA GR
Sbjct: 232 DVMPLNGENRVLVRQGLKEMALRTRPGFLALAETAGVQLQAVTSTNVAFSMAPRINASGR 291

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD-----I 365
           +  +     LL + D +  E+LA +LD LN+ R+ +   M+++A ++   +C        
Sbjct: 292 LDHAGGAVELLTTSDQEAAELLAARLDALNRERQRIVEEMVDEAMSQWAEKCRIAAEACQ 351

Query: 366 QQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFE-EDGKGIGSGRSIEGFDIGKM 424
              +VIV+ G+ W+ G++G++A+++ E++ +P+  +  + E GK  GS RSI+GFD+   
Sbjct: 352 SPPAVIVLAGEGWNAGVIGIVASKMLERYYKPTVVLGIDTETGKCKGSARSIDGFDLHAA 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           ++      +    GGH  AAG+T+ R     L       A   +      P   ID   +
Sbjct: 412 LTAC--ADLFDHFGGHQAAAGMTLHRDKLDALEQSLSDSAMAWLSPEDWVPKTFIDLACS 469

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQ 542
               ++  ID L    P+GAGNP P F F    +   R +     HL++    Q S  L+
Sbjct: 470 PKEASLDTIDQLALLEPFGAGNPAPRFLFEQQPVTDKRTMGKESKHLRLALGGQPSR-LE 528

Query: 543 AIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
           A+ F             + G +  + G L VN W G+++ QL + D        F  +
Sbjct: 529 AVGFGFGEL----AERIAFGAQADLVGELSVNEWNGNRKPQLFIQDIRIANVQLFDWR 582


>gi|56963333|ref|YP_175064.1| single-strand DNA-specific exonuclease [Bacillus clausii KSM-K16]
 gi|56909576|dbj|BAD64103.1| single-strand DNA-specific exonuclease [Bacillus clausii KSM-K16]
          Length = 785

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 182/592 (30%), Positives = 292/592 (49%), Gaps = 27/592 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDP 72
           S  RW  L   E    A  +  +  +  + AR+LV R + ++  AK FL+        DP
Sbjct: 4   SKTRWRILEQNEL--LAQELADELRVSMLTARLLVRRGIQTVQAAKRFLHYE-EPTFYDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L   ++   RI  A+   E+I++FGDYD DG +S ++M+  L     + + YIP+R  
Sbjct: 61  FLLKGMEETIERIALAVKRKERILVFGDYDADGVSSTSVMLTALQTYGADCDYYIPNRFT 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN   ++    +G  L+ITVD G ++ +   +A + G+D I+ DHH+       A 
Sbjct: 121 EGYGPNCPALDFAKRQGYHLVITVDTGISALNEAAHAKDIGLDFIITDHHEPPPVLPEAL 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A++NP +         L   GV F V   +   L +            LLD   + T+ D
Sbjct: 181 AIINPKQPGCPYPFKELAGVGVAFKVAHALLGRLPE-----------ELLDYAVIGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRI 311
           +VPLI  NR    KGL      G PG++AL E   +    + A+++G+ IGP +NA GR+
Sbjct: 230 LVPLIDENRLLAKKGLRAIESSGRPGIRALKEVCGMKQEAMDADHIGFAIGPRLNAAGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             +N    LL++DD +E + LA ++D LN+ R+ + S M E+A  +++      +    I
Sbjct: 290 DSANPAVELLLADDEEEAKALATEIDSLNKERQAIVSKMTEEAI-RLVETTYGTKIPHAI 348

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEE-DGKGIGSGRSIEGFDIGKMVSFAVE 430
           VV  + W+PG++G++A+RL E+F RP+  +S +E  G   GS RSIEGFD+      A  
Sbjct: 349 VVAKEGWNPGVIGIVASRLVEQFYRPTIVMSIDESSGLAKGSARSIEGFDMY--QELANN 406

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
             IL   GGH MAAG+T++  +   L     K A   +   + TP   ID V     V +
Sbjct: 407 RDILPHFGGHPMAAGMTLKTEDIDDLRSRLIKQAKETLTDDMLTPATDIDLVAEVEDVTV 466

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRV 548
            +I  L++  P+G  N  P+       +  +R +     HL++ F     + L  IAFR+
Sbjct: 467 QVIGELQALAPFGVANRKPIVLVEGAHISDMRRIGSNQNHLKIQFTGAQ-KPLDGIAFRM 525

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                  F   +   ++   G + +N W G  + QL + D + +E   F  +
Sbjct: 526 GHL----FEEITPHAKLSAIGTVSLNEWNGKVKPQLIIDDLAVLEWQLFDWR 573


>gi|170077601|ref|YP_001734239.1| single-stranded-DNA-specific exonuclease RecJ [Synechococcus sp.
           PCC 7002]
 gi|169885270|gb|ACA98983.1| single-stranded-DNA-specific exonuclease RecJ [Synechococcus sp.
           PCC 7002]
          Length = 666

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 174/589 (29%), Positives = 298/589 (50%), Gaps = 23/589 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPD 71
           +   RW     Q  I +  ++ +   +  +VA+VLVNRN+ + + AK ++ P  + L   
Sbjct: 5   LPQQRWHIADRQPDITQ--SLVEAMGLNPLVAQVLVNRNIRTPEQAKIYIQPESQRLPAP 62

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
            +   D   +   + +AI     I I GDYD DG  S AL++R L H        IP R+
Sbjct: 63  LVEFEDLALSVELLQEAIAEETLIAICGDYDADGMTSTALLLRALGHVGTKVTYAIPSRM 122

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            DGYG N  ++ +   EG  LI+TVD G ++Y+ +  A + G+DVI+ DHH +  +  PA
Sbjct: 123 KDGYGINERIVTELAEEGVGLILTVDNGISAYEPINLARDLGLDVIITDHHDLPDQLPPA 182

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A++NP  L  +S    L   GV +++ V + + + +   +        +L+L  L T+ 
Sbjct: 183 NAILNPKLLPTMSPYAGLAGVGVAYVLAVSLAQAVDKLEGLTS-----QILELFTLGTIA 237

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN---ISSPITAENLGYMIGPSINAG 308
           D+ PL G+NR ++ +GL +  +    G++AL++          +  +++G+ +GP INA 
Sbjct: 238 DLAPLTGVNRRWLKRGLKLLPQSELAGVQALMQIAGVDDQKKQLKPDDIGFRLGPRINAV 297

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GRI +      LL +D+       AM+ + +N+ R+ M + +  +A A V     D Q  
Sbjct: 298 GRIDDPQKVIELLTTDEPGLALERAMQCEQINKQRQEMCTQIEAEAIALVEETPIDYQGQ 357

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
            V+VV  + WH G++G++A+RL E++G P F  + EEDGK  GS R IE F++ + +++ 
Sbjct: 358 RVLVVCKEEWHHGVIGIVASRLVERYGVPVFICTAEEDGKIRGSARGIEEFNVFEALNYC 417

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
             + +L K GGH  A G ++ R N     +   +FAH ++      P+ KIDG +N + +
Sbjct: 418 --QDLLGKFGGHKAAGGFSLARDNLAAFTEKLSEFAHQLLKPEHLKPLVKIDGAVNFTDL 475

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFES---QDSETLQAIA 545
                  ++   P+G GNP P+F   N ++   R +   HL+ +        + T++AIA
Sbjct: 476 TPEFYQQIDQLHPWGIGNPEPIFWTKNVQILEQRTIGKNHLKFSLGQTIAGQTFTIKAIA 535

Query: 546 FRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
           +       G++L       + +   L  N W G    +L ++ A P E 
Sbjct: 536 W-----QWGDYLPLPP--TLDIAYKLKENRWNGEVNLELELVGARPSEA 577


>gi|317505468|ref|ZP_07963386.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella salivae
           DSM 15606]
 gi|315663381|gb|EFV03130.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella salivae
           DSM 15606]
          Length = 583

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 162/587 (27%), Positives = 278/587 (47%), Gaps = 22/587 (3%)

Query: 16  FRWVSLLGQEGINRA-LAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPL 73
           F+W          +A   ++ K  I  I+A++L+ R ++ +  AK F  P +  L+ +P 
Sbjct: 3   FKWNYEPPTPQEKQASDELSGKLGIHPILAQLLIRRGITTESAAKRFFRPQLADLI-NPF 61

Query: 74  ILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVD 133
           ++ D D A  R+  A+   E+I+++GDYDVDG  +VAL+ +FL     N + YIPDR  +
Sbjct: 62  LMKDMDVAVDRLNDAMGRKERILVYGDYDVDGCTAVALVYKFLQQFYSNIDYYIPDRYDE 121

Query: 134 GYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYA 193
           GYG +   +      G +LII +DCG  +   +  A + GID I+ DHH    E  PA A
Sbjct: 122 GYGVSEKGIAYAKETGVKLIIILDCGIKAIQEIALAKSLGIDFIICDHHVPDEEMPPAVA 181

Query: 194 LVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV 253
           ++NP R DD      LC  GV F  +    +     N       L+ LLD  A++   D+
Sbjct: 182 ILNPKRPDDSYPFKSLCGCGVGFKFMQGWAK-----NNGIPFSRLIPLLDFCAVSIAADL 236

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIG 312
           VP+   NR     GL    +  + GLKA+I+   ++   ++  ++ + IGP INA GR+ 
Sbjct: 237 VPVTDENRILAFHGLKQLNQNPSIGLKAIIDICGLNGRELSMSDIIFRIGPRINASGRME 296

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
                  LL+  D       A  +D  N+ R+ ++  M E+A   ++++ +  +  S IV
Sbjct: 297 NGKESVDLLVEKDYNIALKKAKHIDEYNEQRKDIDKQMTEEANV-IVSKLESQKHHSSIV 355

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  + W  G++G++A+RL E + RP+  ++  +     GS RS+ GFD+   +       
Sbjct: 356 LYDENWKKGVIGIVASRLTEIYFRPTVVLT-RDGDLATGSARSVTGFDVYAAIKHC--RD 412

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           +L+  GGH  AAGLT+   +       FQ++  + +   +T     +D  L+   +   L
Sbjct: 413 LLMNFGGHTYAAGLTLRWDDIPLFRKKFQQYVEDHIAPELTEATINLDAKLDFKDITKKL 472

Query: 493 IDMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRV 548
            + L+   P+G     P+F         + +VV     H+++     + S  +  IAF  
Sbjct: 473 FNDLKRFAPFGPECTKPLFFTQGVYDYGTSKVVGREQEHIKLELVDSKSSTVVNGIAFGQ 532

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
            G+           +   +   +  N ++   + QL++ D  P E H
Sbjct: 533 SGS----VRYIKSKRAFDIAYTIEANVFK-RNQVQLQIEDIRPEEEH 574


>gi|254229665|ref|ZP_04923075.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio sp. Ex25]
 gi|262395208|ref|YP_003287062.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio sp. Ex25]
 gi|151937786|gb|EDN56634.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio sp. Ex25]
 gi|262338802|gb|ACY52597.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio sp. Ex25]
          Length = 579

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 177/569 (31%), Positives = 278/569 (48%), Gaps = 25/569 (4%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           +IP I+ R+ +NR ++       L  S R L      L   ++A   + QAI   ++I++
Sbjct: 18  SIPPILKRIYINRGITDPAQ---LETSARGLHSY-QKLGGIEQAVELLFQAIKEQKRIIV 73

Query: 98  FGDYDVDGAASVALMMRFLSHCS-VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L      N +  +P+R  DGYG +P ++++ +  GA++I+TV
Sbjct: 74  VGDFDADGATSSALSVLALRMLGSHNVDYLVPNRFEDGYGLSPEVVDQALELGAEMIMTV 133

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + ++YA   GI V+V DHH          A+VNPN          L   GV F
Sbjct: 134 DNGVSSIEGVRYAKENGITVLVTDHHLPGQVLPDVDAMVNPNLESCHFPSKALAGVGVAF 193

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   +R+ N           L+ L+DLVAL TV DVVPL   NR  V +GL   R
Sbjct: 194 YLMMALCVHMRKHNWFAEQGMQEPKLMELIDLVALGTVADVVPLDENNRILVHQGLQRIR 253

Query: 273 RQG-NPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
                PG++ALIE        + A + G+ +GP INA GR+ + + G  LL+ ++     
Sbjct: 254 AGKARPGIQALIEVAKRDARRLVASDFGFALGPRINAAGRLDDMSFGVELLMCNNIHAAR 313

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDI--QQASVIVVEGDRWHPGIVGLLAA 388
            +A +LD LNQ R+ +E  M ++A A           +    + +    WH G++G+LA+
Sbjct: 314 RMASELDGLNQTRKEIEEGMKQEAMAFCERLQFGEGSELPYGLALFQRDWHQGVIGILAS 373

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGL 446
           R+KEKF RP  A +   +G   GS RSI G  +   + F      G+++K GGHAMAAGL
Sbjct: 374 RIKEKFHRPVIAFADGGEGTIKGSCRSIPGLHMRDALDFIDTQNPGLIIKFGGHAMAAGL 433

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           T++  +F R    F +     +       V   DG L     ++ + + L S GP+G   
Sbjct: 434 TIKEQDFERFSRLFDEVVKKELDEAALKGVIMSDGELKPEEFSMHVAEQLRSGGPFGQAF 493

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFES-----QDSETLQAIAFRVYGTPLGEFLMQSR 561
           P P+F     K+   ++V   HL++  E        +  +  IAF V      +    + 
Sbjct: 494 PEPIFDGE-FKVLHQKLVGEKHLKLMLEPLYKGHPTNVMIDGIAFNVDLRRWPD----AS 548

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            K + +   L VN +RG++  QL +    
Sbjct: 549 VKTVRLAYKLDVNEFRGNQSLQLMIDHIE 577


>gi|229086972|ref|ZP_04219129.1| Exonuclease RecJ [Bacillus cereus Rock3-44]
 gi|228696348|gb|EEL49176.1| Exonuclease RecJ [Bacillus cereus Rock3-44]
          Length = 779

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 181/589 (30%), Positives = 284/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E   +   +  K  +  +V  + + R +  +    DFLN   R    DP +L
Sbjct: 7   RWKEKSFNE--EQVSELASKLQLSPLVTSLFLGRGLDTEDKIVDFLNTE-RQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ QAI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDRTVERVKQAIQNGEQILIFGDYDADGVSSTTVLYLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A + GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKDLGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++V + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIVVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKQMRMTKNIGLKALFKVANVSQSEITEESIGFSIAPRINAIGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D +N+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 APAVHLLLSEDPEEAKELAEEIDEMNKLRKDIVKQITEEAIAEV-ENNYPPEDNKVLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E F RP+  +    E     GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVELFYRPTIVLCIDPEKQTAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+     TP+  +D +     V ++ I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVEELRRRLNEQADAILTPEDFTPITTVDAICKVEDVTLSAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M   S    TL  I F     
Sbjct: 470 EEMQKLAPFGVGNPKPRIAIRDAELESIRAIGSDGSHLKMGLRSGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S    + V G   +N W   K+ QL + D +      F  +
Sbjct: 527 --AYAKEISPVAHVSVVGEASINEWNNFKKPQLMIQDIAVDAWQLFDWR 573


>gi|228999197|ref|ZP_04158778.1| Exonuclease RecJ [Bacillus mycoides Rock3-17]
 gi|228760542|gb|EEM09507.1| Exonuclease RecJ [Bacillus mycoides Rock3-17]
          Length = 779

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 181/589 (30%), Positives = 281/589 (47%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + ++R +  +    DFLN   +    DP +L
Sbjct: 7   RWKEKSFNE--ELVSELASKLQLSPLVTSLFLSRGLDTEDKIVDFLNTGQQEFH-DPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D    RI QAI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDLTVERIGQAIQNGEQILIFGDYDADGVSSTTVLFLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN          G  LIITVD G  +    Q A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHRAGFSLIITVDTGIAAVHEAQVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLKGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKQMRMTKNIGLKALFKVANVSQSDITEESIGFSIAPRINAIGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 APAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEV-ENNYPPEDNKVLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +    E     GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLCIDPEKQTAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ +   TP+  +D +     V ++ I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQADAILTSEDFTPITTVDAICKVEDVTLSAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EEMQKLAPFGVGNPKPRIAIRDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S    + V G   +N W   K+ QL + D +      F  +
Sbjct: 527 --AYAKEISPVAHVSVVGEASINEWNNFKKPQLMIQDIAVDAWQLFDWR 573


>gi|119384612|ref|YP_915668.1| single-stranded-DNA-specific exonuclease RecJ [Paracoccus
           denitrificans PD1222]
 gi|119374379|gb|ABL69972.1| exonuclease RecJ [Paracoccus denitrificans PD1222]
          Length = 580

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 253/588 (43%), Positives = 354/588 (60%), Gaps = 11/588 (1%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           AFL VE S++G  W           A A+ Q   +P  V+RVL  R V    A  +L+P 
Sbjct: 3   AFLSVESSLTGRLWRG-PEATLERAAEALAQDSRLPLPVSRVLAARGVPAHEAPLYLDPK 61

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R L+PDP  L D DKAA R+V A+   ++I IF DYDVDG AS AL++ +L     +A 
Sbjct: 62  LRDLLPDPSSLRDMDKAAERLVAAVLAGQRIAIFADYDVDGGASAALLLDWLRRQGRDAT 121

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   +   +++G  LII VDCG+ S++AL        DVIV+DHHQ 
Sbjct: 122 LYIPDRIDEGYGPNAPAIA-SLSQGHDLIICVDCGTLSHEALA---AASCDVIVLDHHQG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
                P  A+VNPNR D+    GHLCAAGVVFL LV    +LR+D       DL+ LLDL
Sbjct: 178 GETLPPVLAVVNPNRADEDGSLGHLCAAGVVFLTLVRCNSLLRRDGH--PQPDLIPLLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+G+NRA+V +GL+V  R+  PGL AL +   + S   A +LG+++GP 
Sbjct: 236 VALATVADVAPLVGVNRAFVRQGLLVMARRERPGLVALSDVARLDSAPNAFHLGFLLGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           INAGGR+G ++LG+  L   D ++ E LA +LDVLN++RR +E+A+ ++A A+V  +  D
Sbjct: 296 INAGGRVGRADLGALCLSCTDGRQAERLAAELDVLNRDRRAIEAAVRDEALAQVEARASD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
              + V    GD WHPG+VG++AAR+KE  G PS  I   E G G GS RS+ G D+G+ 
Sbjct: 356 ---SLVAWAAGDGWHPGVVGIVAARVKEATGLPSVVIG-VEGGIGKGSARSVPGVDLGRA 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGHAMAAGLT+E        +   +     +         +I G+++
Sbjct: 412 IQRLSAEGLLLKGGGHAMAAGLTIEEAKIPAAMERLSQLLSREMAERPGAGELRISGLMD 471

Query: 485 ASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAI 544
            +   + L+ MLE AGP+G   P P FAF    + S   +  +HL++ F S  S  L+A+
Sbjct: 472 PAGATVELMQMLERAGPFGQAAPAPRFAFAEQLIDSAGAMGDSHLRLRFRSPGSPVLEAV 531

Query: 545 AFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           A+     PLG  L+ +RG+  H+ G L ++ W G +R +LR+ DA+PV
Sbjct: 532 AWGAMNGPLGPALLGARGRCFHLAGKLELSQWGGRERVRLRLDDAAPV 579


>gi|89072534|ref|ZP_01159106.1| putative single-stranded-DNA-specific exonuclease RecJ
           [Photobacterium sp. SKA34]
 gi|89051638|gb|EAR57091.1| putative single-stranded-DNA-specific exonuclease RecJ
           [Photobacterium sp. SKA34]
          Length = 574

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 185/562 (32%), Positives = 280/562 (49%), Gaps = 20/562 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           +P I+ R+  +R +  D     L  S + L+ +   L     A + +V A+  + +I+I 
Sbjct: 19  VPPILQRIYASRGIKND---AELERSAKGLL-NYNQLHGMTSAVQLLVDALSQNTRIIIV 74

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L      N +  +P+R  DGYG +P ++E+ I  GA+LI+TVD
Sbjct: 75  GDFDADGATSSALSVLALRMLGCKNVDYLVPNRFDDGYGLSPEVVEQAIERGAELIMTVD 134

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S   +  A  +G+ V+V DHH        A A+VNPN  +       LC  GV F 
Sbjct: 135 NGVSSIAGVAVAKEKGLTVLVTDHHLPGDCLPIADAIVNPNLNECGFPSKALCGVGVAFY 194

Query: 218 VLVLIYRILRQDNKVPL----NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR 273
           +++ +   LRQ            +L  LLDLVAL TV DVV L G NR  V +GL   R 
Sbjct: 195 LMLALRAELRQRGWFEQQGIAMPNLAELLDLVALGTVADVVALDGNNRILVHQGLQRIRA 254

Query: 274 -QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
            +  PG++ALIE  N  S  +   +LG+ +GP INA GR+ + + G  LL+ D+ Q    
Sbjct: 255 GKCRPGIQALIEVANRDSARLVTSDLGFALGPRINAAGRLDDMSFGVELLLCDNIQSARR 314

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV-EGDRWHPGIVGLLAARL 390
           +A +LD LNQ R+ +E  M ++A A       + Q     +V     WH G++G+LA+R+
Sbjct: 315 MASELDGLNQTRKEIEQGMKDEALAICERLKFNQQDMPYGLVLFQRDWHQGVIGILASRI 374

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGLTV 448
           K+K+ RP  A +   +G+  GS RSI G  +   +        G+++K GGHAMAAGLT+
Sbjct: 375 KDKYHRPVIAFADAGNGEIKGSCRSITGLHMRDALDLVDTQNPGMILKFGGHAMAAGLTI 434

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
                      F     N +       V   DG L    +N+ + ++L + GP+G   P 
Sbjct: 435 PEDKLEAFSKAFDAVVRNALDEDALKGVLMTDGELGGHELNLDVAEILRAGGPWGQQFPE 494

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P F     +L   ++V   HL++  E       + AIAF V      +  +Q  G    +
Sbjct: 495 PTFDGT-FRLLHQKLVGGKHLKIMVEPLSGGSVIDAIAFNVDVKRWPDASVQQVG----L 549

Query: 568 TGHLCVNYWRGSKRCQLRVLDA 589
              L VN +RG++  QL V + 
Sbjct: 550 VYRLDVNEYRGNRSVQLMVEEL 571


>gi|166364907|ref|YP_001657180.1| single-strand-DNA-specific exonuclease [Microcystis aeruginosa
           NIES-843]
 gi|166087280|dbj|BAG01988.1| single-strand-DNA-specific exonuclease [Microcystis aeruginosa
           NIES-843]
          Length = 654

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 163/589 (27%), Positives = 288/589 (48%), Gaps = 19/589 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLI 74
            RW          +   + ++  +  ++A +L+NR +     AK +++P    L      
Sbjct: 8   QRWYIAATNP--EKIAGLAREMGLSSLLATILINRGIDTPELAKTYIDPEADTLPSPLGE 65

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
             D +K+   +V+AI   +KI I GDYD DG  S +L++R L H     N  IP R+ +G
Sbjct: 66  FPDLEKSVNLLVKAIARGDKIAICGDYDADGMTSTSLLLRALRHLGARVNHAIPSRMKEG 125

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG N  ++E+F   G  LI+TVD G ++++ +  A   G+ VI+ DHH +      A A+
Sbjct: 126 YGINQRIVEEFAESGVGLILTVDNGISAHEPIALAIELGLKVIITDHHDLPPILPNASAI 185

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP  L   S    L   GV +++ V   + + +   +       SLL L  L T+ D+ 
Sbjct: 186 LNPKLLTPNSPYQGLAGVGVAYILAVTTAQKMGKLQGLT-----ESLLALFTLGTIADLA 240

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI---SSPITAENLGYMIGPSINAGGRI 311
           PLIG+NR ++ +GL    +    G+++L++   I      +  +++G+ +GP INA GRI
Sbjct: 241 PLIGVNRRWLKRGLRKLPKSQLVGIQSLMQIAGISEEQKQLQPDDIGFKLGPRINAIGRI 300

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
           G+  +   LL +D++      AM+ + +N+ R+ +   + E+A   V       QQ  V+
Sbjct: 301 GDPQIVIELLTTDEAGIALERAMQCEQINRTRQELCEKIEEEAIKLVEETPIFWQQDRVL 360

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V+    WH G++G++A+RL E++G P F  ++EE+  G   G +    +     +    +
Sbjct: 361 VLVEKDWHHGVIGIVASRLVERYGVPVFIGTYEEEDTGKIRGSARGIEEFHVFEALQFCQ 420

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L K GGH MA G ++   N         +F+H I+      P+ KID +L+   +N+ 
Sbjct: 421 DLLGKFGGHKMAGGFSLPTANLLAFKQRLSQFSHKILQIEQLKPLIKIDTILDFKQINLQ 480

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGT 551
           L   ++S  P+G GN  PVF  PN ++   + +   HL++     D+  ++A+A+R    
Sbjct: 481 LFQQIDSLQPWGIGNELPVFWTPNVRVVEQKTIGKNHLKLLLAQSDNTRIKALAWRWGEY 540

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS-PVEGHHFAK 599
                       R+ +   L  N W G+   ++ ++    P E ++  K
Sbjct: 541 C-------PLPTRLDIAYKLKENTWNGNTTIEIELVGVRLPQENNNIKK 582


>gi|229006744|ref|ZP_04164378.1| Exonuclease RecJ [Bacillus mycoides Rock1-4]
 gi|228754605|gb|EEM04016.1| Exonuclease RecJ [Bacillus mycoides Rock1-4]
          Length = 779

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 181/589 (30%), Positives = 281/589 (47%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + ++R +  +    DFLN   +    DP +L
Sbjct: 7   RWKEKSFNE--ELVSELASKLQLSPLVTSLFLSRGLDTEDKIVDFLNTGQQEFH-DPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D    RI QAI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDLTVERIGQAIQNGEQILIFGDYDADGVSSTTVLFLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN          G  LIITVD G  +    Q A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHRAGFSLIITVDTGIAAVHEAQVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLKGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKQMRMTKNIGLKALFKVANVSQSDITEESIGFSIAPRINAIGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 APAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEV-ENNYPPEDNKVLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +    E     GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLCIDPEKQTAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ +   TP+  +D +     V ++ I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQADAILTSEDFTPITTVDAICKVEDVTLSAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EEMQKLAPFGVGNPKPRIAIRDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S    + V G   +N W   K+ QL + D +      F  +
Sbjct: 527 --AYAKEISPVAHVSVVGEASINEWNNFKKPQLMIQDIAVDAWQLFDWR 573


>gi|146308395|ref|YP_001188860.1| exonuclease RecJ [Pseudomonas mendocina ymp]
 gi|145576596|gb|ABP86128.1| exonuclease RecJ [Pseudomonas mendocina ymp]
          Length = 569

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 175/562 (31%), Positives = 281/562 (50%), Gaps = 18/562 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V      + L+  +  L+P    L   D A   +V+A+   ++I+I
Sbjct: 17  NLPPLLTRLYAARGV---QCAEELDKGLARLIP-FQQLKGIDAAVELLVEALQRRQRILI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA + ++ +  L      + +  +P+R   GYG  P ++   +     L++TV
Sbjct: 73  VGDFDADGATASSVGVLGLRQLGAAHVDYLVPNRFEYGYGLTPEIVAVALQRQPDLLLTV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S D +  A   G+ V+V DHH    E   A A+VNPN+         +   GV+F
Sbjct: 133 DNGISSVDGVAAAKAAGLKVLVTDHHLPGPELPAADAIVNPNQPGCDFPSKAMAGVGVMF 192

Query: 217 LVLVLIYRILRQDNKV--PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
            VL+ +   LR+          +L  LLDLVAL +V DVVPL   NR  V +GL   R  
Sbjct: 193 YVLLALRARLRELGWFASRQEPNLGELLDLVALGSVADVVPLDANNRILVHQGLARIRAG 252

Query: 274 QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PGL+A++E        IT+ +LG+++GP +NA GR+ + +LG   L+ DD      +
Sbjct: 253 RARPGLRAILEVAGRDHRRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCDDEALARDM 312

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           A++LD LNQ+R+ +E  M  +A A++            + +    WH G++G+LA+RLKE
Sbjct: 313 AVQLDQLNQDRKAIEQGMQREALAQL-KDLPLQDMPFGLCLFEPDWHQGVIGILASRLKE 371

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTVER 450
           ++ RP+ A +   +G   GS RS+ G  I   +    A   G++ K GGHAMAAGL++ +
Sbjct: 372 RYHRPAIAFADAGEGMLKGSARSVPGLHIRDALDAVAARHPGLISKFGGHAMAAGLSLPQ 431

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            NFG     F       +     T     DG L+A+  ++ L   L +AGP+G   P P+
Sbjct: 432 ENFGAFAAAFDAEVRRQLCEDDLTGRLLSDGQLDATEFHLELARALRNAGPWGQHFPEPL 491

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F     ++   R+V   HL++  +++  S  L  IAF +      E       +   V  
Sbjct: 492 FHG-VFQIVGQRIVGERHLKLVLKTECGSVQLDGIAFNIDR----EVWPNPTLRWAEVAY 546

Query: 570 HLCVNYWRGSKRCQLRVLDASP 591
            L +N +RG++  QL V   +P
Sbjct: 547 KLDLNEFRGNESVQLMVAHIAP 568


>gi|262277190|ref|ZP_06054983.1| single-stranded-DNA-specific exonuclease RecJ [alpha
           proteobacterium HIMB114]
 gi|262224293|gb|EEY74752.1| single-stranded-DNA-specific exonuclease RecJ [alpha
           proteobacterium HIMB114]
          Length = 580

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 206/583 (35%), Positives = 336/583 (57%), Gaps = 14/583 (2%)

Query: 12  SISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPD 71
           S+ G  WV        N A  I++++ +  + +R+L NRN++    ++FLNP I+  +P+
Sbjct: 5   SVQGKEWVLK--DFDKNLAEYISKEYNLDFLTSRLLANRNINQKNIENFLNPKIKNFLPN 62

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
           P    D  K    I + I N  KI IFGDYDVDGA S  +M ++L   +++  ++IPDR 
Sbjct: 63  PYNFKDMGKGLEIISRHIKNKNKICIFGDYDVDGATSSGIMSKYLEQLNIDHFVFIPDRQ 122

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            DGYGP+       IN+   LII +DCG+TS++A++YA ++ IDV+VIDHH+ +     A
Sbjct: 123 KDGYGPSVKTFTNIINKNVNLIIALDCGTTSFEAIEYARSKNIDVVVIDHHKSQETFPAA 182

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP----LNFDLLSLLDLVAL 247
            A++NPNR+D+     +LCAAGV+F+ LV + +ILR++           +LL LLDLV +
Sbjct: 183 NAIINPNRIDETGDYYYLCAAGVLFIFLVGLNKILRENYYFNKAKVQEPNLLDLLDLVMM 242

Query: 248 ATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINA 307
            TVCDVVPL+ LNRA+V +GL VA ++ N GLK L++   I   ++   +GY++GP INA
Sbjct: 243 GTVCDVVPLMDLNRAFVHQGLKVASKRHNLGLKTLVDYSKIKKKLSTYEVGYVLGPKINA 302

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
           GGRIG+S LG  LL +++++   +++ +L+ LN  R+ +E  ++E+A +      +    
Sbjct: 303 GGRIGKSELGYNLLTTNNAETAYLISSELESLNLKRKDIEKKIVEEAISI----SERNND 358

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
             ++ +  + WH G++G++A+RLK+ F +PSF IS + +    GS RSI GFD+G  ++ 
Sbjct: 359 EPIVFLSKNDWHEGLIGIVASRLKDHFNKPSFIISQKGED-CKGSARSIFGFDVGMAITK 417

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
             +  I+ KGGGH MA G +++        +        +        + +ID  L +SA
Sbjct: 418 CKQLNIITKGGGHPMAGGFSLKSDKLEIFKNELINLFLKLKKNKD-NNIIEIDSYLESSA 476

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
           +N  LI+ L    PYG+GN  P+F F   K+  +      H+++   ++ +  + AI+F 
Sbjct: 477 INDELIEKLNHLEPYGSGNREPIFGFEKFKVSKVIETKNNHVKVVL-NKGNFYIDAISFN 535

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                LG +LM  + K  ++   + +N W G  + +L + D  
Sbjct: 536 SKNKDLGNYLMNFK-KEFNLVAKIKLNEWNGKSKIELIIDDIQ 577


>gi|303230873|ref|ZP_07317620.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514633|gb|EFL56628.1| single-stranded-DNA-specific exonuclease RecJ [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 664

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 191/580 (32%), Positives = 300/580 (51%), Gaps = 24/580 (4%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLIL 75
            RW  +       +   + ++  +  IVAR++VNRN+  D    FL  +++ L+ DP  L
Sbjct: 4   KRWHIMPR--DTEKENTLIRELGVNPIVARLMVNRNIDSDEGHRFLEGTLKDLL-DPFTL 60

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D + A   I++ I   + I+++GDYDVDG  + +L+ RFL       + YIP+R  +GY
Sbjct: 61  KDMETAVALILETIEAKKSIVVYGDYDVDGITATSLLYRFLVKMRARVSYYIPERQSEGY 120

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   +E  I++GA L+ITVDCG +SYD ++   ++ ID+I+ DHH    +  PA A++
Sbjct: 121 GLNLEALEHIISDGASLVITVDCGISSYDIVEAVCDR-IDIIITDHHTAPPQIPPARAVI 179

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           N  + D      +L   GV F +   ++  LRQ          L  LD+VAL TV DVVP
Sbjct: 180 NHKQPDCPYTDKNLSGVGVAFKLCQALW--LRQCG-----EWYLDDLDIVALGTVADVVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGES 314
           L+G NR  V  GL       N G+  LI+        ITA ++G+ + P +NA GR+  +
Sbjct: 233 LVGENRIIVQAGLKKMNELPNLGIDKLIDVAGLHDKTITAGHIGFTLAPRLNAAGRVTHA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL++DD    E +A +L   N  R+ +E ++ E+A A V  Q        V VV 
Sbjct: 293 TRAVELLVTDDVDLAETIAQELQETNMERQEIERSIHEEARANVAAQGHLA--DYVTVVA 350

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
           G+ WHPG++G++A+RL E+F +P+  IS  ++G G GS RSIEGF+I   +     E IL
Sbjct: 351 GENWHPGVIGIVASRLVEEFYKPTLVIS-IDNGVGKGSCRSIEGFNIYNALKSC--EDIL 407

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           ++ GGHA AAG +++      L     ++    V      PV  ID  L    +++ ++D
Sbjct: 408 IQFGGHAAAAGFSIDASRIDELRHRLTEYCKVQVSPDEYIPVVSIDATLPVDDIDVDIVD 467

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGTP 552
            + +  PYG GN  P+F   + K+Q I ++     H ++   + +  ++ AIA+      
Sbjct: 468 RVSALEPYGMGNSTPIFGVMDAKVQDIMLMGQLKNHCKVILATANG-SVDAIAWNRPDL- 525

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
              F    +G  + V   L  N W+G    QL + D  P+
Sbjct: 526 ---FRHIFQGMNVKVAFTLQKNEWQGFVSPQLMIQDIEPI 562


>gi|284929094|ref|YP_003421616.1| exonuclease RecJ [cyanobacterium UCYN-A]
 gi|284809553|gb|ADB95258.1| exonuclease RecJ [cyanobacterium UCYN-A]
          Length = 650

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 171/586 (29%), Positives = 294/586 (50%), Gaps = 18/586 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPD 71
           +   RW  +       +   + ++  I D++ +V++NR +     A+ +LNP+  +L P 
Sbjct: 3   LPNQRWDVISPNP--EKIQLLAEEMKISDLIVKVILNRGIDTSSLARIYLNPNEEILPPP 60

Query: 72  PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRI 131
                D  K+   + +AI    KI I GDYD DG  S +L++R L +   + +  IPDRI
Sbjct: 61  LAEFPDLYKSISLLTRAIKEKSKIAICGDYDADGMTSTSLLLRALKYFGGDIHYKIPDRI 120

Query: 132 VDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPA 191
            DGYG N  ++E     G +LI+TVD G ++YD +Q A   G++VI+ DHH +  +  PA
Sbjct: 121 KDGYGINTQIVENLAKNGVELILTVDNGISAYDPIQRAVELGVNVIITDHHDIPKKLPPA 180

Query: 192 YALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVC 251
            A++NP  L   S    L   GV +++ + + + L +   +     + SLL+L  L T+ 
Sbjct: 181 DAILNPKLLSHESPYSGLAGVGVAYILALTLAQTLNKTEGI-----IASLLELFTLGTIA 235

Query: 252 DVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNI---SSPITAENLGYMIGPSINAG 308
           D+ PLIG+NR ++ +GL        PG++ALI+   I      + ++++G+ +GP INA 
Sbjct: 236 DLAPLIGVNRRWLKQGLKQLPNSQLPGIQALIKVSGISDEQKQLRSDDIGFKLGPRINAV 295

Query: 309 GRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQA 368
           GRIG+  +   LL +DD +     A++ + +N  R+ +   + ++A   V     + Q+ 
Sbjct: 296 GRIGDPKVAIELLTTDDPELALEKALECEEINNVRKSLCEKIEKEAINLVENTPLNYQEK 355

Query: 369 SVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA 428
            V+VV  D WH G++G++A+RL E++G P F  ++EE+      G +    +     +  
Sbjct: 356 RVLVVIKDEWHHGVIGIVASRLVERYGVPVFIGTYEENDIEKIRGSARGIPEFDVFNALQ 415

Query: 429 VEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
             + +L K GGH  A G  ++R           +F+H  +      P+ KID  +N   +
Sbjct: 416 YCDDLLDKFGGHKAAGGFGLKRKYLNSFEKRLSEFSHQHLKLHHIKPLIKIDSEINFKDI 475

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRV 548
           N  L + L+S  P+G GN  P+F  PN  +   +++   HL+++    D E ++AIA+R 
Sbjct: 476 NHNLYETLDSLQPWGIGNAIPIFWTPNVIILKQKIIGDNHLKISLVQNDGEKIEAIAWRF 535

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEG 594
                         K++ +   L  N W G    QL ++     E 
Sbjct: 536 GTYY-------PLPKQLDIAYKLSKNSWNGKSNIQLEIVGIRLPES 574


>gi|229013626|ref|ZP_04170757.1| Exonuclease RecJ [Bacillus mycoides DSM 2048]
 gi|228747685|gb|EEL97557.1| Exonuclease RecJ [Bacillus mycoides DSM 2048]
          Length = 773

 Score =  414 bits (1064), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/589 (30%), Positives = 284/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + + R ++ +    DFLN +      DP +L
Sbjct: 7   RWKEKEYNE--ELVSELANKLQLSPLVTSLFLGRGLNTEDKIADFLN-TADQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L         YIP+R  +GY
Sbjct: 64  EGMDRTVERVKKAIENGEQILIFGDYDADGVSSTTVLYLALKELGAEVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ + P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFALAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLSIDPHKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ A    P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLNMNDVDELRRRLNEQADVILTAEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFGTY 528

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G + +N W   K+ QL V D +      F  +
Sbjct: 529 ----AKEISPVAKVSVVGEVSINEWNNFKKPQLMVQDIAVEAWQLFDWR 573


>gi|28897285|ref|NP_796890.1| ssDNA exonuclease RecJ [Vibrio parahaemolyticus RIMD 2210633]
 gi|260363585|ref|ZP_05776405.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus K5030]
 gi|260876250|ref|ZP_05888605.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus AN-5034]
 gi|260896428|ref|ZP_05904924.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus Peru-466]
 gi|260902721|ref|ZP_05911116.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus AQ4037]
 gi|28805494|dbj|BAC58774.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308088410|gb|EFO38105.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus Peru-466]
 gi|308092897|gb|EFO42592.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus AN-5034]
 gi|308107644|gb|EFO45184.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus AQ4037]
 gi|308113319|gb|EFO50859.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus K5030]
          Length = 579

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 176/569 (30%), Positives = 279/569 (49%), Gaps = 25/569 (4%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           +IP I+ R+ +NR ++       L  S R L      L   ++A   + QAI   ++I++
Sbjct: 18  SIPPILKRIYINRGITD---IAQLETSARGLHSY-QKLGGIEQAVELLFQAIQEQKRIIV 73

Query: 98  FGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L     N  +  +P+R  DGYG +P ++++ +  GA++I+TV
Sbjct: 74  VGDFDADGATSSALSVLALRMLGSNNVDYLVPNRFEDGYGLSPEVVDQALELGAEMIMTV 133

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + ++YA   GI V+V DHH          A+VNPN          L   GV F
Sbjct: 134 DNGVSSIEGVRYAKENGITVLVTDHHLPGQVLPEVDAMVNPNLDSCTFPSKALAGVGVAF 193

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   +R+ N           L+ L+DLVAL TV DVVPL   NR  V +GL   R
Sbjct: 194 YLMMALCVHMRKHNWFAQQGMQEPKLMELIDLVALGTVADVVPLDENNRILVHQGLQRIR 253

Query: 273 RQG-NPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
                PG++ALIE        + A + G+ +GP INA GR+ + + G  LL+ ++     
Sbjct: 254 AGKARPGIQALIEVAKRDARRLVASDFGFALGPRINAAGRLDDMSFGVELLMCNNIHAAR 313

Query: 331 MLAMKLDVLNQNRRLMESAM--LEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
            +A +LD LNQ R+ +E  M     A  + L   ++ +    + +    WH G++G+LA+
Sbjct: 314 RMASELDGLNQTRKEIEEGMKQEAMAFCERLQFGENSELPYGLSLFQRDWHQGVIGILAS 373

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGL 446
           R+KEKF RP  A +   +G   GS RSI G  +   + F      G+++K GGHAMAAGL
Sbjct: 374 RIKEKFHRPVIAFADGGEGTIKGSCRSIPGLHMRDALDFIDTQNPGLIIKFGGHAMAAGL 433

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           T++  +F R    F +     +       V   DG L     ++ + + L + GP+G   
Sbjct: 434 TIKEQDFERFSRLFDEVVKKELDEAALKGVILTDGELKPEEFSMHIAEQLRAGGPFGQAF 493

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFES-----QDSETLQAIAFRVYGTPLGEFLMQSR 561
           P P+F     K+   ++V   HL++  E        +  +  IAF V      +    + 
Sbjct: 494 PEPIFDGE-FKVLHQKLVGEKHLKLMLEPLYKGHPTNVMIDGIAFNVDLRRWPD----AS 548

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            K + +   L VN +RG++  QL +    
Sbjct: 549 VKTVRLAYKLDVNEFRGNQSLQLMIDHIE 577


>gi|149279018|ref|ZP_01885152.1| single-strand DNA specific exonuclease [Pedobacter sp. BAL39]
 gi|149230297|gb|EDM35682.1| single-strand DNA specific exonuclease [Pedobacter sp. BAL39]
          Length = 566

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 163/577 (28%), Positives = 267/577 (46%), Gaps = 17/577 (2%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            RWV    Q       ++ Q+  I   +A++LV R + + + AKD+  P +  L  DP +
Sbjct: 3   KRWVQ-AVQGNYVHIDSLAQQLNIDRSLAQILVQRGIITFEQAKDYFRPQLSQLH-DPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D  KA  RI +A+  SEKI+I+GDYDVDG  SVAL   F S  +     YIPDR  +G
Sbjct: 61  MKDMMKAVLRIEEALAASEKILIYGDYDVDGTTSVALAYSFFSQFTTKIEYYIPDRHKEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LI+ +DCG  S D + YAT  GID I+ DHH    E   A AL
Sbjct: 121 YGISTQGIDYASANGYSLIVALDCGIKSVDKVAYATGLGIDFIICDHHMPGEELPAAAAL 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P + D       L   G+ F +                       LDLV ++   D+V
Sbjct: 181 LDPKQSDCEYPFKELAGCGIGFKLAQAYCIKHGL-----PAEKYERYLDLVMVSIAADIV 235

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           P+   NR     GL+        GLKAL++    S   T  ++ + + P INA GR+  +
Sbjct: 236 PVEDENRILAYHGLIKLNTAPCMGLKALMDISGRSKQYTLTDVVFSLAPRINAAGRMDHA 295

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           N   ++L+  +       +  +D+ N  R+  +  +  +A A +   C+ +      VV 
Sbjct: 296 NQAVKMLLCTEDTIALAQSEFIDLQNTERKTSDQNITAEALALI-ADCEILINKKTTVVY 354

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + W+ G++G++A+RL EK+ RP+  ++ + +G   GS RS+ GFD+ + +     + +L
Sbjct: 355 HESWNKGVIGIVASRLTEKYYRPTVVLT-KSNGLLTGSARSVAGFDLYEALLGC--QDLL 411

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           V+ GGH  AAGLT+E          F++   + +   +  P   ID  +    ++     
Sbjct: 412 VQFGGHKFAAGLTIEPEKIDAFSARFEEIVSSTITEDLLCPEISIDAEIQLQQIDGKFQR 471

Query: 495 MLESAGPYGAGNPNPVFAFPNHK-LQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           ++    P+G  NP PVF       +    VV   HL+++ + Q+S   ++I F       
Sbjct: 472 IISQMSPFGPHNPAPVFISHGVTMVGRPYVVATKHLKLSVKQQNSPIFESIGFNFAEHE- 530

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
               +        +   +  N W+  +R QL +    
Sbjct: 531 ---SLLRPNVPFSICYTIEENVWKDQRRLQLNIKGIK 564


>gi|67923725|ref|ZP_00517191.1| RecJ exonuclease [Crocosphaera watsonii WH 8501]
 gi|67854433|gb|EAM49726.1| RecJ exonuclease [Crocosphaera watsonii WH 8501]
          Length = 654

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 169/583 (28%), Positives = 286/583 (49%), Gaps = 20/583 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPD 71
           +   RW          +   +  +  +  ++A+V++NR +     A+ ++NP    L PD
Sbjct: 3   LPDQRWYIASPNPD--QVKKLVAETGLSPLLAQVILNRGIDSPQLAQVYINPETENL-PD 59

Query: 72  PLI-LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
           PL    D   +   + +AI   EKI I GDYD DG  S +L++R  +H   +A   IP R
Sbjct: 60  PLTEFPDLFPSIELLKEAIETGEKIAICGDYDADGMTSTSLLLRAFNHFGGDAYYEIPSR 119

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           + DGYG N  ++EKF  EG  +++TVD G ++Y+ ++ A   G+ VI+ DHH +  +  P
Sbjct: 120 MKDGYGINERIVEKFAEEGVGVVLTVDNGISAYNPIKLAVELGLTVIITDHHDLPEKLPP 179

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
           A A++NP  L   S    L   GV +++ V +   L++ + +     + SLL+L  L T+
Sbjct: 180 ADAILNPKLLPIQSPYRGLAGVGVAYILAVTLAEALQKSDGI-----IDSLLELFTLGTI 234

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN---ISSPITAENLGYMIGPSINA 307
            D+ PL+G+NR ++ KGL         G++AL++          +  +++G+ +GP INA
Sbjct: 235 ADLAPLVGVNRRWLKKGLKQLPNSQLVGIQALMQVAGVSEEQKQLKPDDIGFKLGPRINA 294

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRIG+      LLI+DD       AM+ + +N  R+ +   + ++A   + T   D ++
Sbjct: 295 VGRIGDPETAIELLITDDPAIALERAMQCEQINSQRKSLCEEIEQEAIHLIRTTPIDYKR 354

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
             V+VV   +WH G++G++A+RL E++G P F  ++EE       G +    +     S 
Sbjct: 355 DRVLVVVHPQWHHGVIGIVASRLVERYGVPVFIGTYEEADYSKIRGSARGIEEFNIFESL 414

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
                +L K GGH  A G  +   N     +   +FAH ++      P+ KIDG  +   
Sbjct: 415 VYCYDLLGKYGGHKAAGGFGLGSDNLIAFQERLSQFAHQLLEPHHLKPLVKIDGQADFKQ 474

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
           +   L + ++S  P+G  N  PVF  PN K+   R V   HL++     D + ++AIA+R
Sbjct: 475 LKTQLYENIDSLQPWGIQNAFPVFWTPNVKILEQRTVGKNHLKLVLGQDDGQEIKAIAWR 534

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                          K + +   L  N W G+   +L ++   
Sbjct: 535 FGSYF-------PLPKCLDIAYKLTENNWNGAVNIELEIVGVR 570


>gi|308187995|ref|YP_003932126.1| Single-stranded DNA-specific exonuclease [Pantoea vagans C9-1]
 gi|308058505|gb|ADO10677.1| Single-stranded DNA-specific exonuclease [Pantoea vagans C9-1]
          Length = 578

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 182/564 (32%), Positives = 276/564 (48%), Gaps = 19/564 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           +P ++ R+ + R V        L    + L+P    L+  + A   + QA+ +  +IM+ 
Sbjct: 23  LPPLLKRLYLQRGVCDA---AELERGAKNLLPY-QSLSGIESAVALLHQALLDGRRIMVV 78

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L      N    +P+R  DGYG +P ++E+    GA +I+TVD
Sbjct: 79  GDFDADGATSTALTVMALRSMGGGNVQYLVPNRFEDGYGLSPEVVEQARARGAAMILTVD 138

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S+  ++ A   GI V++ DHH        A A+VNPN  D       L   GV F 
Sbjct: 139 NGISSHAGVECAHQHGIPVLITDHHLPGETLPAAEAIVNPNLPDCNFPSRALAGVGVAFY 198

Query: 218 VLVLIYRILRQDNKV---PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
           +++ +   LR            +L  +LDLVAL TV DVVPL   NR  V +GL   R  
Sbjct: 199 LMLALRAHLRTQGWFGATRAEPNLAEMLDLVALGTVADVVPLDVNNRILVWQGLSRIRAG 258

Query: 274 QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PG++AL+E  N     + A +LG+ +GP +NA GR+ + ++G  LL++DD  +  ML
Sbjct: 259 KCRPGIRALLEIANRDARQLAASDLGFALGPRLNAAGRLDDMSVGVALLMTDDLSQARML 318

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI-VVEGDRWHPGIVGLLAARLK 391
           A +LD LNQ R+ +E  M  +A A       +     +        WH G+VG+LA+RLK
Sbjct: 319 ASELDALNQTRKEIEQGMQSEALALCQALEREQSDLPLGLAFYHPEWHQGVVGILASRLK 378

Query: 392 EKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV--EEGILVKGGGHAMAAGLTVE 449
           E+F RP  A +   DG   GSGRSI G  +   +        G+++K GGHAMAAGL++E
Sbjct: 379 ERFHRPVIAFAPAGDGTLKGSGRSIAGLHLRDALERLDTLNPGLMLKFGGHAMAAGLSLE 438

Query: 450 RVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNP 509
              +      F       +       +   DG L     ++   +ML  AGP+G   P P
Sbjct: 439 TARYEEFRQRFADLVGEWLDGESLQGIIWSDGALQPQEFSLQTAEMLREAGPWGQAFPEP 498

Query: 510 VFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
            F     KL   R+V   HL++  E       +  IAF V  T   +    S  +++ + 
Sbjct: 499 AFDGK-FKLLQQRLVGERHLKVMVEPLNGGPLIDGIAFNVDTTLWPD----SSIRQVELA 553

Query: 569 GHLCVNYWRGSKRCQLRVLDASPV 592
             L +N +RG++  QL +    P+
Sbjct: 554 YKLDINEYRGNRSVQLIIDHIWPL 577


>gi|229135232|ref|ZP_04264031.1| Exonuclease RecJ [Bacillus cereus BDRD-ST196]
 gi|228648274|gb|EEL04310.1| Exonuclease RecJ [Bacillus cereus BDRD-ST196]
          Length = 781

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/589 (30%), Positives = 285/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + + R ++ +    DFLN + +    DP +L
Sbjct: 15  RWKEKEYNE--ELVSELANKLQLSPLVTSLFLGRGLNTEDKIVDFLNTTDQEFH-DPFLL 71

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L         YIP+R  +GY
Sbjct: 72  EGMDRTVERVKKAIENGEQILIFGDYDADGVSSTTVLYLALKELGAEVEFYIPNRFTEGY 131

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 132 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 191

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 192 HPKLEGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 240

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ + P INA GR+ ++
Sbjct: 241 LHGENRLLVQRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFALAPRINAVGRLEDA 300

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 301 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 359

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S +   +   GS RSI GFD+    + +    +
Sbjct: 360 KEGWNPGVIGIVASKLVERFYRPTIVLSIDPHKETAKGSARSIAGFDL--FANLSDCREL 417

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ A    P+  +D       V +A I
Sbjct: 418 LPHFGGHPMAAGMTLNMNDVDELRRRLNEQADVILTAEDFIPITAVDAFCKVEDVTLAAI 477

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 478 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFGTY 536

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G + +N W   K+ QL V D +      F  +
Sbjct: 537 ----AKEISPVAKVSVVGEVSINEWNNFKKPQLMVQDIAVEAWQLFDWR 581


>gi|256425938|ref|YP_003126591.1| single-stranded-DNA-specific exonuclease RecJ [Chitinophaga
           pinensis DSM 2588]
 gi|256040846|gb|ACU64390.1| single-stranded-DNA-specific exonuclease RecJ [Chitinophaga
           pinensis DSM 2588]
          Length = 568

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 160/578 (27%), Positives = 266/578 (46%), Gaps = 18/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLI 74
            RW     Q        +     I  ++ R+LV R + + D ++ F  P++  L  DP +
Sbjct: 3   KRWTVRSYQPKQEAL--LQSSLRIHPLLCRLLVQRGMHTYDESRLFFRPTLADLH-DPWL 59

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D DKA  RI QA ++ EKI++FGDYDVDG  +VA +  FL     N   YIP R  +G
Sbjct: 60  MKDMDKAVSRIEQAFFHREKILVFGDYDVDGTTAVATVYDFLHSLYNNIEFYIPHRYKEG 119

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   +E   +    LIIT+DCG  + D +++A + GID I+ DHH   +   PA A+
Sbjct: 120 YGISTQGIEYARDNEFTLIITLDCGIKAIDQIKWAADNGIDFIICDHHLPDAILPPAVAI 179

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP + D       L   G+ + ++    +          +  +   LDLVA +   D+V
Sbjct: 180 LNPKQYDCPYPYKELSGCGIGYKLISAFAQKKGI-----PDEQVHRYLDLVATSIAADIV 234

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           P+ G NR     GL         G++ALIE   +   +T  NL ++I P +NA GR+ ++
Sbjct: 235 PMTGENRVLAFHGLKKVNSAPLAGIQALIELSGLKEQLTISNLVFVIAPRVNAAGRMDDA 294

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                L +  D  +   +A  L   N +R+ ++  + ++A   +      ++     V+ 
Sbjct: 295 RKAVNLFVETDKDKAMEIAKVLHADNFDRKEIDGNITKEAVELLQNDLT-LKDKKSTVLY 353

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
              WH G+VG++A+RL +K+      I    + K  GS RS+ GF++ + +     + +L
Sbjct: 354 KPDWHKGVVGIVASRLIDKYYYRPTIILTLSNDKVAGSARSVTGFNVYEAIHQC--KDLL 411

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
              GGH  AAG+T++  N       F++     +   +  P   ID  ++   +  A  +
Sbjct: 412 ENYGGHFYAAGMTLKPENVEAFQQKFEEVVATTINPDLLVPEIVIDTEIHLKDITPAFFN 471

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSET-LQAIAFRVYGTP 552
           +L    P G  N  PVF   N       R+V   H++ + +   S   L  I F +    
Sbjct: 472 ILRQFEPLGPENLRPVFLVRNVVDSGYSRLVKDEHIKFSVKQGKSPNALTGIGFYMSE-- 529

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
             +F + S  +   +   +  N W G    QL+V+D  
Sbjct: 530 --KFHIVSSKQPFDMAFTIDENEWNGKMNLQLKVIDIR 565


>gi|270264902|ref|ZP_06193166.1| ssDNA exonuclease RecJ [Serratia odorifera 4Rx13]
 gi|270041200|gb|EFA14300.1| ssDNA exonuclease RecJ [Serratia odorifera 4Rx13]
          Length = 577

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 181/565 (32%), Positives = 276/565 (48%), Gaps = 20/565 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +  ++ R+   R V  +     L  S++ ++P    L   D A   + QA+  S +IM+
Sbjct: 21  GLHPLLRRLYALRGVKAEQE---LERSVKGMLP-WQQLDGIDTAVGILQQALAASRRIMV 76

Query: 98  FGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L     +  +  +P+R  DGYG +P ++E+    GA+LI+TV
Sbjct: 77  VGDFDADGATSTALTVLALRSMGGSAVDYLVPNRFEDGYGLSPEVVEQAAARGAELILTV 136

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S+  +  A  +G+ V+V DHH        A A+VNPN          L   GV F
Sbjct: 137 DNGISSHAGVDVAHAKGMQVLVTDHHLPGETLPAAEAIVNPNLRGCEFPSKSLAGVGVAF 196

Query: 217 LVLVLIYRILRQDNKVPL----NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   LR+            +L  LLDLVAL TV DVVPL   NR  V +GL   R
Sbjct: 197 YLMLALRARLRESGWFEQRALAMPNLAELLDLVALGTVADVVPLDANNRILVYQGLNRIR 256

Query: 273 R-QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PG++AL+E  N     + A +LG+ +GP +NA GR+ + ++G  LL+SDD  +  
Sbjct: 257 AGKCRPGIRALLEVANRDARQLAANDLGFALGPRLNAAGRLDDMSIGVALLLSDDIAQAR 316

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLT-QCDDIQQASVIVVEGDRWHPGIVGLLAAR 389
           MLA  LD LN  RR +E  M  +A       +         + +    WH G+VG+LA+R
Sbjct: 317 MLANDLDALNLTRREIEQGMQVEALQLCDELERSSTALPYGLAMYHPEWHQGVVGILASR 376

Query: 390 LKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV--EEGILVKGGGHAMAAGLT 447
           +KE+F RP  A +   +G   GSGRSI G  +   +        G+++K GGHAMAAGL+
Sbjct: 377 IKERFHRPVIAFAPAGEGILKGSGRSIAGLHMRDALERLDTLNPGLMMKFGGHAMAAGLS 436

Query: 448 VERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNP 507
           +E   F      F +     +   +   V   DG L    +++   ++L   GP+G   P
Sbjct: 437 LEEAKFDEFRQRFGELVGEWLDPAMLEGVIWSDGELAMQELSLETAELLREGGPWGQAFP 496

Query: 508 NPVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMH 566
            P F     ++   R+V   HL++  E       L  IAF V  T   +    S  + + 
Sbjct: 497 EPTFDGR-FRILQQRLVGEKHLKLMVEPLGGGPLLDGIAFNVDTTLWPD----SSVREVE 551

Query: 567 VTGHLCVNYWRGSKRCQLRVLDASP 591
           +   L VN +RG++  QL +    P
Sbjct: 552 LAYKLDVNEFRGNRNVQLLIQHLWP 576


>gi|65321775|ref|ZP_00394734.1| COG0608: Single-stranded DNA-specific exonuclease [Bacillus
           anthracis str. A2012]
          Length = 779

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/589 (30%), Positives = 281/589 (47%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW          R   +  K  +  +V  + + R +  +    DFLN        DP +L
Sbjct: 7   RWKEKEYN--GERVSELASKLQLSPLVVSLFLGRGLDTEDKILDFLNTE-NQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDRTVERVNKAIQNGEQILIFGDYDADGVSSTTVLYLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLDGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVKRGLKHMRMTKNIGLKALFKVANVSQSEITEESIGFSIAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            L   LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TLAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +  +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLCIDPVKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+      P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQAEEILTEEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G   +N W   K+ QL V D +      F  +
Sbjct: 527 --AYAKEISPVAKVSVIGEASINEWNNFKKPQLMVKDIAVEAWQLFDWR 573


>gi|228993148|ref|ZP_04153070.1| Exonuclease RecJ [Bacillus pseudomycoides DSM 12442]
 gi|228766607|gb|EEM15248.1| Exonuclease RecJ [Bacillus pseudomycoides DSM 12442]
          Length = 779

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 181/589 (30%), Positives = 281/589 (47%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + ++R +  +    DFLN   +    DP +L
Sbjct: 7   RWKEKSFNE--ELVSELASKLQLSPLVTSLFLSRGLDTEDKIVDFLNTGQQEFH-DPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D    RI QAI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDLTVERIGQAIQNGEQILIFGDYDADGVSSTTVLFLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN          G  LIITVD G  +    Q A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHRAGFSLIITVDTGIAAVHEAQVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLKGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKQMRMTKNIGLKALFKVANVSQSEITEESIGFSIAPRINAIGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 APAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEV-ENNYLPEDNKVLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +    E     GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLCIDPEKQTAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ +   TP+  +D +     V ++ I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQADAILTSEDFTPITTVDAICKVEDVTLSAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EEMQKLAPFGVGNPKPRIAIRDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S    + V G   +N W   K+ QL + D +      F  +
Sbjct: 527 --AYAKEISPVAHVSVVGEASINEWNNFKKPQLMIQDIAVDAWQLFDWR 573


>gi|153839364|ref|ZP_01992031.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus AQ3810]
 gi|149747112|gb|EDM58100.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio
           parahaemolyticus AQ3810]
 gi|328472049|gb|EGF42926.1| ssDNA exonuclease RecJ [Vibrio parahaemolyticus 10329]
          Length = 579

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 175/569 (30%), Positives = 278/569 (48%), Gaps = 25/569 (4%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           +IP I+ R+ +NR ++       L  S R L      L   ++A   + QAI   ++I++
Sbjct: 18  SIPPILKRIYINRGITD---IAQLETSARGLHSY-QKLGGIEQAVELLFQAIQEQKRIIV 73

Query: 98  FGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L     N  +  +P+R  DGYG +P ++++ +  GA++I+TV
Sbjct: 74  VGDFDADGATSSALSVLALRMLGSNNVDYLVPNRFEDGYGLSPEVVDQALELGAEMIMTV 133

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + ++YA   GI V+V DHH          A+VNPN          L   GV F
Sbjct: 134 DNGVSSIEGVRYAKENGITVLVTDHHLPGQVLPEVDAMVNPNLDSCAFPSKALAGVGVAF 193

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   +R+ N           L+ L+DLVAL TV DVVPL   NR  V +GL   R
Sbjct: 194 YLMMALCVHMRKHNWFAQQGMQEPKLMELIDLVALGTVADVVPLDENNRILVHQGLQRIR 253

Query: 273 RQG-NPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
                PG++ALIE        + A + G+ +GP INA GR+ + + G  LL+ ++     
Sbjct: 254 AGKARPGIQALIEVAKRDARRLVASDFGFALGPRINAAGRLDDMSFGVELLMCNNIHAAR 313

Query: 331 MLAMKLDVLNQNRRLMES--AMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
            +A +LD LNQ R+ +E        A  + L   ++ +    + +    WH G++G+LA+
Sbjct: 314 RMASELDGLNQTRKEIEEGMKQEAMAFCERLQFGENSELPYGLSLFQRDWHQGVIGILAS 373

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGL 446
           R+KEKF RP  A +   +G   GS RSI G  +   + F      G+++K GGHAMAAGL
Sbjct: 374 RIKEKFHRPVIAFADGGEGTIKGSCRSIPGLHMRDALDFIDTQNPGLIIKFGGHAMAAGL 433

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           T++  +F R    F +     +       V   DG L     ++ + + L + GP+G   
Sbjct: 434 TIKEQDFERFSRLFDEVVKKELDEAALKGVILTDGELKPEEFSMHIAEQLRAGGPFGQAF 493

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFES-----QDSETLQAIAFRVYGTPLGEFLMQSR 561
           P P+F     K+   ++V   HL++  E        +  +  IAF V      +    + 
Sbjct: 494 PEPIFDGE-FKVLHQKLVGEKHLKLMLEPLYKGHPTNVMIDGIAFNVDLRRWPD----AS 548

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            K + +   L VN +RG++  QL +    
Sbjct: 549 VKTVRLAYKLDVNEFRGNQSLQLMIDHIE 577


>gi|313675542|ref|YP_004053538.1| exonuclease recj [Marivirga tractuosa DSM 4126]
 gi|312942240|gb|ADR21430.1| exonuclease RecJ [Marivirga tractuosa DSM 4126]
          Length = 569

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 166/578 (28%), Positives = 270/578 (46%), Gaps = 18/578 (3%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
            +W+    +        ++Q   I  +++++L++R +S  + AK F  PSI     DP +
Sbjct: 5   KKWII-ASEPEQKMIHELSQSININPVLSKILLSRGISNFEEAKTFFRPSIED-CHDPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D   A  R+++A+ N E I+++GDYDVDG+ SVA+M  FL     N   YIPDR V+G
Sbjct: 63  MKDMPIAVERLIKALDNHESILVYGDYDVDGSTSVAMMYSFLKSYCKNLYYYIPDRYVEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++    +   LII++DCG  + D + YA ++ ID I+ DHH    +   A A+
Sbjct: 123 YGISYKGIDYAKEKNCSLIISLDCGIKAIDKVDYANSENIDFIICDHHNPSEKLPQAVAV 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R D       L   GV F ++                     LLDLVA++   D+V
Sbjct: 183 LDPKRKDCPYPFKELSGCGVGFKLIQAFCIQKEIPEHHAF-----ELLDLVAISIAADIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
            + G NR     GL        PG+KALI+   +   IT  NL + +GP INA GRI  +
Sbjct: 238 AVTGENRILAFYGLEKINFNPRPGIKALIQASGLKEKITISNLVFQLGPRINAAGRIDHA 297

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +L  RLL +    E  ++A  +   N  R+  +  +  +A + +  +   +  A   V+ 
Sbjct: 298 HLAVRLLTAIHEDEALIIAENVSHKNTTRKDFDQNITSEALSTI-EENTSMLSAKSTVLF 356

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
              WH G++G++A+R  E   RP+  ++ E +GK  GS RS++GFD+   +    E   L
Sbjct: 357 NKNWHKGVIGIVASRCIEHHYRPTIIMT-ESNGKATGSARSVDGFDLYSAIESCKEY--L 413

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
            + GGH  AAGLT+           F+      +      P  KID  +    +      
Sbjct: 414 EQFGGHKHAAGLTLAIDQIPSFAAAFEAVVQKNITEDQLIPKVKIDSYIEIDQITDKFYS 473

Query: 495 MLESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLAHLQMTFESQDSE-TLQAIAFRVYGTP 552
           +L    P+G GN  PVFA  N  +     ++   HL++T + +  +  + AI F +    
Sbjct: 474 ILSQMDPFGPGNMQPVFAAKNLSVLGEPLILKEKHLKLTVKDRSGKNKITAIGFGMAEYK 533

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                +        +   +  N++ G K  QL + D  
Sbjct: 534 A----LIMNSNAFELAFTIQENHFNGLKSLQLYLKDIR 567


>gi|310822730|ref|YP_003955088.1| single-stranded-DNA-specific exonuclease recj [Stigmatella
           aurantiaca DW4/3-1]
 gi|309395802|gb|ADO73261.1| Single-stranded-DNA-specific exonuclease RecJ [Stigmatella
           aurantiaca DW4/3-1]
          Length = 570

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 184/585 (31%), Positives = 299/585 (51%), Gaps = 26/585 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW+    +    +  ++ ++  +  + ARVL++R   + +    FL+  +  L PDP +L
Sbjct: 2   RWLL--PEAVDQQVASLARELGLHPLSARVLLHRGYRTPEAVSAFLSDKLADL-PDPFLL 58

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
                A  R+ +A+   EKI ++GDYDVDG  S +L+  FL         YIP R+ +GY
Sbjct: 59  KGMTSAVERLARALRLGEKITLYGDYDVDGVCSTSLLTLFLRQLGAQPATYIPHRLGEGY 118

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G N   M++   EG +L++T+DCG TS   +  A   G+DV+++DHH V +    A A++
Sbjct: 119 GLNLQAMDRIAQEGTRLLVTLDCGITSVAEVARARELGMDVVIVDHHTVPTTLPAAVAVL 178

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATVCDV 253
           NP++         LCAAGV F + + + + LR +          L  L+DLVALATV DV
Sbjct: 179 NPHQPGCDYPTKTLCAAGVAFNLCMGLRKHLRDEGFFATRKEPLLKGLMDLVALATVADV 238

Query: 254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS--PITAENLGYMIGPSINAGGRI 311
           VPL G NR  V  GL        PG++AL E   +    P+TA  +G+ +GP INA GR+
Sbjct: 239 VPLTGANRILVAHGLQELTAARRPGVRALKEVAGVEPEAPVTAGQVGFRLGPRINAAGRL 298

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
            +++LG +LL ++  ++   LA  LD  N  R+ +ES++L +A      Q + +  A  +
Sbjct: 299 HDASLGLQLLTAESLEDARRLAGVLDRANAERQGIESSILTEAL----KQAESLPHARGL 354

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V+  + WHPG++G++A+R+ E+F RP+  +   E G G GS RSIEGF +   +      
Sbjct: 355 VLYAEGWHPGVIGIVASRVVERFHRPTVMVGVNE-GIGKGSARSIEGFHLYDALHGC--A 411

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +L + GGH  AAGLT+E        + F++ A   +      P  K+D V+    ++  
Sbjct: 412 DMLSRFGGHKYAAGLTIEAGRLPAFREAFERIALERLTPEDLIPRCKVDAVVTPHELDER 471

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVV----NLAHLQMTFESQDSETLQAIAFR 547
            ++ L+  GP+G GNP PV      ++   RV+       H  +     D+  + AI F 
Sbjct: 472 AVESLQRLGPFGQGNPEPVLVLRK-QMARPRVLPPKTGHGHAHLKLALVDAPGVDAIGFG 530

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           +         +      + +   + ++ +RG +R  LR+ D    
Sbjct: 531 MADR------LSLVEGPVDLAFQVGMDTFRGQRRVSLRLKDLRIA 569


>gi|39997708|ref|NP_953659.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter
           sulfurreducens PCA]
 gi|39984600|gb|AAR35986.1| single-stranded-DNA-specific exonuclease RecJ [Geobacter
           sulfurreducens PCA]
 gi|298506642|gb|ADI85365.1| single-stranded DNA-specific exonuclease RecJ [Geobacter
           sulfurreducens KN400]
          Length = 578

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 175/578 (30%), Positives = 282/578 (48%), Gaps = 17/578 (2%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLI 74
             W        +   + +++  ++  ++AR+L NR V+     + FL  ++  L  DPL+
Sbjct: 7   KVWTIREPDRDV--VVRLSRDLSLDPLLARLLANRGVTDGIDGRRFLGATLADLR-DPLL 63

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           L   D A  R+  A+ N E++ ++GDYDVDG    AL++ F          +IP R+ DG
Sbjct: 64  LRGMDAAVERLCAALRNGEQVCVYGDYDVDGVTGTALLVSFFREVGFTCRYHIPKRLSDG 123

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   +      GA++I+TVDCG  S        + G+D+I+ DHH    E   A A+
Sbjct: 124 YGLSEDGIRAVAERGARVIVTVDCGIGSVAEADLCASLGVDLIITDHHSPGPELPRALAV 183

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVP--LNFDLLSLLDLVALATVCD 252
           +NP +         L   GV F +L+ +   LR+          +L   LDLVAL T+ D
Sbjct: 184 INPRQPGCSYPFKSLAGVGVAFNLLIALRGRLREQGCFTAGPEPNLRQYLDLVALGTIAD 243

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           VVPL+  NR +V  GL         G+ AL +   ++  +    +G+ + P +NA GR+ 
Sbjct: 244 VVPLVEENRIFVTYGLKEMSATSRVGVTALKDVAGVAGRVGCGAVGFRLAPRLNAAGRLE 303

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           +++LG  LL++ D      LA +LD  N  R+ +E ++L++A A V        + S+ V
Sbjct: 304 DASLGVELLLTGDRSRAATLAAELDRSNGERQALERSILDEATAMVRANPAMASKRSI-V 362

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +  D WHPG+VG++A+RL ++F RP+  I+ ++ G G GSGRS+    +   +S   E  
Sbjct: 363 LASDAWHPGVVGIVASRLVDRFHRPTILIALQD-GTGRGSGRSVPALHLLDALSACGEH- 420

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
            L K GGH  AAGL+++        D F+     ++      PV   D  L A  V  AL
Sbjct: 421 -LEKFGGHRQAAGLSIDEETLQAFVDRFEDVCAGLLGPDDLKPVVAADAELAADEVTPAL 479

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTP 552
           +D++E+  P+G GNP P+F      +   RV    HLQ+         + A+ F +    
Sbjct: 480 VDLIEALEPFGMGNPEPLFLLRGATICGRRVAGGHHLQLRL-DLGGRQVDAVGFNLAARD 538

Query: 553 LGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                  + G+R+ +      N W G ++ QL + D  
Sbjct: 539 ------GAPGERVDILFTAGWNSWNGRRKFQLTLKDLK 570


>gi|30264479|ref|NP_846856.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. Ames]
 gi|47529937|ref|YP_021286.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49187299|ref|YP_030551.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. Sterne]
 gi|165872010|ref|ZP_02216651.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0488]
 gi|170709257|ref|ZP_02899677.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0389]
 gi|190566914|ref|ZP_03019830.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           Tsiankovskii-I]
 gi|227817187|ref|YP_002817196.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. CDC 684]
 gi|229602672|ref|YP_002868695.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0248]
 gi|254724665|ref|ZP_05186448.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A1055]
 gi|254751352|ref|ZP_05203389.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. Vollum]
 gi|254757684|ref|ZP_05209711.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. Australia 94]
 gi|30259137|gb|AAP28342.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. Ames]
 gi|47505085|gb|AAT33761.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49181226|gb|AAT56602.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. Sterne]
 gi|164712300|gb|EDR17836.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0488]
 gi|170125833|gb|EDS94740.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0389]
 gi|190561905|gb|EDV15874.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           Tsiankovskii-I]
 gi|227004863|gb|ACP14606.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. CDC 684]
 gi|229267080|gb|ACQ48717.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0248]
          Length = 779

 Score =  413 bits (1062), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/589 (30%), Positives = 281/589 (47%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW          R   +  K  +  +V  + + R +  +    DFLN        DP +L
Sbjct: 7   RWKEKEYN--GERVSELASKLQLSPLVVSLFLGRGLDTEDKILDFLNTE-NQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDRTVERVNKAIQNGEQILIFGDYDADGVSSTTVLYLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLDGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVKRGLKHMRMTKNIGLKALFKVANVSQSEITEESIGFSIAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            L   LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TLAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +  +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLCIDPVKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+      P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQAEEILTEEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G   +N W   K+ QL V D +      F  +
Sbjct: 527 --AYAKEISPVAKVSVIGEASINEWNNFKKPQLMVKDIAVEAWQLFDWR 573


>gi|163731960|ref|ZP_02139407.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Roseobacter litoralis Och 149]
 gi|161395414|gb|EDQ19736.1| single-stranded-DNA-specific exonuclease RecJ, putative
           [Roseobacter litoralis Och 149]
          Length = 580

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 245/599 (40%), Positives = 338/599 (56%), Gaps = 33/599 (5%)

Query: 5   AFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPS 64
           +FLG+E S++G RWV     E    A  + Q+  +P  V +VL  R V  + A+ FL P+
Sbjct: 2   SFLGIERSLTGRRWVG-PTAEMERAAQTLEQRADLPAPVCQVLARRGVQAEDAQSFLAPA 60

Query: 65  IRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNAN 124
           +R LMPDP  L D  KAA R + A+   EKI IF DYDVDG +S AL++ +L      A 
Sbjct: 61  LRDLMPDPRSLKDMTKAATRFLDAVRKREKIAIFADYDVDGGSSAALLLSWLRQTGREAT 120

Query: 125 MYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQV 184
           +YIPDRI +GYGPN   M +       LI+ VDCG+ S+  +  A   G DV+V+DHH  
Sbjct: 121 LYIPDRIDEGYGPNDEAMAQLAR-AHDLIVCVDCGTLSHGPIAAAV--GADVLVLDHHLG 177

Query: 185 KSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDL 244
             E   A A+VNPNR D+    GHLCAAGVVFL+LV + R+LR+  +   + DL+S LDL
Sbjct: 178 TEELPAALAVVNPNRQDESGDLGHLCAAGVVFLLLVELRRLLREAGQ--TSPDLMSFLDL 235

Query: 245 VALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPS 304
           VALATV DV PL+G+NRA+V +GL V  R+   GL AL +   + +   A +LG+++GP 
Sbjct: 236 VALATVADVAPLVGINRAFVRQGLKVLARRERIGLTALADVAGVDTEPNAYHLGFILGPR 295

Query: 305 INAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD 364
           +NAGGRIG ++LG+RLL ++D  E   LA +LD LN  RR +E+A+   A A+   +  D
Sbjct: 296 VNAGGRIGAADLGARLLATNDPHEAAALAERLDKLNTERREIEAAVRATALAQAEERGLD 355

Query: 365 IQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKM 424
                ++   G  WHPG+VG++A+RLKE  GRPS  I   + G G GSGRS+ G D+G+ 
Sbjct: 356 ---RPLVWAAGADWHPGVVGIVASRLKEAAGRPSIVIGISD-GIGKGSGRSVSGIDLGQP 411

Query: 425 VSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLN 484
           +     EG+L+KGGGH MAAGLTVE            +       + I      IDG+L 
Sbjct: 412 IQRLAAEGLLLKGGGHKMAAGLTVEESKIETAMARLSELLEKQGASSIGAADLHIDGMLM 471

Query: 485 ASAVNIALIDMLES-----------AGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTF 533
             A  + L+  +E                        + F N  ++  + V   HL+++F
Sbjct: 472 PEAAAVELVQKIEQAGPFGAAAPAP-----------RYVFANVAVRFAKRVGENHLKLSF 520

Query: 534 ESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPV 592
            S    ++ AI F  Y T LG  L    G R H+ G L +N WRG +  QLR+ DA+P 
Sbjct: 521 GSDAG-SMDAICFGAYDTDLGPTLETHGGARFHLAGRLDINTWRGRQSVQLRLEDAAPA 578


>gi|170723303|ref|YP_001750991.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas putida
           W619]
 gi|169761306|gb|ACA74622.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas putida
           W619]
          Length = 569

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 177/562 (31%), Positives = 281/562 (50%), Gaps = 18/562 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V  +     L+ S+  L+P    L   D A   +V+A+   ++I+I
Sbjct: 17  NLPPLLTRLYAARGVQSE---AELDKSLARLLPY-QQLKGIDAAVDLLVEALDQRQRIII 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQRQPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + +  A   G+ V+V DHH    +   A A+VNPN+         L   GV+F
Sbjct: 133 DNGISSVEGVAAAKAAGLKVLVTDHHLPGQQLPVADAIVNPNQPGCDFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKVPL--NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
            VL+ +   LR   +       ++  LLDLVAL +V DVVPL   NR  V +GL   R  
Sbjct: 193 YVLMALRARLRSLGRYETQAQPNIGELLDLVALGSVADVVPLDANNRILVHQGLERIRAG 252

Query: 274 QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PGLKA++E        IT+ +LG+++GP +NA GR+ + +LG   L+ +D      +
Sbjct: 253 RARPGLKAILEVARRDHRRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCEDEALALDM 312

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           A +LD LNQ+R+ +E  M  +A A++     +     + + + + WH G++G+LA+RLKE
Sbjct: 313 AQQLDGLNQDRKSIEQGMQREALAQLKDLPVESMPYGLCLFDAE-WHQGVIGILASRLKE 371

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTVER 450
           ++ RP+ A +   +G   GS RS+ GF I   +    A    ++ K GGHAMAAGL++  
Sbjct: 372 RYHRPTIAFADAGEGMLKGSARSVPGFHIRDALDAVAARHPQLISKFGGHAMAAGLSLPE 431

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            NF    + F +     +     T     DG L     ++ L   L  AGP+G   P P+
Sbjct: 432 GNFPAFAEAFDEEVRRQLREEDLTGRLLSDGSLAVEEFHLDLAKALRHAGPWGQHFPEPL 491

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F     +L   RVV   HL++  +S+  S  L  IAF +      E       + + +  
Sbjct: 492 FHG-VFQLVEQRVVGERHLKVVLKSECGSVRLDGIAFGIDR----EVWPNPTVRWVELAY 546

Query: 570 HLCVNYWRGSKRCQLRVLDASP 591
            L VN +RG++  QL +    P
Sbjct: 547 KLDVNEFRGNESVQLMIAHMEP 568


>gi|251790994|ref|YP_003005715.1| single-stranded-DNA-specific exonuclease RecJ [Dickeya zeae
           Ech1591]
 gi|247539615|gb|ACT08236.1| single-stranded-DNA-specific exonuclease RecJ [Dickeya zeae
           Ech1591]
          Length = 576

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 183/566 (32%), Positives = 280/566 (49%), Gaps = 20/566 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           ++P ++ R+   R V        L  S+R L+ D  +L   ++A   + +A+  + +I+I
Sbjct: 20  SLPALLRRLYAQRGVRQ---MQELERSLRGLL-DYRLLGGIEQAVEVLRRALAENRRIVI 75

Query: 98  FGDYDVDGAASVALMMRFLSHCS-VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L           +P+R  DGYG +P ++ +   +GA+LI+TV
Sbjct: 76  VGDFDADGATSTALTVLALRSMGGYEVQYLVPNRFEDGYGLSPEVVAQAAVKGAELIVTV 135

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S+  +  A  +GI V+V DHH        A A++NPN  D       L   GV F
Sbjct: 136 DNGISSHAGVDDAHRRGIAVVVTDHHLPGETLPAAEAMINPNLSDCAFPSKALAGVGVAF 195

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   LR+            +L  LLDLVAL TV DVVPL   NR  V +GL   R
Sbjct: 196 YLMMALRASLRESGWFSERGLAEPNLAELLDLVALGTVADVVPLDANNRILVSQGLSRIR 255

Query: 273 R-QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PG++AL+E  N   + + A +LG+ +GP +NA GR+ + ++G  LL+ +D  +  
Sbjct: 256 AGKCRPGIRALLEVSNRDAAHLVASDLGFALGPRLNAAGRLDDMSVGVELLLCNDIVQAR 315

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI-VVEGDRWHPGIVGLLAAR 389
           MLA  LD LNQ+RR +E+ M  +A           +   +   +    WH G+VG+LA+R
Sbjct: 316 MLASDLDALNQSRREIEAGMQVEALQLCEQLERSRETLPLGLAMYHPEWHQGVVGILASR 375

Query: 390 LKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGLT 447
           +KE+F RP  A +   DG   GSGRSI G  +   +        G+++K GGHAMAAGL+
Sbjct: 376 IKERFHRPVIAFAPAGDGILKGSGRSIAGLHLRDALERLDTCHPGLMLKFGGHAMAAGLS 435

Query: 448 VERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNP 507
           +    F      F       + A     V   DG L    +++   +ML  AGP+G   P
Sbjct: 436 LVEDRFDEFRQRFADLVSEWLDAAQLEGVVWSDGELAPPELSLGTAEMLREAGPWGQAFP 495

Query: 508 NPVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMH 566
            P+F     +L   R+V   HL++  E       L  IAF V      +    S  + + 
Sbjct: 496 EPLFDGR-FRLLQQRLVGERHLKVMVEPLGGGPLLDGIAFNVDTLLWPD----SSVREVE 550

Query: 567 VTGHLCVNYWRGSKRCQLRVLDASPV 592
           +   L VN +RG +  QL +    P+
Sbjct: 551 LAYKLDVNEFRGKRSVQLLIEHLWPL 576


>gi|149910169|ref|ZP_01898815.1| putative single-stranded-DNA-specific exonuclease RecJ [Moritella
           sp. PE36]
 gi|149806755|gb|EDM66719.1| putative single-stranded-DNA-specific exonuclease RecJ [Moritella
           sp. PE36]
          Length = 576

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 183/565 (32%), Positives = 288/565 (50%), Gaps = 20/565 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           +P ++ ++  +R V  D     L   ++ L+  P  L     A   +V A+  +++I+I 
Sbjct: 20  VPALLRQIYASRGVKSDQE---LEKGVKNLLR-PNQLKGMTAACELLVSALVKNQRIIII 75

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL M         N +  +P+R   GYG +P +++     GAQLI+TVD
Sbjct: 76  GDFDADGATSTALSMLAFKMLGYRNIDFLVPNRFEFGYGLSPEIVDLAATNGAQLIMTVD 135

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S   +  A   GI V+V DHH   +E   A A+VNPN+        +L   GV F 
Sbjct: 136 NGISSIAGVAAAKALGIKVLVTDHHLPGNEIPDADAIVNPNQHGCTFPSKNLAGVGVAFY 195

Query: 218 VLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR- 272
           V++ +   LR+ +          +L  LLD+VAL TV DVVPL   NR  V +GL   R 
Sbjct: 196 VMLALRGALREQDWFAKQGITEPNLACLLDIVALGTVADVVPLDANNRILVHQGLQRIRA 255

Query: 273 RQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
            +  PG+KALIE  N +   + A +LG+ +GP +NA GR+ + ++G   L+ +D      
Sbjct: 256 DKCRPGIKALIEIANRNQAQLCASDLGFALGPRLNAAGRLDDMSVGVATLLCEDLNNARR 315

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDD-IQQASVIVVEGDRWHPGIVGLLAARL 390
            A +LD LN+ R+ +ES+M ++A A + +   D  Q    I +  D WH G+VGL+A+R+
Sbjct: 316 FAGELDSLNEERKEIESSMQQEALAILKSVDFDAGQVPYGICLFQDDWHQGVVGLVASRI 375

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGLTV 448
           KE+F RP  A +   +G+  GS RSI G  +  ++        G+++K GGHAMAAGL++
Sbjct: 376 KERFHRPVIAFADAGEGEIKGSARSIPGLHLRDVLELLDIRNPGMILKFGGHAMAAGLSL 435

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
               +      F      ++     T V   DG L +  +++   ++++ A P+G   P 
Sbjct: 436 RLDCYDEFAKQFNALVQELLTEEQLTGVVLSDGELLSEQLSLPTAELIKEAAPWGQMFPE 495

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P+F     KL+  R+V   HL+M  E  Q    + AIAF V      +    +  +++ +
Sbjct: 496 PIFDGI-FKLREQRLVGKKHLKMMLEPEQGGPLVDAIAFNVDLEVWPD----ASVQKIEL 550

Query: 568 TGHLCVNYWRGSKRCQLRVLDASPV 592
              L VN +RG +  Q  V    P+
Sbjct: 551 AYKLDVNEFRGKRSLQFMVEHLQPL 575


>gi|163942159|ref|YP_001647043.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           weihenstephanensis KBAB4]
 gi|163864356|gb|ABY45415.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus
           weihenstephanensis KBAB4]
          Length = 773

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/589 (30%), Positives = 284/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + + R ++ +    DFLN +      DP +L
Sbjct: 7   RWKEKEYNE--ELVSELANKLQLSPLVTSLFLGRGLNTEDKIVDFLN-TADQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L         YIP+R  +GY
Sbjct: 64  EGMDRTVERVKKAIENGEQILIFGDYDADGVSSTTVLYLALKELGAEVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ + P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFALAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLSIDPHKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ A    P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLNMNDVDELRRRLNEQADVILTAEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFGTY 528

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G + +N W   K+ QL V D +      F  +
Sbjct: 529 ----AKEISPVAKVSVVGEVSINEWNNFKKPQLMVQDIAVEAWQLFDWR 573


>gi|23099481|ref|NP_692947.1| single-strand DNA-specific exonuclease [Oceanobacillus iheyensis
           HTE831]
 gi|22777710|dbj|BAC13982.1| single-strand DNA-specific exonuclease [Oceanobacillus iheyensis
           HTE831]
          Length = 771

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 164/591 (27%), Positives = 285/591 (48%), Gaps = 33/591 (5%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDP 72
           S  +W      +  +   ++ +   +  ++ ++ + R ++  +  + FL+P I  L   P
Sbjct: 4   SKMKWRY---NQVEDHNSSLLKDTNLSPLLKQLFIQRGITTNEEVQRFLSPQIDDLHH-P 59

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            +L D +KA +RI +AI N EKI++FGDYD DG +S A+M++ L+      + YIP+R  
Sbjct: 60  FLLKDMEKAVQRIHKAIQNEEKILVFGDYDADGVSSTAVMLKALTELGATCDFYIPNRFT 119

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYGPN +       +G ++IITVD G TS      A   G+D+I+ DHH+ ++    ++
Sbjct: 120 EGYGPNEAAFRNASEQGYKVIITVDTGITSVHEANIANELGMDLIITDHHEPQTNIPESF 179

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A+++P    +      L   GV F     +          P        L   A+ T+ D
Sbjct: 180 AIIHPKCSPE-YPFNELAGVGVAFKFAEALL------GYFPS-----QFLSYTAIGTIAD 227

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           +VPL   NR     GL   R   + GLKALI+   I   +  +++G+ IGP +NA GR+ 
Sbjct: 228 LVPLFDENRVLASYGLKELRATTDVGLKALIQVCQIED-LDEQSIGFSIGPRLNAVGRLQ 286

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
           +++L   LL+++D +    +A +++ +N  R+ +   ++ +A+  V ++     +  +IV
Sbjct: 287 DADLAVELLLTEDMEAALEIANEINKINDERKKVVQRIVSEADQIVNSK----PERRIIV 342

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAI-SFEEDGKGIGSGRSIEGFDIGKMVSFAVEE 431
           V  + W+ G++G++A+ L  K+ RP+  + +  E+G   GS RSI  FD+          
Sbjct: 343 VSNEAWNQGVLGIVASHLVRKYDRPAIVLSTQPENGVVKGSARSIPAFDL--FEGCMRMR 400

Query: 432 GILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIA 491
            +    GGH+ AAG+T+   N  +L        +N +         +I G LN   +NI 
Sbjct: 401 DLFTHFGGHSQAAGMTLPIENVDKLELQLDDILNNELAEEDLKQELEISGQLNMENINIE 460

Query: 492 LIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVY 549
           LI  +    P+G  NP PVF         I+ +     HL+M F  ++S  + AI F   
Sbjct: 461 LIKDISKLAPFGMKNPKPVFQIKEIP-SDIKRIGSKKNHLKMQFR-KNSTRMDAIGFGWG 518

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                 +   +    + + G L +N W G++  QL + D    E   F  +
Sbjct: 519 DA----YNQIAPHTPIQIAGELSINEWNGNQTAQLMIQDMKIDEWQLFDYR 565


>gi|167636494|ref|ZP_02394791.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0442]
 gi|170688663|ref|ZP_02879868.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0465]
 gi|254684164|ref|ZP_05148024.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. CNEVA-9066]
 gi|254741549|ref|ZP_05199236.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. Kruger B]
 gi|167528087|gb|EDR90884.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0442]
 gi|170667349|gb|EDT18107.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0465]
          Length = 779

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/589 (30%), Positives = 281/589 (47%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW          R   +  K  +  +V  + + R +  +    DFLN        DP +L
Sbjct: 7   RWKEKEYN--GERVSELASKLQLSPLVVSLFLGRGLDTEDKILDFLNTE-NQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDRTVERVNKAIQNGEQILIFGDYDADGVSSTTVLYLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLDGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVKRGLKHMRMTKNIGLKALFKVANVSQSEITEESIGFSIAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            L   LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TLAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +  +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLCIDPVKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+      P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQAEEILTEEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G   +N W   K+ QL V D +      F  +
Sbjct: 527 --AYVKEISPVAKVSVIGEASINEWNNFKKPQLMVKDIAVEAWQLFDWR 573


>gi|255533564|ref|YP_003093936.1| single-stranded-DNA-specific exonuclease RecJ [Pedobacter heparinus
           DSM 2366]
 gi|255346548|gb|ACU05874.1| single-stranded-DNA-specific exonuclease RecJ [Pedobacter heparinus
           DSM 2366]
          Length = 567

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 166/577 (28%), Positives = 273/577 (47%), Gaps = 16/577 (2%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
            RWV  L       AL + Q+  I   +A++LV R +S  + A+ +  P +  L  DP +
Sbjct: 3   KRWVQALQGNKETTAL-LAQQLNIDSSLAQILVQRGISSFEEARQYFRPDMGRLH-DPFL 60

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D DKA  RI +AI + EKI+++GDYDVDG  SVAL   F S  +     YIPDR  +G
Sbjct: 61  MKDMDKAIERIDKAINSREKILVYGDYDVDGTTSVALAFSFFSQFTDQIGYYIPDRHKEG 120

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG + + ++     G  LII +DCG  S D + YA +  ID I+ DHH        A A+
Sbjct: 121 YGISTAGIDYANANGISLIIALDCGIKSTDKIAYANSLNIDFIICDHHLPGEVLPAAVAI 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           ++P R D       L   G+ F +        R              LDLV ++   D+V
Sbjct: 181 LDPKRKDCPYPFKELAGCGIGFKLAQAYCLQHRL-----PQEQYERYLDLVMVSIAADIV 235

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGES 314
           P+   NR     GL+        GLKAL++    +   T  ++ + + P INA GR+  +
Sbjct: 236 PIEDENRILAYHGLIKLNSNPCIGLKALMDISGKNKDYTLTDVVFTLAPRINAAGRMDHA 295

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           N   ++L+  +    +  ++ +++ N  R+  +  M  +A A +  +C+ +      VV 
Sbjct: 296 NQAVKMLLCTEDNLAQEQSLLINLQNTERKTSDQNMTAEALALI-AECEILINKKTTVVY 354

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGIL 434
            + W+ G++G++A+RL EK+ RP+  ++ + +G   GS RS+ GFD+ + +     E +L
Sbjct: 355 HENWNKGVIGIVASRLTEKYYRPTVVLT-KSNGLLTGSARSVAGFDLYEALLGC--EDLL 411

Query: 435 VKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALID 494
           V+ GGH  AAGLT++  + G   + F+      +   +  P   ID  +    ++     
Sbjct: 412 VQFGGHKFAAGLTIKAEDIGFFTERFENIVAATITEDLLCPEISIDNEIRLRQIDGKFQR 471

Query: 495 MLESAGPYGAGNPNPVFAFPNHKL-QSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPL 553
           ++    P+G  N  PVF      L     VV   HL++  + Q+S   + IAF +     
Sbjct: 472 IIAQMAPFGPHNMAPVFVSHEVFLASKPYVVGTKHLKLAIKQQNSSIFECIAFGMAEEY- 530

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
               +    +   V   +  N W+  KR QL + +  
Sbjct: 531 --EQLLQPNQPFSVCYTIEENIWKAQKRLQLNIKEIK 565


>gi|269964521|ref|ZP_06178761.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio alginolyticus
           40B]
 gi|269830758|gb|EEZ84977.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio alginolyticus
           40B]
          Length = 579

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 177/569 (31%), Positives = 278/569 (48%), Gaps = 25/569 (4%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           +IP I+ R+ +NR ++       L  S R L      L   ++A   + QAI   ++I++
Sbjct: 18  SIPPILKRIYINRGITD---LSQLETSARGLHSY-QKLGGIEQAVDLLFQAIKEQKRIIV 73

Query: 98  FGDYDVDGAASVALMMRFLSHCS-VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L      N +  +P+R  DGYG +P ++++ +  GA++I+TV
Sbjct: 74  VGDFDADGATSSALSVLALRMLGSHNVDYLVPNRFEDGYGLSPEVVDQALELGAEMIMTV 133

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + ++YA   GI V+V DHH          A+VNPN          L   GV F
Sbjct: 134 DNGVSSIEGVRYAKENGITVLVTDHHLPGQVLPDVDAMVNPNLDSCSFPSKALAGVGVAF 193

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   +R+ N           L+ L+DLVAL TV DVVPL   NR  V +GL   R
Sbjct: 194 YLMMALCVHMRKHNWFAEQGMQEPKLMELIDLVALGTVADVVPLDENNRILVHQGLQRIR 253

Query: 273 RQG-NPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
                PG++ALIE        + A + G+ +GP INA GR+ + + G  LL+ ++     
Sbjct: 254 AGKARPGIQALIEVAKRDARRLVASDFGFSLGPRINAAGRLDDMSFGVELLMCNNIHAAR 313

Query: 331 MLAMKLDVLNQNRRLMESAM--LEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
            +A +LD LNQ R+ +E  M     A  + L   +  +    + +    WH G++G+LA+
Sbjct: 314 RMASELDGLNQTRKEIEEGMKQEAMAFCERLQFGEGNELPYGLALFQRDWHQGVIGILAS 373

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGL 446
           R+KEKF RP  A +   +G   GS RSI G  +   + F      G+++K GGHAMAAGL
Sbjct: 374 RIKEKFHRPVIAFADGGEGTIKGSCRSIPGLHMRDALDFIDTQNPGLIIKFGGHAMAAGL 433

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           T++  +F R    F +     +       V   DG L     ++ + + L S GP+G   
Sbjct: 434 TIKEQDFERFSRLFDEVVKKELDEAALKGVIMSDGELKPEEFSMHVAEQLRSGGPFGQAF 493

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFES-----QDSETLQAIAFRVYGTPLGEFLMQSR 561
           P P+F     K+   ++V   HL++  E        +  +  IAF V      +    + 
Sbjct: 494 PEPIFDGE-FKVLHQKLVGEKHLKLMLEPLYKGHPTNVMIDGIAFNVDLRRWPD----AS 548

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            K + +   L VN +RG++  QL +    
Sbjct: 549 VKTVRLAYKLDVNEFRGNQSLQLMIDHIE 577


>gi|172035400|ref|YP_001801901.1| single-stranded-DNA-specific exonuclease [Cyanothece sp. ATCC
           51142]
 gi|171696854|gb|ACB49835.1| single-stranded-DNA-specific exonuclease [Cyanothece sp. ATCC
           51142]
          Length = 654

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 170/583 (29%), Positives = 287/583 (49%), Gaps = 20/583 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPD 71
           +   RW          +   +  +  +  ++A+V++NR +     A+ ++NP +  L PD
Sbjct: 3   LPDQRWYIASPNPD--QVKMLVAETGLSPLLAQVILNRGIDSPNLAQVYINPEVETL-PD 59

Query: 72  P-LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
           P     D   +   + +AI   EKI I GDYD DG  S +L++R L+H   +A   IP R
Sbjct: 60  PLDEFPDLLSSIELLKEAIEIGEKIAICGDYDADGMTSTSLLLRALTHLGGDAYYEIPSR 119

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           + DGYG N  ++EKF  EG  +++TVD G  +Y+ ++ A   G+ VI+ DHH +  +  P
Sbjct: 120 MKDGYGINERIVEKFAEEGVGVVLTVDNGIAAYEPIKRAIELGLTVIITDHHDLPEKLPP 179

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
           A A++NP  L   S    L   GV +++ V +     +         + SLL+L  L T+
Sbjct: 180 ADAILNPKLLSIHSPYRGLAGVGVAYILAVTLAEQFNKTE-----EIIDSLLELFTLGTI 234

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN---ISSPITAENLGYMIGPSINA 307
            D+ PL+G+NR ++ KGL         G++AL++          +  +++G+ +GP INA
Sbjct: 235 ADLAPLVGVNRRWLKKGLKQLPNSQLAGIQALMQVAGVSEEQKQLKPDDIGFKLGPRINA 294

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRIG+      LL +DD       AM+ + +N  R+ +   + ++A   + T   + ++
Sbjct: 295 VGRIGDPQTAIELLTTDDPGIALERAMQCEQINGKRKGLCEEIEKEAIHLIKTTPINYKK 354

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
             V+VV   +WH G++G++A+RL E++G P F  ++EED      G +    +     + 
Sbjct: 355 DRVLVVINHKWHHGVIGIVASRLVERYGVPVFIGTYEEDDPSKIRGSARGIEEFNIFEAL 414

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
              + +L K GGH  A G  ++  N     +   +FAH ++      P+ KIDG  N   
Sbjct: 415 VYCDDLLGKYGGHKAAGGFGLKSNNLIAFKERLSQFAHQLLEPHHIKPLVKIDGEANFKQ 474

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
           +N  L   ++S  P+G  N  PVF  PN K+   R V   HL++    +D + ++AIA+R
Sbjct: 475 LNAQLYQHIDSLQPWGIENAFPVFWTPNVKILEQRTVGKNHLKLVLGQEDGQEMKAIAWR 534

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                          KR+ +   L  NYW G+   +L ++   
Sbjct: 535 FGSYF-------PLPKRLDIAYKLTENYWNGTVNIELEIVGVR 570


>gi|167032095|ref|YP_001667326.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas putida
           GB-1]
 gi|166858583|gb|ABY96990.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas putida
           GB-1]
          Length = 569

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 175/562 (31%), Positives = 280/562 (49%), Gaps = 18/562 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V  +     L+ S+  L+P    L   +     +V+A+   ++I+I
Sbjct: 17  NLPPLLTRLYAARGVQSE---AELDKSLARLLPY-QQLKGIEAGVDLLVEALDQRQRILI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQRQPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + +  A   G+ V+V DHH    +   A A++NPN+         L   GV+F
Sbjct: 133 DNGISSVEGVAAAKAAGLKVLVTDHHLPGQQLPDADAIINPNQPGCTFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKVPL--NFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
            VL+ +   LR   +       ++  LLDLVAL +V DVVPL   NR  V +GL   R  
Sbjct: 193 YVLMALRARLRSLGRYETQAQPNIGELLDLVALGSVADVVPLDANNRILVHQGLERIRAG 252

Query: 274 QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PGLKA++E        IT+ +LG+++GP +NA GR+ + +LG   L+ +D+   + +
Sbjct: 253 RARPGLKAILEVARRDHRRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCEDAALAQDM 312

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           A +LD LNQ+R+ +E  M  +A A++     +      + +    WH G++G+LA+RLKE
Sbjct: 313 AQQLDDLNQDRKSIEQGMQREALAQLKDLPVE-SMPYGLCLFDADWHQGVIGILASRLKE 371

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTVER 450
           ++ RP+ A +   +G   GS RS+ GF I   +    A    ++ K GGHAMAAGL++  
Sbjct: 372 RYHRPTIAFADAGEGMLKGSARSVPGFHIRDALDAVAARHPQLISKFGGHAMAAGLSLPE 431

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            NF    + F +     +     T     DG L     ++ L   L  AGP+G   P P+
Sbjct: 432 GNFQAFAEAFDEEVRRQLREEDLTGRLLSDGSLAVEEFHLDLAKALRHAGPWGQHFPEPL 491

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F     +L   RVV   HL++  +S+  S  L  IAF V      E       + + +  
Sbjct: 492 FHG-VFQLVEQRVVGERHLKVVLKSECGSVRLDGIAFGVDR----EVWPNPTVRWVELAY 546

Query: 570 HLCVNYWRGSKRCQLRVLDASP 591
            L VN +RG++  QL +    P
Sbjct: 547 KLDVNEFRGNESVQLMIAHMEP 568


>gi|330975449|gb|EGH75515.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 571

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/564 (31%), Positives = 286/564 (50%), Gaps = 20/564 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V+ +     L+ S+  L+P    L   D A   +V A+   ++++I
Sbjct: 17  DLPPLLTRLYAARGVACE---AELDKSLARLIPY-QQLKGIDAAVDLLVTALREGQRMLI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQREPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + +  A   G+ V+V DHH    E   A A+VNPN+         L   GV+F
Sbjct: 133 DNGISSVEGVAAAKAAGLQVLVTDHHLPGHELPAADAIVNPNQPGCTFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKV----PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            VL+ +   LR+            +L  LLDLVAL +V DVVPL   NR  V +GLM  R
Sbjct: 193 YVLMALRARLRETGWFQSNQRAQPNLGELLDLVALGSVADVVPLDANNRILVHQGLMRIR 252

Query: 273 R-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PGL+A++E        IT+ +LG+++GP +NA GR+ + +LG   L+ DD     
Sbjct: 253 AGRARPGLRAILEVARREPSRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCDDPTLAR 312

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A++LD LNQ+R+ +E  M  +A A++     +     + + + + WH G++G+LA+RL
Sbjct: 313 EMAVQLDELNQDRKSIEQGMQREALAQLKDLPLESMPFGLCLFDAE-WHQGVIGILASRL 371

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTV 448
           KE++ RP+ A +   +G   GS RS+ GF I   +    A    ++ K GGHAMAAGL++
Sbjct: 372 KERYHRPTIAFASAGEGVLKGSARSVPGFHIRDALDAVAASHPHLISKFGGHAMAAGLSL 431

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
              NF    + F +     +     T     DG L     ++ L   L +AGP+G   P 
Sbjct: 432 PEENFPAFAEAFDQEVRRQLDEQDLTGRLLSDGSLAVEEFHLELARALRNAGPWGQHFPE 491

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P+F     +L   RVV   HL+M  +++  S  L  IAF V      +       + + +
Sbjct: 492 PLFHG-VFQLVEQRVVGERHLKMVLKTECGSVKLDGIAFGVDR----DIWPNPNIRWVEL 546

Query: 568 TGHLCVNYWRGSKRCQLRVLDASP 591
              L +N +RG++  QL V+  +P
Sbjct: 547 AYKLDLNEFRGNETVQLMVVHIAP 570


>gi|330896007|gb|EGH28230.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           pv. japonica str. M301072PT]
 gi|330936896|gb|EGH41027.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           pv. pisi str. 1704B]
          Length = 571

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/564 (31%), Positives = 286/564 (50%), Gaps = 20/564 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V+ +     L+ S+  L+P    L   D A   +V A+   ++++I
Sbjct: 17  DLPPLLTRLYAARGVACE---AELDKSLARLIPY-QQLKGIDAAVDLLVTALREGQRMLI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQREPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + +  A   G+ V+V DHH    E   A A+VNPN+         L   GV+F
Sbjct: 133 DNGISSVEGVAAAKAAGLQVLVTDHHLPGHELPAADAIVNPNQPGCTFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKV----PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            VL+ +   LR+            +L  LLDLVAL +V DVVPL   NR  V +GLM  R
Sbjct: 193 YVLMALRARLRETGWFESNQRAQPNLGELLDLVALGSVADVVPLDANNRILVHQGLMRIR 252

Query: 273 R-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PGL+A++E        IT+ +LG+++GP +NA GR+ + +LG   L+ DD     
Sbjct: 253 AGRARPGLRAILEVARREPSRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCDDPTLAR 312

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A++LD LNQ+R+ +E  M  +A A++     +     + + + + WH G++G+LA+RL
Sbjct: 313 EMAVQLDELNQDRKSIEQGMQREALAQLKDLPLESMPFGLCLFDAE-WHQGVIGILASRL 371

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTV 448
           KE++ RP+ A +   +G   GS RS+ GF I   +    A    ++ K GGHAMAAGL++
Sbjct: 372 KERYHRPTIAFASAGEGVLKGSARSVPGFHIRDALDAVAASHPHLISKFGGHAMAAGLSL 431

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
              NF    + F +     +     T     DG L     ++ L   L +AGP+G   P 
Sbjct: 432 PEENFPAFAEAFDQEVRRQLDEQDLTGRLLSDGSLAVEEFHLELARALRNAGPWGQHFPE 491

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P+F     +L   RVV   HL+M  +++  S  L  IAF V      +       + + +
Sbjct: 492 PLFHG-VFQLVEQRVVGERHLKMVLKTECGSVKLDGIAFGVDR----DIWPNPNIRWVEL 546

Query: 568 TGHLCVNYWRGSKRCQLRVLDASP 591
              L +N +RG++  QL V+  +P
Sbjct: 547 AYKLDLNEFRGNETVQLMVVHIAP 570


>gi|160883196|ref|ZP_02064199.1| hypothetical protein BACOVA_01165 [Bacteroides ovatus ATCC 8483]
 gi|156111421|gb|EDO13166.1| hypothetical protein BACOVA_01165 [Bacteroides ovatus ATCC 8483]
          Length = 588

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 162/584 (27%), Positives = 276/584 (47%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W       E    +  + Q+  I  I+ ++LV R ++    AK F  P +  L  DP +
Sbjct: 20  KWNYRPITPEQAETSQTLAQELGISPILGQLLVQRGITKAADAKKFFRPQLPDLH-DPFL 78

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+ +A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 79  MKDMDIAVERLNRAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNLDYYIPDRYNEG 138

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 139 YGISKKGVDYAAETGVGLIIVLDCGIKAVEEITYAKEKGIDFIICDHHVPDDVLPPAVAI 198

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +         +        L+ LLD+VA++   D+V
Sbjct: 199 LNAKRLDNTYPYTHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDIVAVSIASDIV 253

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + G+KA+I+        IT  ++ + IGP INA GRI  
Sbjct: 254 PIMGENRILAYHGLKQLNSNPSIGMKAIIDVCGLSEKEITVSDIVFKIGPRINASGRIQN 313

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL   D       A +++  N+ R+ ++ +M E+A   ++   + +     IV+
Sbjct: 314 GKEAVDLLTEKDFSIALEKAGQINQYNETRKDLDKSMTEEANN-IVANLEGLADRRSIVL 372

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K +       +
Sbjct: 373 YNEEWHKGVIGIVASRLTEVYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEHC--RDL 429

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+++    +    T+ V +ID  ++   ++    
Sbjct: 430 LENFGGHTYAAGLSMKVENVDAFTKRFEEYVSQHILPEQTSAVIEIDAEIDFRDISSKFF 489

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  P+F   +     + +VV     H+++     + +  +  IAF   
Sbjct: 490 NDLKKFNPFGPDNTKPIFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 549

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 550 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 588


>gi|138896148|ref|YP_001126601.1| single-strand DNA-specific exonuclease [Geobacillus
           thermodenitrificans NG80-2]
 gi|134267661|gb|ABO67856.1| Single-strand DNA-specific exonuclease [Geobacillus
           thermodenitrificans NG80-2]
          Length = 785

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 180/589 (30%), Positives = 283/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           RW      E       + ++  I  ++A++LV R V +   A  FL+P +     DP +L
Sbjct: 7   RWEVDCPDE--QTVRRLAEEADIAPLLAKLLVRRGVRTAAEAAAFLDP-LGQPFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              ++A RR+ +AI   E ++++GDYD DG  S ++M+  L     +   YIP+R  +GY
Sbjct: 64  DGMERAVRRLERAINTGELVLVYGDYDADGVCSTSVMVSALKEAGASVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN +        G  +I+TVD G  + D +  A   G+DVIV DHH+       AYA++
Sbjct: 124 GPNLAAFRAAKERGVSVIVTVDNGIAAVDEIAAANEWGLDVIVTDHHEPGPVLPEAYAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P +         L   GV F V   +   +              LLDLVA+ T+ D+VP
Sbjct: 184 HPKKPGSTYPFRDLAGVGVAFKVAHALLGRVP-----------RHLLDLVAIGTIADLVP 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGES 314
           L+G NR    +GL   R     GL+AL  +  I +  +  + +G+ I P +NA GR+G +
Sbjct: 233 LVGENRLLAAQGLEALRETNRVGLRALWRQCRIDAMTVNEQTVGFAIAPRLNAAGRLGGA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
           +    LL++DD  E   LA ++D LN+ R+ + + M E+A   V  Q    +   V+VV 
Sbjct: 293 DPAVALLMTDDEGEAARLAQEMDELNRERQQLVAQMAEEAAEMVRRQFPPEEHR-VLVVA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
           G+ W+PG+VG++A++L E+F RP+  +S   E G   GS RSI GFD+    S +    I
Sbjct: 352 GEGWNPGVVGIVASKLVEQFYRPAVVLSMDREKGIAKGSARSIHGFDL--FASLSQCRDI 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L +     A   +     TP   ID   +   + ++  
Sbjct: 410 LPHFGGHPMAAGMTLALDDVEELRERLNAIAARTLSDDDFTPPTFIDAACSVDELTLSAA 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLA--HLQMTFESQDSETLQAIAFRVYGT 551
              E   P+G  NP P+       ++++R V     H++  F SQ+   + AI F +   
Sbjct: 470 RSFERLAPFGVSNPRPLLLIEEVAVETMRRVGANGAHMKAVF-SQNGAAIDAIGFGLG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   + G  +   G L VN W G  + QL + D +      F  +
Sbjct: 527 --PLCEEIAPGACVSAVGELSVNEWNGLAKPQLSLCDVAVSSCQVFDVR 573


>gi|299148228|ref|ZP_07041290.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           3_1_23]
 gi|298512989|gb|EFI36876.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           3_1_23]
          Length = 572

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 162/584 (27%), Positives = 276/584 (47%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W       E    +  + Q+  I  I+ ++LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYRPITPEQAETSQTLAQELGISPILGQLLVQRGITKAADAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+ +A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDIAVERLNRAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNLDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGISKKGVDYAAETGVGLIIVLDCGIKAVEEITYAKEKGIDFIICDHHVPDDVLPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +         +        L+ LLD+VA++   D+V
Sbjct: 183 LNAKRLDNTYPYTHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDIVAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + G+KA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAYHGLKQLNSNPSIGMKAIIDVCGLSEKEITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL   D       A +++  N+ R+ ++ +M E+A   ++   + +     IV+
Sbjct: 298 GKEAVDLLTEKDFSVALEKAGQINQYNETRKDLDKSMTEEANN-IVANLEGLADRRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K +       +
Sbjct: 357 YNEEWHKGVIGIVASRLTEVYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEHC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+++    +    T+ V +ID  ++   ++    
Sbjct: 414 LENFGGHTYAAGLSMKVENVNAFTKRFEEYVSQHILPEQTSAVIEIDAEIDFRDISSKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  P+F   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NDLKKFNPFGPDNTKPIFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 534 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 572


>gi|91226784|ref|ZP_01261437.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio alginolyticus
           12G01]
 gi|91188915|gb|EAS75199.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio alginolyticus
           12G01]
          Length = 579

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 176/569 (30%), Positives = 277/569 (48%), Gaps = 25/569 (4%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           +IP I+ R+ +NR ++       L  S R L      L   ++A   + QAI   ++I++
Sbjct: 18  SIPPILKRIYINRGITD---LSQLETSARGLHSY-QKLGGIEQAVDLLFQAIKEQKRIIV 73

Query: 98  FGDYDVDGAASVALMMRFLSHCS-VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L      N +  +P+R  DGYG +P ++++ +  GA++I+TV
Sbjct: 74  VGDFDADGATSSALSVLALRMLGSHNVDYLVPNRFEDGYGLSPEVVDQALELGAEMIMTV 133

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + ++YA   GI V+V DHH          A+VNPN          L   GV F
Sbjct: 134 DNGVSSIEGVRYAKENGITVLVTDHHLPGQVLPDVDAMVNPNLDSCSFPSKALAGVGVAF 193

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   +R+ N           L+ L+DLVAL TV DVVPL   NR  V +GL   R
Sbjct: 194 YLMMALCVHMRKHNWFAEQGMQEPKLMELIDLVALGTVADVVPLDENNRILVHQGLQRIR 253

Query: 273 RQG-NPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
                PG++ALIE        + A + G+ +GP INA GR+ + + G  LL+ ++     
Sbjct: 254 AGKARPGIQALIEVAKRDARRLVASDFGFALGPRINAAGRLDDMSFGVELLMCNNIHAAR 313

Query: 331 MLAMKLDVLNQNRRLMES--AMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
            +A +LD LNQ R+ +E        A  + L   +  +    + +    WH G++G+LA+
Sbjct: 314 RMASELDGLNQTRKEIEEGMKQEAMAFCERLQFGEGNELPYGLALFQRDWHQGVIGILAS 373

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGL 446
           R+KEKF RP  A +   +G   GS RSI G  +   + F      G+++K GGHAMAAGL
Sbjct: 374 RIKEKFHRPVIAFADGGEGTIKGSCRSIPGLHMRDALDFIDTQNPGLIIKFGGHAMAAGL 433

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           T++  +F R    F +     +       V   DG L     ++ + + L S GP+G   
Sbjct: 434 TIKEQDFERFSRLFDEVVKKELDEAALKGVIMSDGELKPEEFSMHVAEQLRSGGPFGQAF 493

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFES-----QDSETLQAIAFRVYGTPLGEFLMQSR 561
           P P+F     K+   ++V   HL++  E        +  +  IAF V      +    + 
Sbjct: 494 PEPIFDGE-FKVLHQKLVGEKHLKLMLEPLYKGHPTNVMIDGIAFNVDLRRWPD----AS 548

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            K + +   L VN +RG++  QL +    
Sbjct: 549 VKTVRLAYKLDVNEFRGNQSLQLMIDHIE 577


>gi|24372539|ref|NP_716581.1| single-stranded-DNA-specific exonuclease RecJ [Shewanella
           oneidensis MR-1]
 gi|24346551|gb|AAN54026.1|AE015540_6 single-stranded-DNA-specific exonuclease RecJ [Shewanella
           oneidensis MR-1]
          Length = 574

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 172/565 (30%), Positives = 271/565 (47%), Gaps = 21/565 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ ++   R V     +  L   +R     P  +   D AA+ I  A+   + I+I
Sbjct: 19  HLPPLLRQLYARRGVLPSECELVLKGLLR-----PDTMKGLDLAAKLIADAMQLDKSILI 73

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S ++ +  L        +  IP+R   GYG +P ++    ++ AQL+ITV
Sbjct: 74  VGDFDADGATSTSVCILALRMMGASKVDYLIPNRFDYGYGLSPEIVAVAASKQAQLLITV 133

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + +  A   G+ V++ DHH    E   A A+VNPN+         +   GV F
Sbjct: 134 DNGISSIEGVAAAKAFGMQVVITDHHLPGHELPKADAIVNPNQPGCQFASKSIAGVGVAF 193

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            ++  +   LR  N          +L +LLD+VAL TV DVV L   NR  V  GL   R
Sbjct: 194 YLMTALRAELRARNWYQARGIAEPNLGTLLDIVALGTVADVVSLDTNNRILVEAGLQRVR 253

Query: 273 R-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +   G+ AL+E    +   I A + G+ +GP +NA GR+ E  LG   L+ +D     
Sbjct: 254 SGRCRVGITALLEVAKRNPARIVASDFGFAVGPRLNAAGRLDEMALGVETLLCEDMMYAR 313

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKV-LTQCDDIQQASVIVVEGDRWHPGIVGLLAAR 389
            +A +LD LNQ RR +E  M ++A   +   + ++ Q    I +  + WH G++G+LA+R
Sbjct: 314 RMAAELDSLNQERRELEVGMQQEALKSLEYLKLNEEQLPWGIALFQEDWHQGVIGILASR 373

Query: 390 LKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV--EEGILVKGGGHAMAAGLT 447
           +K+K+ RP  A +   +G+  GS RSI+G  +  ++        G++ K GGHAMAAGLT
Sbjct: 374 IKDKYHRPVIAFADAGNGEIKGSARSIKGLHMRDLLELVNSRHPGLISKFGGHAMAAGLT 433

Query: 448 VERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNP 507
           ++   F      +       +     T     DG L  + + + +  +L +AGP+G    
Sbjct: 434 LKSGGFATFAKAYDDAVREQLKPEQLTGELWSDGELTPTELTLEIAQLLRNAGPWGQSFE 493

Query: 508 NPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET-LQAIAFRVYGTPLGEFLMQSRGKRMH 566
            P+F     K+   R+V   HL++  E+Q     L AIAF V      +  +Q       
Sbjct: 494 EPLFDGY-FKIIQQRIVGDRHLKLVLETQCGTVMLDAIAFNVALHTWPDATIQHA----R 548

Query: 567 VTGHLCVNYWRGSKRCQLRVLDASP 591
           +   L VN +RG+   QL V    P
Sbjct: 549 IVYKLDVNEYRGNFTLQLMVEQIEP 573


>gi|261405419|ref|YP_003241660.1| single-stranded-DNA-specific exonuclease RecJ [Paenibacillus sp.
           Y412MC10]
 gi|261281882|gb|ACX63853.1| single-stranded-DNA-specific exonuclease RecJ [Paenibacillus sp.
           Y412MC10]
          Length = 800

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 168/581 (28%), Positives = 291/581 (50%), Gaps = 26/581 (4%)

Query: 14  SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDP 72
           S + W        I     +    ++P IVA ++ +R + S +  ++FL  +   L  DP
Sbjct: 4   SKYEWRIREAASTI--TERLAHDLSLPPIVASLMASRGIQSAEDGREFLYGTF-ELTHDP 60

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
            ++    +A  RI +A+ + E I+I+GDYD DG +S +LM+  + +   + ++YIP R  
Sbjct: 61  YLMQGMREAVPRIRKALEDREHILIYGDYDADGVSSTSLMIHLMRYLGASYDIYIPHRSN 120

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG +   ++    +G  L+ITVD G ++ + + YA + GIDVIV DHH+       AY
Sbjct: 121 EGYGLHNHALDWAHQQGVSLVITVDTGISAVEQIAYANSLGIDVIVTDHHEPPEVLPEAY 180

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           AL+NP           L   GV + +   +           +       L +V++ T+ D
Sbjct: 181 ALINPKIPTCPYPFKGLAGVGVAYKLAQAL-----------VGDPPEEWLQIVSIGTIAD 229

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRI 311
           ++PL G NR  V  G+   RR    G+++L+E   I    +TA N+ + + P INA GR+
Sbjct: 230 LMPLTGENRVLVKHGIESMRRTRYEGIRSLLEVSGIHVEQVTAVNVAFSMAPRINASGRL 289

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI 371
             +     LL ++  +E E LA +LD LN++R+ +   ++++A   V  +    +   VI
Sbjct: 290 DHAGRAVTLLTTEHREEAERLAWELDGLNKDRQQVVENIVQEALGMVQNRWRGQEIPPVI 349

Query: 372 VVEGDRWHPGIVGLLAARLKEKFGRPSFAIS-FEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           V+ G+ W+ G+VG++A+++ E+F RP   +    E G   GS RSI GFDI   +     
Sbjct: 350 VLAGEGWNVGVVGIVASKILERFYRPVVILGIDPETGNCKGSARSIPGFDIYAALLSC-- 407

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNI 490
           + ++   GGH  AAG+++ R           ++A + + A     V + D   + S V++
Sbjct: 408 KDVMDHFGGHPSAAGMSLHRDRLAAFEQGLHRYAEDALEAEHLIAVCEADLEASLSEVSV 467

Query: 491 ALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL--AHLQMTFESQDSETLQAIAFRV 548
            +++ +E  GP+G  N  P   F +  ++ +R +     HL++  + +  E + AI+F  
Sbjct: 468 PILEQMEQLGPFGMANAVPKIVFRDVVIKDVRKIGKEGKHLKLRLQQK-REVIDAISFGW 526

Query: 549 YGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
               L + L    G  + V G L VN W GS++ QL + D 
Sbjct: 527 G--HLADIL--PVGSVVDVLGELSVNEWNGSRKVQLMIQDI 563


>gi|303236583|ref|ZP_07323165.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella disiens
           FB035-09AN]
 gi|302483236|gb|EFL46249.1| single-stranded-DNA-specific exonuclease RecJ [Prevotella disiens
           FB035-09AN]
          Length = 574

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 167/586 (28%), Positives = 276/586 (47%), Gaps = 22/586 (3%)

Query: 17  RWVS-LLGQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLI 74
           +W       E  N A  + +K  I  I+A +L+ R +  +  AK F  P +  L+ +P +
Sbjct: 4   KWNYTPPTPEQTNAAKELGEKLGISPILATLLLRRGIKTESAAKRFFRPQLSDLI-NPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+  A+   E+IM++GDYDVDG  +VAL+  FL     N   YIPDR  +G
Sbjct: 63  MQDMDVAVDRLNDAMGRKERIMVYGDYDVDGCTAVALVFNFLRQFYSNIEYYIPDRYDEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++   + G +LII +DCG  + + + YA  QGID I+ DHH   +   PA A+
Sbjct: 123 YGVSKKSIDFAKDNGVKLIIILDCGIKAVEEISYAKEQGIDFIICDHHVPDNNLPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +NP R DD      LC  GV F  +         +N       L+ LLD  A++   D+V
Sbjct: 183 LNPKRSDDSYPFKDLCGCGVGFKFMQAFA-----NNNNIAFSRLIPLLDFCAVSIAADLV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL    +  + GL+A++E        ++  ++ + IGP INA GR+  
Sbjct: 238 PVVGENRILAFHGLKQLNQNPSVGLQAIVEICGLTGRELSMSDIIFKIGPRINASGRMEN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL+  D     + A  +D  N  R+ ++  M E+A  +++ + +  +  + IV+
Sbjct: 298 GKESVDLLVERDLATALLEARNIDKYNDKRKDVDRQMTEEA-NQIVERLESQKHQNSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + W  G++G++A+RL E + RP+  I+  ED    GS RS  GFD+   +       +
Sbjct: 357 YDEHWKKGVIGIVASRLTEIYYRPTIVIT-REDDLATGSARSAVGFDLYSAIENC--SDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L+  GGH  AAGLT++  N     D FQK+    +          ID V++   +   L 
Sbjct: 414 LLNFGGHTYAAGLTLKWENVKEFRDRFQKYVDEHIEPHQKEATLDIDTVIDFKDITKKLH 473

Query: 494 DMLESAGPYGAGNPNPVFAFPN-HKLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  P+F   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NDLKRFAPFGPKNEKPLFCTKDVFDFGTSKVVGRAQEHIKLELVDSKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
            +           +   +   +  N ++     QL++    P E  
Sbjct: 534 ES----ARYIKSKRSFDIVYTIEDNVFKKGSS-QLQIEGIRPSESE 574


>gi|225012395|ref|ZP_03702831.1| single-stranded-DNA-specific exonuclease RecJ [Flavobacteria
           bacterium MS024-2A]
 gi|225003372|gb|EEG41346.1| single-stranded-DNA-specific exonuclease RecJ [Flavobacteria
           bacterium MS024-2A]
          Length = 565

 Score =  412 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 163/577 (28%), Positives = 273/577 (47%), Gaps = 22/577 (3%)

Query: 18  WVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSI-DYAKDFLNPSIRLLMPDPLILT 76
           W +       N    ++    +  ++A++L  R ++  + AK+F  P    L  DP ++ 
Sbjct: 3   WYTPPSAPE-NTVEHLSGALGVSPVIAQLLAQRGITSYEEAKNFFRPDWSQLH-DPYLMQ 60

Query: 77  DCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYG 136
           D   A  RI+QAI   E++M++GDYDVDG  SVAL+  FL     N   Y+PDR  +GYG
Sbjct: 61  DMTVAVNRIIQAIERHERVMVYGDYDVDGTTSVALVYSFLKDKIENLTPYVPDRYKEGYG 120

Query: 137 PNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVN 196
            + + ++    EG  LII +DCG  +   + YA + G+D ++ DHH        A A+++
Sbjct: 121 ISIAGIDHAKEEGISLIIALDCGIKANAQIDYANDLGVDFVICDHHLPSENLPKAIAVLD 180

Query: 197 PNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPL 256
           P R D       LC  G+ F ++  + + +          +L   LDLVA A   D+VP+
Sbjct: 181 PKRGDCAYPFKELCGCGIGFKLIQAVQQRMEL-----PQKELFCYLDLVATAIAADIVPI 235

Query: 257 IGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNL 316
           IG NR     G+    +    GL+  ++ +   +P++  +L ++I P INA GR+     
Sbjct: 236 IGENRILTFLGIEQLNQSPRVGLQFFLKSL--KNPVSVTDLVFVIAPRINAAGRMDHGLN 293

Query: 317 GSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGD 376
              LL + D +    +A  ++  N  RR  +  + ++A  +++   ++ Q++   VV   
Sbjct: 294 AVELLAASDVEVALPIARSIEFYNSERRATDERITKEALQQII--LNEQQESFSTVVFHS 351

Query: 377 RWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVK 436
            WH G++G++A+RL E + RP+  ++  E G   GS RS+ GFD+ K +    E   +++
Sbjct: 352 SWHKGVIGIVASRLIETYYRPTVVLTESE-GVLSGSVRSVRGFDVYKALESCAEF--MIQ 408

Query: 437 GGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDML 496
            GGH  AAGLT++          F+ +  + +     TP    D VL  + ++  L+ +L
Sbjct: 409 FGGHKYAAGLTLKPEQLEGFKKGFEAYVRSTILKEQQTPSLIYDAVLKLNELSPKLLRIL 468

Query: 497 ESAGPYGAGNPNPVFAFPNHKLQ-SIRVVNLA--HLQMTFESQDSETLQAIAFRVYGTPL 553
              GP+G  N  PVF   + K     R+V     HL++         +Q I F +     
Sbjct: 469 NQMGPFGPKNMRPVFVTHHCKDTGGSRLVGKDQTHLKLEIRDSSGIQIQGIGFGMG---- 524

Query: 554 GEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
              +         V   L  N + G    QL+V D  
Sbjct: 525 ANLITIKNQLPFSVLYTLEENEYNGIVSLQLKVKDLK 561


>gi|126660250|ref|ZP_01731366.1| single-stranded-DNA-specific exonuclease [Cyanothece sp. CCY0110]
 gi|126618489|gb|EAZ89242.1| single-stranded-DNA-specific exonuclease [Cyanothece sp. CCY0110]
          Length = 654

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 170/583 (29%), Positives = 290/583 (49%), Gaps = 20/583 (3%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPD 71
           +   RW          +   +  +  +  ++A+V++NR +     A+ ++NP++  L PD
Sbjct: 3   LPDQRWYIASPNPD--KVKMLVAETGLSPLLAQVILNRGIDSPNLAQVYINPNVETL-PD 59

Query: 72  P-LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
           P     D   + + + +AI   EKI I GDYD DG  S +L++R L+H   +A   IP R
Sbjct: 60  PLDEFPDLFPSIKLLKEAINIGEKIAICGDYDADGMTSTSLLLRALTHLGGDAYYEIPSR 119

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           + DGYG N  ++EKF  EG  +I+TVD G  +Y+ ++ A   G+ VI+ DHH +  +  P
Sbjct: 120 MKDGYGINERIVEKFAEEGVGVILTVDNGIAAYEPIKRAVELGLTVIITDHHDLPEKLPP 179

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
           A A++NP  L   S    L   GV +++ + + +   +         + SLL+L  L T+
Sbjct: 180 ADAILNPKLLSIHSPYRGLAGVGVAYILAITLAKQFNKTE-----EIIDSLLELFTLGTI 234

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN---ISSPITAENLGYMIGPSINA 307
            D+ PL+G+NR ++ KGL         G++AL++          +  +++G+ +GP INA
Sbjct: 235 ADLAPLVGVNRRWLKKGLKQLPNSQLAGIQALMQVGGVSEEQKQLKPDDIGFKLGPRINA 294

Query: 308 GGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ 367
            GRIG+      LL +DD       AM+ + +N  R+ +   + ++A   + T   + +Q
Sbjct: 295 VGRIGDPQTAIELLTTDDPGIALERAMQCEQINGKRKGLCEEIEKEAIHLIKTTPINYKQ 354

Query: 368 ASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF 427
             V+VV   +WH G++G++A+RL E++G P F  ++EED      G +    +     + 
Sbjct: 355 DRVLVVIHHKWHHGVIGIVASRLVERYGVPVFIGTYEEDDPSKIRGSARGIEEFNIFEAL 414

Query: 428 AVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASA 487
              + +L K GGH  A G  ++  N     +   KFAH ++      P+ KIDG  + + 
Sbjct: 415 VYCDDLLGKYGGHKAAGGFGLKSENLIAFKERLSKFAHQLLEPHHIKPLVKIDGEADFNQ 474

Query: 488 VNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFR 547
           +N  L   ++S  P+G  N  PVF  PN K+   R V   HL++     D + ++AIA+R
Sbjct: 475 LNAHLYQHIDSLQPWGIQNAFPVFWTPNVKILEQRTVGKNHLKLVLGQDDGQEMKAIAWR 534

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
                          KR+ +   L  N+W G+   +L ++   
Sbjct: 535 FGSYF-------PLPKRLDIAYKLTENHWNGNVNIELEIIGVR 570


>gi|238763214|ref|ZP_04624179.1| Single-stranded-DNA-specific exonuclease recJ [Yersinia
           kristensenii ATCC 33638]
 gi|238698487|gb|EEP91239.1| Single-stranded-DNA-specific exonuclease recJ [Yersinia
           kristensenii ATCC 33638]
          Length = 577

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 181/564 (32%), Positives = 276/564 (48%), Gaps = 20/564 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           +  ++ R+  +R V        L   ++ L+     L   D     + QA+ +  +I+I 
Sbjct: 22  LHPLLRRLYASRGVKSAEE---LERGVKGLLA-WQQLDGIDAGVTLLQQALADRRRIVIV 77

Query: 99  GDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L     N  +  +P+R  DGYG +P ++E+    GA+LI+TVD
Sbjct: 78  GDFDADGATSTALAVLALRSMGGNNVDYLVPNRFDDGYGLSPEVVEQVAARGAELIVTVD 137

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S+  ++ A   GI V+V DHH        A A++NPN          L   GV F 
Sbjct: 138 NGISSHAGVELAHAMGIQVLVTDHHLPGETLPAAEAIINPNLTGCDFLSKSLAGVGVTFY 197

Query: 218 VLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR 273
           +++ +   LR             +L  LLDLVAL TV DVVPL   NR  V +GL   R 
Sbjct: 198 LMLALRARLRDSGWFEQRALAVPNLAELLDLVALGTVADVVPLDANNRILVHQGLSRIRA 257

Query: 274 -QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
            +  PG++AL+E  N     + A +LG+ +GP +NA GR+ + ++G  LL+SDD  +   
Sbjct: 258 GKCRPGIRALLEVANRDARQLAANDLGFSLGPRLNAAGRLDDMSIGVALLLSDDIAQARA 317

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLT-QCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
           LA+ LD LNQ RR +E  M  +A       +    +    I +    WH G+VG+LA+R+
Sbjct: 318 LAIDLDALNQTRREIEQGMQVEALQLCDQLERTSTELPYGIAMYHPEWHQGVVGILASRI 377

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV--EEGILVKGGGHAMAAGLTV 448
           KE+F RP  A +   DG   GSGRS+ G  +   +        G+++K GGHAMAAGL++
Sbjct: 378 KERFHRPVIAFAPAGDGLLKGSGRSVAGLHMRDALERLDTLNPGLMLKFGGHAMAAGLSL 437

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
           E+  F      F       + A     V   DG L  + +++   ++L   GP+G   P 
Sbjct: 438 EQDKFDEFRQRFADLVGEWMDASQLEGVIWSDGELKGNELSLETAELLRDGGPWGQSFPE 497

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P F     ++   R+V   HL++  E       L AIAF +  T   +    S  + + +
Sbjct: 498 PTFDGK-FRILQQRLVGERHLKLMIEPLNGGPLLDAIAFNIDTTLWPD----SSVREVKL 552

Query: 568 TGHLCVNYWRGSKRCQLRVLDASP 591
              L +N +RG++  QL V    P
Sbjct: 553 AYKLDINEYRGNRSVQLLVQHLWP 576


>gi|302185539|ref|ZP_07262212.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           pv. syringae 642]
          Length = 571

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 181/564 (32%), Positives = 286/564 (50%), Gaps = 20/564 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V+ +     L+ S+  L+P    L   D A   +V A+   ++++I
Sbjct: 17  DLPPLLTRLYAARGVACE---AELDKSLARLIPY-QQLKGIDAAVDLLVTALREGQRMLI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQREPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S D +  A   G+ V+V DHH    E   A A+VNPN+         L   GV+F
Sbjct: 133 DNGISSVDGVAAAKAAGLQVLVTDHHLPGHELPAADAIVNPNQPGCTFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKV----PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            VL+ +   LR+            +L  LLDLVAL +V DVVPL   NR  V +GLM  R
Sbjct: 193 YVLMALRARLRETGWFESNQRAQPNLGELLDLVALGSVADVVPLDANNRILVHQGLMRIR 252

Query: 273 R-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PGL+A++E        IT+ +LG+++GP +NA GR+ + +LG   L+ DD     
Sbjct: 253 AGRARPGLRAILEVARREPARITSTDLGFILGPRLNAAGRLDDMSLGIECLLCDDPTLAR 312

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A++LD LNQ+R+ +E  M  +A A++     +     + + + + WH G++G+LA+RL
Sbjct: 313 EMAVQLDELNQDRKSIEQGMQREALAQLKDLPLESMPFGLCLFDAE-WHQGVIGILASRL 371

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTV 448
           KE++ RP+ A +   +G   GS RS+ GF I   +    A    ++ K GGHAMAAGL++
Sbjct: 372 KERYHRPTIAFASAGEGVLKGSARSVPGFHIRDALDAVAASHPHLISKFGGHAMAAGLSL 431

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
              NF    D F +     +     T     DG L     ++ L   L +AGP+G   P 
Sbjct: 432 PEENFPAFADAFDQEVRRQLDEQDLTGRLLSDGSLAVEEFHLELARALRNAGPWGQHFPE 491

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P+F     +L   RVV   HL+M  +++  S  L  IAF V      +       + + +
Sbjct: 492 PLFHG-VFQLVEQRVVGERHLKMVLKTECGSVKLDGIAFGVDR----DIWPNPNIRWVEL 546

Query: 568 TGHLCVNYWRGSKRCQLRVLDASP 591
              L +N +RG++  QL V+  +P
Sbjct: 547 AYKLDLNEFRGNETVQLMVVHIAP 570


>gi|213969070|ref|ZP_03397209.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           pv. tomato T1]
 gi|301384035|ref|ZP_07232453.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           pv. tomato Max13]
 gi|302058741|ref|ZP_07250282.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           pv. tomato K40]
 gi|213926068|gb|EEB59624.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           pv. tomato T1]
          Length = 569

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/562 (31%), Positives = 282/562 (50%), Gaps = 18/562 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V+ +     L+ S+  L+P    L   D A   +V A+   ++++I
Sbjct: 17  DLPPLLTRLYAARGVACE---AELDKSLARLIPY-QQLKGIDAAVDLLVTALREGQRMLI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQREPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + +  A   G+ V+V DHH    E   A A+VNPN+         L   GV+F
Sbjct: 133 DNGISSVEGVAAAKAAGLQVLVTDHHLPGHELPAADAIVNPNQPGCTFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKV--PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR- 273
            VL+ +   LR           +L  LLDLVAL +V DVVPL   NR  V +GLM  R  
Sbjct: 193 YVLMALRARLRDTGWFDQRAQPNLGELLDLVALGSVADVVPLDANNRILVHQGLMRIRAG 252

Query: 274 QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEML 332
           +  PGL+A++E        IT+ +LG+++GP +NA GR+ + +LG   L+ DD      +
Sbjct: 253 RARPGLRAILEVARREPARITSTDLGFILGPRLNAAGRLDDMSLGIECLLCDDPTRAREM 312

Query: 333 AMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKE 392
           A++LD LNQ+R+ +E  M  +A A++  +         + +    WH G++G+LA+RLKE
Sbjct: 313 AVQLDELNQDRKSIEQGMQREALAQL-KELPLESMPFGLCLFDAEWHQGVIGILASRLKE 371

Query: 393 KFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTVER 450
           ++ RP+ A +   +G   GS RS+ GF I   +    A    ++ K GGHAMAAGL++  
Sbjct: 372 RYHRPTIAFASAGEGVLKGSARSVPGFHIRDALDAVAAGHPHLISKFGGHAMAAGLSLPE 431

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
            NF    + F       +     T     DG L     ++ L   L +AGP+G   P P+
Sbjct: 432 DNFPAFAEAFDLEVRRQLDEQDLTGRLLSDGSLAVEEFHLELARALRNAGPWGQHFPEPL 491

Query: 511 FAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F     +L   RVV   HL+M  +++  S  L  IAF V      +       + + +  
Sbjct: 492 FHG-VFQLVEQRVVGERHLKMVLKTECGSVRLDGIAFSVDR----DIWPNPNIRWVELAY 546

Query: 570 HLCVNYWRGSKRCQLRVLDASP 591
            L +N +RG++  QL V+  +P
Sbjct: 547 KLDLNEFRGNETVQLMVVHIAP 568


>gi|167640714|ref|ZP_02398974.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0193]
 gi|177653975|ref|ZP_02936016.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0174]
 gi|254736511|ref|ZP_05194217.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. Western North America USA6153]
 gi|167511286|gb|EDR86672.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0193]
 gi|172081030|gb|EDT66108.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus anthracis
           str. A0174]
          Length = 779

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/589 (30%), Positives = 282/589 (47%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW          R   +  K  +  +V  + + R +  +    DFLN        DP +L
Sbjct: 7   RWKEKEYN--GERVSELASKLQLSPLVVSLFLGRGLDTEDKILDFLNTE-NQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L     +  +YIP+R  +GY
Sbjct: 64  EGMDRTVERVNKAIQNGEQILIFGDYDADGVSSTTVLYLALQELGADVEIYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLDGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVKRGLKHMRMTKNIGLKALFKVANVSQSEITEESIGFSIAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
            L   LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TLAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +  +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLCIDPVKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+      P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQAEEILTEEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G   +N W   K+ QL V D +      F  +
Sbjct: 527 --AYAKEISPVAKVSVIGEASINEWNNFKKPQLMVKDIAVEAWQLFDWR 573


>gi|153807332|ref|ZP_01960000.1| hypothetical protein BACCAC_01610 [Bacteroides caccae ATCC 43185]
 gi|149129694|gb|EDM20906.1| hypothetical protein BACCAC_01610 [Bacteroides caccae ATCC 43185]
          Length = 572

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 163/584 (27%), Positives = 272/584 (46%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLI 74
           +W       E    +  + Q+  I  I+ ++LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYQPITPEQAETSQTLAQELGISPILGQLLVQRGITKAVDAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+ +A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MNDMDIAVERLNKAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNLDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGISKKGVDYAAETGVGLIIVLDCGIKAVEEITYAKEKGIDFIICDHHVPDDILPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  R D+     HL   GV F  +         +        L+ LLDLVA++   D+V
Sbjct: 183 LNAKRPDNTYPYTHLSGCGVGFKFMQAFAISNGIE-----FHHLIPLLDLVAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + G+KA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAFHGLKQLNSNPSVGMKAIIDVCGLSEREITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL   D       A +++  N+ R+ ++ +M E+A   ++   + + +   IV+
Sbjct: 298 GKEAVDLLTEKDFSVALEKAGQINQYNETRKDLDKSMTEEANN-IVANLEGLAERRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K +       +
Sbjct: 357 YNEEWHKGVIGIVASRLTEVYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEHC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+ F    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVEAFTKRFEDFVSQHILPEQTSAVIDIDAEIDFRDITPRFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
             L+   P+G  N  P+F   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 SDLKKFNPFGPDNMKPIFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 534 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 572


>gi|117621046|ref|YP_857761.1| single-stranded-DNA-specific exonuclease RecJ [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117562453|gb|ABK39401.1| single-stranded-DNA-specific exonuclease RecJ [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 576

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 180/564 (31%), Positives = 280/564 (49%), Gaps = 19/564 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           +  ++ ++  +R V        L  S   L+P P  L    +A   + +A+   ++I+I 
Sbjct: 20  LHPLLRQIFASRGVEDPAL---LERSASQLLP-PQRLFGMAQAVPLLAEALTAQKRILIV 75

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L      + +  +P+R   GYG  P ++E  +  GA+ +ITVD
Sbjct: 76  GDFDCDGATSSALCVLALRAMGGRHIDFLVPNRFEFGYGLTPEIVELAVARGAEFLITVD 135

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S   +  A   G+ V+V DHH    E   A A+VNPN+         L   GV F 
Sbjct: 136 NGISSIAGVAAAKAAGMQVLVTDHHLPGQELPDADAIVNPNQHGCDFPSKSLAGVGVAFY 195

Query: 218 VLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR 273
           ++  +   LRQ            ++   LDLVAL TV DVV L G NR  V +GL   R 
Sbjct: 196 LMAALNTQLRQSGWYERQGLRAPNVADYLDLVALGTVADVVALDGNNRILVHQGLQRIRA 255

Query: 274 -QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEM 331
            +  PG++AL++        + A +LG+ +GP +NA GR+ + +LG   L+SDD      
Sbjct: 256 GRCRPGIQALVDVSGRDGRRLCAADLGFALGPRLNAVGRLDDMSLGVACLLSDDLNLARQ 315

Query: 332 LAMKLDVLNQNRRLMESAMLEQAEAKVLT-QCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
           LA ++D LNQ R+ +E  M ++A A +   +  D +  S IV+  + WH G+VGL+A+++
Sbjct: 316 LASEMDSLNQERKEIEQGMQQEALATLEQIRFRDGEVPSGIVLHRNEWHQGVVGLVASKV 375

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGLTV 448
           KEK+ RP  A +   + +  GSGRSI G  +   +        G++ K GGHAMAAGLT+
Sbjct: 376 KEKYYRPVIAFAESSETELKGSGRSIPGVHLRDALELLDTRHPGLMGKFGGHAMAAGLTL 435

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
            + N       F+     +V   + T V   DG L    +++ L +++ ++GP+G   P 
Sbjct: 436 PKANIEAFGRAFEAVIGELVTPELLTGVLLTDGELLPDELSLELAELIRASGPWGQAFPE 495

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVT 568
           P+F      L   R+V   HL+M   +     + AIAF V      +    +  KR+ + 
Sbjct: 496 PLFDGEFV-LVQQRLVGEKHLKMMLTTDSGHAVDAIAFGVDLQRWPD----ASVKRVRLV 550

Query: 569 GHLCVNYWRGSKRCQLRVLDASPV 592
             L VN WRG++  QL V      
Sbjct: 551 YRLDVNEWRGNRNVQLLVEHLEAA 574


>gi|300718201|ref|YP_003743004.1| Single-stranded-DNA-specific exonuclease [Erwinia billingiae Eb661]
 gi|299064037|emb|CAX61157.1| Single-stranded-DNA-specific exonuclease [Erwinia billingiae Eb661]
          Length = 572

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 193/561 (34%), Positives = 287/561 (51%), Gaps = 17/561 (3%)

Query: 39  IPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIF 98
           +  ++ R+ ++R V +  A+  L    + L P    L+  ++AA  + +A+ ++  IMI 
Sbjct: 22  LHPLLRRLYLHRGV-LQAAE--LERGAKNLHP-FHSLSGIERAAEILQKALADNLCIMIV 77

Query: 99  GDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVD 157
           GD+D DGA S AL +  L      N    +P+R  DGYG +P ++E+    GAQLI+TVD
Sbjct: 78  GDFDADGATSTALTVLALRSMGGRNIKYLVPNRFDDGYGLSPEVVEQAAARGAQLIVTVD 137

Query: 158 CGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFL 217
            G +S+  +  A  +GI V++ DHH        A A+VNPN  D       L   GV F 
Sbjct: 138 NGISSHAGVDLAHEKGISVVITDHHLPGETLPAAEAIVNPNLEDCAFPSRSLAGVGVAFY 197

Query: 218 VLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR-QGN 276
           +++ +   LR    V +  +L  LLDLVAL TV DVVPL   NR  V +GL   R  +  
Sbjct: 198 LMLALRARLRDSG-VEVLPNLAELLDLVALGTVADVVPLDANNRILVWQGLSRIRAGKCR 256

Query: 277 PGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMK 335
            G+KAL+E  N     + A +LG+ +GP +NA GR+ + ++G  LL+S+D  +  MLA +
Sbjct: 257 AGIKALLEIANRDPRQLAASDLGFALGPRLNAAGRLDDMSVGVALLLSEDIAQARMLASE 316

Query: 336 LDVLNQNRRLMESAMLEQAEAKVLT-QCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKF 394
           LD LNQ R+ +E  M  +A A     +  D      I +    WH G+VG+LA+RLKE+F
Sbjct: 317 LDALNQTRKEIEQGMQTEALALCDALESKDEALPLGIAMYHPEWHQGVVGILASRLKERF 376

Query: 395 GRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV--EEGILVKGGGHAMAAGLTVERVN 452
            RP  A +   DG   GSGRSI G  +   +        G+++K GGHAMAAGL++E  N
Sbjct: 377 HRPVIAFAPSGDGTLKGSGRSIAGLHMRDALERLDTLHPGLIIKFGGHAMAAGLSLEEAN 436

Query: 453 FGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFA 512
           F R    F       + A     V   DG L A  + +   ++L  AGP+G   P P F 
Sbjct: 437 FDRFRQHFGDLVGEWLDAEALQGVVWSDGELMAQELTLTTAELLREAGPWGQAFPEPQFD 496

Query: 513 FPNHKLQSIRVVNLAHLQMTFES-QDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHL 571
               KL   R+V   HL++  E       L  IAF +  T   +       +++ +   L
Sbjct: 497 GK-FKLIQQRLVGERHLKVMIEPLGGGPLLDGIAFNIDTTQWPD----PSVRQVELAYKL 551

Query: 572 CVNYWRGSKRCQLRVLDASPV 592
            +N +RG++  QL +    P+
Sbjct: 552 DINEFRGNRSVQLIIDHLWPL 572


>gi|229169152|ref|ZP_04296867.1| Exonuclease RecJ [Bacillus cereus AH621]
 gi|228614380|gb|EEK71490.1| Exonuclease RecJ [Bacillus cereus AH621]
          Length = 773

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 179/589 (30%), Positives = 283/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + + R ++ +    DFLN +      DP +L
Sbjct: 7   RWKEKEYNE--ELVSELANKLQLSPLVTSLFLGRGLNTEDKIVDFLN-TADQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L         YIP+R  +GY
Sbjct: 64  EGMDRTVERVKKAIENGEQILIFGDYDADGVSSTTVLYLALKELGAEVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ + P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFALAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLSIDPHKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+ A    P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLNMNDVDELRRRLNEQADVILTAEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  +  L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDADLESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFGTY 528

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G + +N W   K+ QL V D +      F  +
Sbjct: 529 ----AKEISPVAKVSVVGEVSINEWNNFKKPQLMVQDIAVEAWQLFDWR 573


>gi|308270359|emb|CBX26971.1| hypothetical protein N47_A10000 [uncultured Desulfobacterium sp.]
          Length = 570

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 185/580 (31%), Positives = 286/580 (49%), Gaps = 20/580 (3%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNV-SIDYAKDFLNPSIRLLMPDPLIL 75
           +W     Q        I++      ++A +LVNR + S + A  FLN SI  L   P  +
Sbjct: 4   KWHI--HQPDKKLVDKISKAIKCSPVIASILVNRGIFSAEEAHAFLNISIDNLR-SPFSI 60

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
            D + AA RI  AI   EKI+IFGDYD DG  S AL+M F  H   + + YIPDRI +GY
Sbjct: 61  KDMEIAANRIYDAILRREKILIFGDYDADGVTSTALLMEFFRHTKADVSYYIPDRIKEGY 120

Query: 136 GPNPSLM-EKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           G     + E  I     LIITVDCGS+S +A+  A +  ID+I+ DHH +  +   A A+
Sbjct: 121 GLQEKHIAEIAIPGNIDLIITVDCGSSSNEAVAAANDADIDIIITDHHILPEKLPEALAI 180

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN--FDLLSLLDLVALATVCD 252
           ++P R D  SG  HL   GV F +++ + + LR  +        +L +L DL+AL TV D
Sbjct: 181 ISPKRPDCNSGLSHLAGVGVAFYLVIYLRKYLRDMHFWDRYPEPNLKNLCDLIALGTVAD 240

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIG 312
           +VPL+  NR +   GL +       G+ AL++  N    I +E++ + + P INA GRI 
Sbjct: 241 MVPLLEENRVFTRIGLDLINSGSRIGISALLKAGNYRDTIDSEDIAFRLAPRINAMGRID 300

Query: 313 ESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIV 372
            +     LL++ +    + +A +++ +N  R+ +E  + ++    +     DI  +  IV
Sbjct: 301 NAKEAVELLLTGNPYTADNIARQMNQMNTKRQTIEKKVFDEIIEYI-QNNPDILLSKSIV 359

Query: 373 VEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEG 432
           +    WH GI+G++A+RL EKF RP      +E     GSGRS   F++ + ++      
Sbjct: 360 LSHHGWHEGILGIVASRLVEKFHRPVVLFVQKET-IAKGSGRSTPYFNLYEGLAAC--SD 416

Query: 433 ILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIAL 492
           IL   GGH+MAAG+ ++  N       F+     +       P   +D  L    ++   
Sbjct: 417 ILEAFGGHSMAAGVKIKIDNLSLFKQEFENAVLKMSQPEDLFPDIYVDHELIFDDISTGF 476

Query: 493 IDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET---LQAIAFRVY 549
           +D LES  P+GAGNP P+F   N  + S  +V   H +M   S   +      AI F + 
Sbjct: 477 LDELESLKPFGAGNPEPIFIARNINVISSDIVGENHRRMVLSSSSGKKDNYYNAIHFNID 536

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDA 589
            +   + + +       +   L  N W G+K  QL + + 
Sbjct: 537 KSLPEKTIYEQ------IAFRLRWNRWNGNKSIQLVIENI 570


>gi|29349347|ref|NP_812850.1| single-stranded-DNA-specific exonuclease recJ [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|298384880|ref|ZP_06994439.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           1_1_14]
 gi|29341255|gb|AAO79044.1| single-stranded-DNA-specific exonuclease recJ [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|298262024|gb|EFI04889.1| single-stranded-DNA-specific exonuclease RecJ [Bacteroides sp.
           1_1_14]
          Length = 572

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 164/584 (28%), Positives = 275/584 (47%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVSID-YAKDFLNPSIRLLMPDPLI 74
           +W       E    +  + Q+  I  I+ ++LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYQPITPEQAETSQTLAQELGISPILGQLLVQRGITKAGDAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+ +A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDIAVERLNKAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNIDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGISKKGVDYASETGVGLIIVLDCGIKAVEEITYAKEKGIDFIICDHHVPDDILPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +          N       L+ LLDLVA++   D+V
Sbjct: 183 LNAKRLDNTYPYTHLSGCGVGFKFMQAFA-----INNGIEFHHLIPLLDLVAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + G+KA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAYHGLKQLNSNPSVGMKAIIDVCGLSEKEITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL   D       A +++  N+ R+ ++ +M E+A   ++   + + +   IV+
Sbjct: 298 GKEAVDLLTEKDFSAALEKAGQINQYNETRKDLDKSMTEEANN-IVANLEGLSERRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K +       +
Sbjct: 357 YNEEWHKGVIGIVASRLTEVYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEHC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+++    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVEAFTRRFEEYVSQHILPEQTSAVINIDAEIDFRDITSKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  P+F   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NDLKKFNPFGPDNIKPIFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 534 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 572


>gi|107103239|ref|ZP_01367157.1| hypothetical protein PaerPA_01004308 [Pseudomonas aeruginosa PACS2]
 gi|116051722|ref|YP_789439.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|296387767|ref|ZP_06877242.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa PAb1]
 gi|313109131|ref|ZP_07795102.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa 39016]
 gi|115586943|gb|ABJ12958.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|310881604|gb|EFQ40198.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa 39016]
          Length = 571

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 175/564 (31%), Positives = 279/564 (49%), Gaps = 20/564 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++AR+   R V        L+  +  L+P    L   ++    +V A+   ++I+I
Sbjct: 17  DLPPLLARLYAARGVRCAEE---LDKGLARLIP-FQRLKGIEEGVALLVDALEGGQRILI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA + ++ +  L        +  +P+R   GYG  P ++   + +   L++TV
Sbjct: 73  VGDFDADGATASSVGVLALRMLGAAWVDYLVPNRFEYGYGLTPEIVGVALEKRPDLLVTV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S D +Q A   G+ V+V DHH    E   A A++NPN+         +   GV+F
Sbjct: 133 DNGISSVDGVQAAKAAGLKVLVTDHHLPGPELPAADAIINPNQPGCEFPSKAMAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            V++ +   LR+ +          +L  LLDLVAL +V DVVPL   NR  V +GL   R
Sbjct: 193 YVMLALRARLRELDWFARRGLKEPNLAELLDLVALGSVADVVPLDANNRILVHQGLARIR 252

Query: 273 R-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PGL+AL+E        IT+ +LG+++GP +NA GR+ + +LG   L+ DD     
Sbjct: 253 AGRARPGLRALLEVAGRPPVRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCDDEALAR 312

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A++LD LNQ+R+ +E  M  +A A++  +    Q    + +    WH G++G+LA+RL
Sbjct: 313 DMAVQLDQLNQDRKAIEQGMQREALAQL-KELSLEQLPFGLCLFDADWHQGVIGILASRL 371

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF--AVEEGILVKGGGHAMAAGLTV 448
           KE++ RP+ A +   DG   GS RSI GF I   +    A   G++ K GGHAMAAGL++
Sbjct: 372 KERYHRPTIAFADAGDGSLKGSARSIPGFHIRDALDAVAARHPGLISKFGGHAMAAGLSL 431

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
            + NFG     F       +           DG L+    ++ L   L  AGP+G   P 
Sbjct: 432 PQENFGAFSAAFDAEVRRQLAEEDLAGRLLSDGQLSIQEFHLELARALRQAGPWGQHFPE 491

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQDSE-TLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P+F     +L   R+V   HL++  +S+     L  IAF +              +   +
Sbjct: 492 PMFHG-VFQLVQQRIVGERHLKLVLKSECGSLQLDGIAFNIDREQWP----NPTVRWAEL 546

Query: 568 TGHLCVNYWRGSKRCQLRVLDASP 591
              L VN +RG +  QL ++  +P
Sbjct: 547 AYKLDVNEFRGQESVQLMIVHMAP 570


>gi|253570306|ref|ZP_04847715.1| single-stranded-DNA-specific exonuclease recJ [Bacteroides sp.
           1_1_6]
 gi|251840687|gb|EES68769.1| single-stranded-DNA-specific exonuclease recJ [Bacteroides sp.
           1_1_6]
          Length = 572

 Score =  412 bits (1059), Expect = e-113,   Method: Composition-based stats.
 Identities = 164/584 (28%), Positives = 276/584 (47%), Gaps = 22/584 (3%)

Query: 17  RWVSLL-GQEGINRALAITQKHAIPDIVARVLVNRNVS-IDYAKDFLNPSIRLLMPDPLI 74
           +W       E    +  + Q+  I  I+ ++LV R ++    AK F  P +  L  DP +
Sbjct: 4   KWNYQPITPEQAETSQTLAQELGISPILGQLLVQRGITKAADAKKFFRPQLPDLH-DPFL 62

Query: 75  LTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDG 134
           + D D A  R+ +A+   E+I+I+GDYDVDG  +VAL+ +F+     N + YIPDR  +G
Sbjct: 63  MKDMDIAVERLNKAMGKKERILIYGDYDVDGTTAVALVYKFIQQFYSNIDYYIPDRYNEG 122

Query: 135 YGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYAL 194
           YG +   ++     G  LII +DCG  + + + YA  +GID I+ DHH       PA A+
Sbjct: 123 YGISKKGVDYASETGVGLIIVLDCGIKAVEEITYAKEKGIDFIICDHHVPDDILPPAVAI 182

Query: 195 VNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVV 254
           +N  RLD+     HL   GV F  +          N       L+ LLDLVA++   D+V
Sbjct: 183 LNAKRLDNTYPYTHLSGCGVGFKFMQAFA-----INNGIEFHHLIPLLDLVAVSIASDIV 237

Query: 255 PLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRIGE 313
           P++G NR     GL       + G+KA+I+        IT  ++ + IGP INA GRI  
Sbjct: 238 PIMGENRILAYHGLKQLNSNPSVGMKAIIDVCGLSEKEITVSDIVFKIGPRINASGRIQN 297

Query: 314 SNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVV 373
                 LL   D       A +++  N+ R+ ++ +M E+A   ++   + + +   IV+
Sbjct: 298 GKEAVDLLTEKDFSAALEKAGQINQYNETRKDLDKSMTEEANN-IVANLEGLSERRSIVL 356

Query: 374 EGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGI 433
             + WH G++G++A+RL E + RP+  ++  +D    GS RS+ GFD+ K + +     +
Sbjct: 357 YNEEWHKGVIGIVASRLTEVYYRPAVVLTRTDD-MATGSARSVSGFDVYKAIEYC--RDL 413

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH  AAGL+++  N       F+++    +    T+ V  ID  ++   +     
Sbjct: 414 LENFGGHTYAAGLSMKVENVEAFTRRFEEYVSQHILPEQTSAVINIDAEIDFRDITSKFF 473

Query: 494 DMLESAGPYGAGNPNPVFAFPNH-KLQSIRVVN--LAHLQMTFES-QDSETLQAIAFRVY 549
           + L+   P+G  N  P+F   +     + +VV     H+++     + +  +  IAF   
Sbjct: 474 NDLKKFNPFGPDNIKPIFCTHHVYDYGTSKVVGRDQEHIKLELVDNKSNNVMNGIAFGQS 533

Query: 550 GTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                        +   +   +  N  +     QL++ D  P+E
Sbjct: 534 ----SHVRYIKTKRSFDICYTIEENTHK-RGEVQLQIEDIKPIE 572


>gi|15598920|ref|NP_252414.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa PAO1]
 gi|218889999|ref|YP_002438863.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa LESB58]
 gi|254236635|ref|ZP_04929958.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa C3719]
 gi|254242416|ref|ZP_04935738.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa 2192]
 gi|9949891|gb|AAG07112.1|AE004791_9 single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa PAO1]
 gi|126168566|gb|EAZ54077.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa C3719]
 gi|126195794|gb|EAZ59857.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa 2192]
 gi|218770222|emb|CAW25984.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas
           aeruginosa LESB58]
          Length = 571

 Score =  412 bits (1058), Expect = e-113,   Method: Composition-based stats.
 Identities = 175/564 (31%), Positives = 279/564 (49%), Gaps = 20/564 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++AR+   R V        L+  +  L+P    L   ++    +V A+   ++I+I
Sbjct: 17  DLPPLLARLYAARGVRCAEE---LDKGLARLIPY-QRLKGIEEGVALLVDALEGGQRILI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA + ++ +  L        +  +P+R   GYG  P ++   + +   L++TV
Sbjct: 73  VGDFDADGATASSVGVLALRMLGAAWVDYLVPNRFEYGYGLTPEIVGVALEKRPDLLVTV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S D +Q A   G+ V+V DHH    E   A A++NPN+         +   GV+F
Sbjct: 133 DNGISSVDGVQAAKAAGLKVLVTDHHLPGPELPAADAIINPNQPGCEFPSKAMAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            V++ +   LR+ +          +L  LLDLVAL +V DVVPL   NR  V +GL   R
Sbjct: 193 YVMLALRARLRELDWFARRGLKEPNLAELLDLVALGSVADVVPLDANNRILVHQGLARIR 252

Query: 273 R-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PGL+AL+E        IT+ +LG+++GP +NA GR+ + +LG   L+ DD     
Sbjct: 253 AGRARPGLRALLEVAGRPPVRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCDDEALAR 312

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A++LD LNQ+R+ +E  M  +A A++  +    Q    + +    WH G++G+LA+RL
Sbjct: 313 DMAVQLDQLNQDRKAIEQGMQREALAQL-KELSLEQLPFGLCLFDADWHQGVIGILASRL 371

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSF--AVEEGILVKGGGHAMAAGLTV 448
           KE++ RP+ A +   DG   GS RSI GF I   +    A   G++ K GGHAMAAGL++
Sbjct: 372 KERYHRPTIAFADAGDGSLKGSARSIPGFHIRDALDAVAARHPGLISKFGGHAMAAGLSL 431

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
            + NFG     F       +           DG L+    ++ L   L  AGP+G   P 
Sbjct: 432 PQENFGAFSAAFDAEVRRQLAEEDLAGRLLSDGQLSIQEFHLELARALRQAGPWGQHFPE 491

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQDSE-TLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P+F     +L   R+V   HL++  +S+     L  IAF +              +   +
Sbjct: 492 PMFHG-VFQLVQQRIVGERHLKLVLKSECGSLQLDGIAFNIDREQWP----NPTVRWAEL 546

Query: 568 TGHLCVNYWRGSKRCQLRVLDASP 591
              L VN +RG +  QL ++  +P
Sbjct: 547 AYKLDVNEFRGQESVQLMIVHMAP 570


>gi|119475793|ref|ZP_01616145.1| RecJ exonuclease [marine gamma proteobacterium HTCC2143]
 gi|119450420|gb|EAW31654.1| RecJ exonuclease [marine gamma proteobacterium HTCC2143]
          Length = 584

 Score =  412 bits (1058), Expect = e-113,   Method: Composition-based stats.
 Identities = 182/568 (32%), Positives = 277/568 (48%), Gaps = 22/568 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +  ++ R+  +R VS D         +  L+  P  L     A  RI QA+ + ++I++
Sbjct: 20  HLHPLLQRIYGSRGVSSDAQVK---TDLSSLLK-PDSLKGLPTAVDRIHQALISHQRILV 75

Query: 98  FGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L        +  +P+R   GYG  P ++E        LIITV
Sbjct: 76  VGDFDADGATSSALAVMALRSMGATFVDFLVPNRFDYGYGLTPEIVEVAKQFSPDLIITV 135

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S   +  A   GIDV+V DHH   SE   A A+VNPN+        +L   GVVF
Sbjct: 136 DNGISSISGVDEANRAGIDVVVTDHHLPGSELPKACAIVNPNQPGCEFTSKNLAGVGVVF 195

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            V+  +   LR  +          ++   LDLVAL TV DVVPL   NR  V +GL   R
Sbjct: 196 YVMTALRSQLRSCHWFSDKGLDEPNMADYLDLVALGTVADVVPLDHNNRILVAQGLRRIR 255

Query: 273 R-QGNPGLKALIERVNISSP-ITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PG+K+L+   N S   + + +LG+ +GP +NA GR+ + +LG + L+++D     
Sbjct: 256 AGRSRPGIKSLLNIANRSEHRLVSSDLGFALGPRLNAVGRLDDMSLGIQCLMTNDENLAS 315

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVI-VVEGDRWHPGIVGLLAAR 389
            +A ++D LNQ+R+ +E +M ++A  ++     D         +    WH G++G+LA+R
Sbjct: 316 EIARQMDDLNQDRKSIEGSMQQEALNQLQNIDVDESSLPFGLCLYNGNWHQGVIGILASR 375

Query: 390 LKEKFGRPSFAISF-EEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGL 446
           +KE++ RP  A +  +E+G   GS RSI G  I   +    A    IL K GGHAMAAG+
Sbjct: 376 IKERYHRPVIAFADSDEEGMIKGSARSIPGLHIRDALDAVAASHPHILSKFGGHAMAAGM 435

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           ++E+  +      F +     +       +   DG L ++ +N+ L  +L   GP+G   
Sbjct: 436 SLEKQYYHEFETAFDREVRRQLTEDDLQAIIFSDGELASADINLDLAQLLRDGGPWGQHF 495

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET--LQAIAFRVYGTPLGEFLMQSRGKR 564
           P P+F      L   R+V   HL+M     D +   + AIAF V      E     +   
Sbjct: 496 PEPMFDGT-FTLLQQRIVGEKHLKMVLGVGDDKQQIIDAIAFNVDT----ECWPNPQATH 550

Query: 565 MHVTGHLCVNYWRGSKRCQLRVLDASPV 592
           + V   L VN +RG +  QL V   S V
Sbjct: 551 VAVAYKLDVNDFRGKQTVQLLVDHISVV 578


>gi|229062104|ref|ZP_04199429.1| Exonuclease RecJ [Bacillus cereus AH603]
 gi|228717256|gb|EEL68931.1| Exonuclease RecJ [Bacillus cereus AH603]
          Length = 773

 Score =  412 bits (1058), Expect = e-112,   Method: Composition-based stats.
 Identities = 177/589 (30%), Positives = 283/589 (48%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW      E       +  K  +  +V  + + R ++ +    DFLN +      DP +L
Sbjct: 7   RWKEKEYNE--ELVSELANKLQLSPLVTSLFLGRGLNTEDKIVDFLN-TADQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L         YIP+R  +GY
Sbjct: 64  EGMDRTVERVKKAIENGEQILIFGDYDADGVSSTTVLYLALKELGAEVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLEGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ + P INA GR+ ++
Sbjct: 233 LHGENRLLVQRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFALAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +S +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLSIDPHKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  ++      P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLNMNDVDELRRRLNEQADVVLTEEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  +  L+SIR +    +HL+M    +   TL  I F     
Sbjct: 470 EEMQKLAPFGVGNPKPRIAVKDADLESIRAIGSDGSHLKMALR-EGQATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G + +N W   K+ QL V D +      F  +
Sbjct: 527 --AYAKEISPVAKVSVVGEVSINEWNNFKKPQLMVQDIAVEAWQLFDWR 573


>gi|330950728|gb|EGH50988.1| single-stranded-DNA-specific exonuclease RecJ [Pseudomonas syringae
           Cit 7]
          Length = 571

 Score =  412 bits (1058), Expect = e-112,   Method: Composition-based stats.
 Identities = 179/564 (31%), Positives = 285/564 (50%), Gaps = 20/564 (3%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
            +P ++ R+   R V+ +     L+ S+  L+P    L   D A   +V A+   ++++I
Sbjct: 17  DLPPLLTRLYAARGVACE---AELDKSLARLIPY-QQLKGIDAAVDLLVTALREGQRMLI 72

Query: 98  FGDYDVDGAASVALMMRFLSHCSV-NANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA +  + +  L      + +  +P+R   GYG  P ++E  +    QL+ITV
Sbjct: 73  VGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEVALQREPQLLITV 132

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + +  A   G+ V+V DHH    E   A A+VNPN+         L   GV+F
Sbjct: 133 DNGISSVEGVAAAKAAGLQVLVTDHHLPGHELPAADAIVNPNQPGCTFPSKSLAGVGVIF 192

Query: 217 LVLVLIYRILRQDNKV----PLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            VL+ +   LR+            +L  LLDLVAL +V DVVPL   NR  V +GLM  R
Sbjct: 193 YVLMALRARLRETGWFESNQRAQPNLGELLDLVALGSVADVVPLDANNRILVHQGLMRIR 252

Query: 273 R-QGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
             +  PGL+A++E        IT+ +LG+++GP +NA GR+ + +LG   L+ DD     
Sbjct: 253 AGRARPGLRAILEVARREPSRITSTDLGFILGPRLNAAGRLDDMSLGIECLLCDDPTLAR 312

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            +A++LD LNQ+R+ +E  M  +A A++     +     + + + + WH G++G+LA+RL
Sbjct: 313 EMAVQLDELNQDRKSIEQGMQREALAQLKDLPVESMPFGLCLFDAE-WHQGVIGILASRL 371

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVS--FAVEEGILVKGGGHAMAAGLTV 448
           KE++ RP+ A +   +G   GS RS+ GF I   +    A    ++ K GGHAMAAGL++
Sbjct: 372 KERYHRPTIAFASAGEGVLKGSARSVPGFHIRDALDAVAASHPHLISKFGGHAMAAGLSL 431

Query: 449 ERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPN 508
              NF    + F       +     T     DG L     ++ L   L +AGP+G   P 
Sbjct: 432 PEENFPAFAEAFDLEVRRQLDEQDLTGRLLSDGSLAVEEFHLELARALRNAGPWGQHFPE 491

Query: 509 PVFAFPNHKLQSIRVVNLAHLQMTFESQ-DSETLQAIAFRVYGTPLGEFLMQSRGKRMHV 567
           P+F     +L   RVV   HL+M  +++  S  L  IAF V      +       + + +
Sbjct: 492 PLFHG-VFQLVEQRVVGERHLKMVLKTECGSVKLDGIAFGVDR----DVWPNPNIRWVEL 546

Query: 568 TGHLCVNYWRGSKRCQLRVLDASP 591
              L +N +RG++  QL V+  +P
Sbjct: 547 AYKLDLNEFRGNETVQLMVVHIAP 570


>gi|269959608|ref|ZP_06173989.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio harveyi 1DA3]
 gi|269835666|gb|EEZ89744.1| single-stranded-DNA-specific exonuclease RecJ [Vibrio harveyi 1DA3]
          Length = 579

 Score =  412 bits (1058), Expect = e-112,   Method: Composition-based stats.
 Identities = 178/569 (31%), Positives = 277/569 (48%), Gaps = 25/569 (4%)

Query: 38  AIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMI 97
           +IP I+ R+ +NR ++       L  S R L      L   DKA   + QAI   ++I++
Sbjct: 18  SIPAILKRIYINRGITD---VAQLETSARGLHSY-QQLGGIDKAVELLFQAIDEKKRIIV 73

Query: 98  FGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITV 156
            GD+D DGA S AL +  L     N  +  +P+R  DGYG +P ++++ +  GA++I+TV
Sbjct: 74  VGDFDADGATSSALSVLALRMLGSNNVDYLVPNRFEDGYGLSPEVVDQALELGAEMIMTV 133

Query: 157 DCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVF 216
           D G +S + ++YA   GI V+V DHH          A+VNPN          L   GV F
Sbjct: 134 DNGVSSIEGVRYAKENGITVLVTDHHLPGQVLPDVDAMVNPNLDSCAFPSKALAGVGVAF 193

Query: 217 LVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVAR 272
            +++ +   +R+ N           L+ L+DLVAL TV DVVPL   NR  V +GL   R
Sbjct: 194 YLMMALCVHMRKQNWFAQQGMQEPKLMELIDLVALGTVADVVPLDENNRILVHQGLQRIR 253

Query: 273 RQG-NPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
                PG++ALIE        + A + G+ +GP INA GR+ + + G  LL+ ++     
Sbjct: 254 AGKARPGIQALIEVAKRDARRLVASDFGFALGPRINAAGRLDDMSFGVELLMCNNIHAAR 313

Query: 331 MLAMKLDVLNQNRRLMES--AMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAA 388
            +A +LD LNQ R+ +E        A  + L   ++ +    + +    WH G++G+LA+
Sbjct: 314 RMASELDGLNQTRKEIEEGMKQEAMAFCERLQFGENSELPYGLALFQRDWHQGVIGILAS 373

Query: 389 RLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFA--VEEGILVKGGGHAMAAGL 446
           R+KEKF RP  A +   +G   GS RSI G  +   + F      G+++K GGHAMAAGL
Sbjct: 374 RIKEKFHRPVIAFADGGEGTIKGSCRSIPGLHMRDALDFIDTQNPGLIIKFGGHAMAAGL 433

Query: 447 TVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGN 506
           T++  +F R    F       +       V   DG L     ++ + + L S GP+G   
Sbjct: 434 TIKEQDFERFSRLFDDVVKKELDEAALKGVIMSDGELKPEEFSMHVAEQLRSGGPFGQAF 493

Query: 507 PNPVFAFPNHKLQSIRVVNLAHLQMTFES-----QDSETLQAIAFRVYGTPLGEFLMQSR 561
           P P+F     K+   ++V   HL++  E        +  +  IAF V      +    + 
Sbjct: 494 PEPIFDGE-FKVLHQKLVGEKHLKLMLEPLYKGHPTNVMIDGIAFNVDLRRWPD----AS 548

Query: 562 GKRMHVTGHLCVNYWRGSKRCQLRVLDAS 590
            K + +   L VN +RG++  QL +    
Sbjct: 549 VKTVRLAYKLDVNEFRGNQSLQLMIDHIE 577


>gi|197285861|ref|YP_002151733.1| single-stranded-DNA-specific exonuclease [Proteus mirabilis HI4320]
 gi|227356362|ref|ZP_03840750.1| single-stranded-DNA-specific exonuclease [Proteus mirabilis ATCC
           29906]
 gi|194683348|emb|CAR44055.1| single-stranded-DNA-specific exonuclease [Proteus mirabilis HI4320]
 gi|227163472|gb|EEI48393.1| single-stranded-DNA-specific exonuclease [Proteus mirabilis ATCC
           29906]
          Length = 577

 Score =  412 bits (1058), Expect = e-112,   Method: Composition-based stats.
 Identities = 185/584 (31%), Positives = 289/584 (49%), Gaps = 22/584 (3%)

Query: 19  VSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDC 78
           +    +  + +A A+ +  ++  ++ ++  NR ++ +     L  S++ L+     L   
Sbjct: 4   IEPTLRRRVAKATALPE--SLDPLLRQIYANRGITSE---TQLERSLKGLLHY-QDLNGI 57

Query: 79  DKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVN-ANMYIPDRIVDGYGP 137
           D A   +V+A+    +I+I GD+D DGA S AL ++ L        + +IP+R  DGYG 
Sbjct: 58  DVAISLLVEALKLQSRIVIVGDFDADGATSTALAIKALRQMGFQQVSYHIPNRFDDGYGL 117

Query: 138 NPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNP 197
           +P ++     +G  LIITVD G +S++ +  A   GI V+V DHH        A A++NP
Sbjct: 118 SPQVVHDVAKKGVDLIITVDNGISSFEGVDVAHEYGIRVLVTDHHLPGHSLPQADAIINP 177

Query: 198 NRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN----FDLLSLLDLVALATVCDV 253
           N  D       L   GV F ++  +   L +            ++   LDLVAL TV DV
Sbjct: 178 NLADCAFLSKSLAGVGVTFYLMTALRAELEKQGWFTAQGLARPNMADYLDLVALGTVADV 237

Query: 254 VPLIGLNRAYVVKGLMVARR-QGNPGLKALIERVNIS-SPITAENLGYMIGPSINAGGRI 311
           VPL   NR +V +GL   R  +   G+KAL E    + S + + +LG+ +GP +NA GR+
Sbjct: 238 VPLDENNRIFVYEGLRRIRAGRCCAGIKALTEVSRKTLSQLVSSDLGFALGPRLNAAGRL 297

Query: 312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQ-ASV 370
            + ++G  LL+++D      +A +LD LNQ RR +E+ M E+A               + 
Sbjct: 298 DDMSVGVALLLTNDIGVAREIANELDGLNQTRREIEAGMQEEASTIFRQFITTQDDLPNG 357

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAV- 429
           + +   +WH G+VG+LA+R+KEK  RP  A +   DG   GSGRSI G  +   +     
Sbjct: 358 LAIYHPQWHQGVVGILASRIKEKLHRPVIAFAPSGDGLLKGSGRSIHGVHLRDALERLNT 417

Query: 430 -EEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAV 488
              G++VK GGHAMAAGL++E   F      F      +V A     V   DG L+ S +
Sbjct: 418 LNPGLMVKFGGHAMAAGLSLEEDKFPLFQRHFSALMAELVSAEQLQGVILTDGELSDSQL 477

Query: 489 NIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSET-LQAIAFR 547
           ++ + +ML  AGP+G   P P+F      L   R+V   HL+M  +  +S   + AIAF 
Sbjct: 478 SLPIAEMLREAGPWGQAFPEPLFDGK-FTLLQQRIVGSKHLKMMLQPINSHVMIDAIAFN 536

Query: 548 VYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASP 591
           V      +    +  K + +   L VN +RG +  QL V    P
Sbjct: 537 VDVNIWPD----NSIKTVELAYRLDVNEFRGQRNAQLLVEHIWP 576


>gi|196039251|ref|ZP_03106557.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus cereus
           NVH0597-99]
 gi|228917045|ref|ZP_04080605.1| Exonuclease RecJ [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|196029878|gb|EDX68479.1| single-stranded-DNA-specific exonuclease RecJ [Bacillus cereus
           NVH0597-99]
 gi|228842652|gb|EEM87740.1| Exonuclease RecJ [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
          Length = 779

 Score =  412 bits (1058), Expect = e-112,   Method: Composition-based stats.
 Identities = 178/589 (30%), Positives = 280/589 (47%), Gaps = 27/589 (4%)

Query: 17  RWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDY-AKDFLNPSIRLLMPDPLIL 75
           RW          R   +  K  +  +V  + + R +  +    DFLN        DP +L
Sbjct: 7   RWKEKEYN--GERVSELASKLQLSPLVVSLFLGRGLDTEDKILDFLNTE-NQEFHDPFLL 63

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
              D+   R+ +AI N E+I+IFGDYD DG +S  ++   L     +   YIP+R  +GY
Sbjct: 64  EGMDRTVERVNKAIQNGEQILIFGDYDADGVSSTTVLYLALQELGADVEFYIPNRFTEGY 123

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           GPN        + G  LIITVD G  +    + A   GID+I+ DHH+   E   A A++
Sbjct: 124 GPNEEAFRWAHSAGFSLIITVDTGIAAVHEAKVAKELGIDLIITDHHEPPPELPEALAII 183

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P     +    +L   GV F V   +   + +            LL++  + TV D+V 
Sbjct: 184 HPKLDGGVYPFHYLAGVGVAFKVAHALLGRVPE-----------HLLEIAVIGTVADLVS 232

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISS-PITAENLGYMIGPSINAGGRIGES 314
           L G NR  V +GL   R   N GLKAL +  N+S   IT E++G+ I P INA GR+ ++
Sbjct: 233 LHGENRLLVKRGLKHMRMTKNIGLKALFKVANVSQSEITEESIGFSIAPRINAVGRLEDA 292

Query: 315 NLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVE 374
                LL+S+D +E + LA ++D LN+ R+ +   + E+A A+V       +   V+V+ 
Sbjct: 293 TPAVHLLLSEDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENK-VLVLA 351

Query: 375 GDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKG-IGSGRSIEGFDIGKMVSFAVEEGI 433
            + W+PG++G++A++L E+F RP+  +  +   +   GS RSI GFD+    + +    +
Sbjct: 352 KEGWNPGVIGIVASKLVERFYRPTIVLCIDPVKETAKGSARSIAGFDL--FANLSDCREL 409

Query: 434 LVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI 493
           L   GGH MAAG+T+   +   L     + A  I+      P+  +D       V +A I
Sbjct: 410 LPHFGGHPMAAGMTLHMNDVDELRRRLNEQAEEILTEEDFIPITAVDAFCKVEDVTLAAI 469

Query: 494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVN--LAHLQMTFESQDSETLQAIAFRVYGT 551
           + ++   P+G GNP P  A  + +L+SIR +    +HL+M        TL  I F     
Sbjct: 470 EDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQ-ATLDTIGFGFG-- 526

Query: 552 PLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK 600
                   S   ++ V G   +N W   K+ QL V D +      F  +
Sbjct: 527 --AYAKEISPVAKVSVIGEASINEWNNFKKPQLMVQDIAVEAWQLFDWR 573


>gi|238018953|ref|ZP_04599379.1| hypothetical protein VEIDISOL_00813 [Veillonella dispar ATCC 17748]
 gi|237864437|gb|EEP65727.1| hypothetical protein VEIDISOL_00813 [Veillonella dispar ATCC 17748]
          Length = 660

 Score =  412 bits (1058), Expect = e-112,   Method: Composition-based stats.
 Identities = 188/584 (32%), Positives = 290/584 (49%), Gaps = 24/584 (4%)

Query: 13  ISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDP 72
           I   RW      +       + ++  +  IVA+++VNR++ +D  + FL  S+  L+ DP
Sbjct: 2   IKKKRWRISTSDKEQENI--LIRELGVNPIVAKLMVNRHIDVDEGRKFLQGSLSDLL-DP 58

Query: 73  LILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIV 132
             L D D A   + + I N + I+I+GDYDVDG  + +++ RFL     +   YIP+R  
Sbjct: 59  FALKDMDVAVSLVQETIENHKPIVIYGDYDVDGITATSVLYRFLKKLGADVTYYIPERQS 118

Query: 133 DGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAY 192
           +GYG N   +E  I +G  L+ITVDCG +SYD ++   ++ ID+I+ DHH        A 
Sbjct: 119 EGYGLNFEALEHLIEQGTSLVITVDCGISSYDIVEAVRDR-IDMIITDHHTAPDLIPRAK 177

Query: 193 ALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCD 252
           A++N  + D      +L   GV F +   ++               L  LD+VAL TV D
Sbjct: 178 AVINHKQKDCPYKDKNLSGVGVAFKLCQALW-------LTKYGEWYLDDLDIVALGTVAD 230

Query: 253 VVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVN-ISSPITAENLGYMIGPSINAGGRI 311
           VVPL+G NR  V  GL       N G+K LI+        IT+ ++G+ + P +NA GR+
Sbjct